Download Quadra-Fire VOYAGEUR-PMH Owner`s manual
Transcript
R VOYAGEUR GRAND WOOD INSERT Automatic ComEustion Control ACC OWNER’S MANUAL Installation and OSeration Model: VOYA-GRAND-MBK VOYA-GRAND-PMH CAUTION DO NOT DISCARD THIS MANUAL ,PSRUWDQW RSHUDWLQJ D Q G P D L Q W H Q D Q F H LQVWUXFWLRQVLQFOXGHG 5HDG XQGHUVWDQG DQG IROORZWKHVHLQVWUXFWLRQV IRUVDIHLQVWDOODWLRQDQG RSHUDWLRQ WARNING WARNING HOT SURFACES! If the information in these instructions is not followed exactly, a ¿re may result causinJ SroSerty damaJe, Sersonal inMury, or death 'RQRWVWRUHRUXVHJDVROLQHRURWKHUÀDPPDEOHYDSRUVDQGOLTXLGVLQWKHYLFLQLW\RI WKLVRUDQ\RWKHUDSSOLDQFH 'RQRWRYHU¿UH,IKHDWHURUFKLPQH\FRQQHFWRUJORZV\RXDUHRYHU¿ULQJ2YHU¿ULQJ ZLOOYRLG\RXUZDUUDQW\ &RPSO\ZLWKDOOPLQLPXPFOHDUDQFHVWR FRPEXVWLEOHVDVVSHFL¿HG)DLOXUHWR FRPSO\PD\FDXVHKRXVH¿UH WARNING *ODVVDQGRWKHUVXUIDFHVDUH KRWGXULQJRSHUDWLRQ$1' FRROGRZQ Hot Jlass will cause Eurns 'RQRWWRXFKJODVVXQWLOLWLVFRROHG 1(9(5DOORZFKLOGUHQWRWRXFKJODVV .HHSFKLOGUHQDZD\ &$5()8//<683(59,6(FKLOGUHQLQVDPHURRPDV ¿UHSODFH $OHUWFKLOGUHQDQGDGXOWVWRKD]DUGVRIKLJK WHPSHUDWXUHV HiJh temSeratures may iJnite clothinJ or other ÀammaEle materials .HHSFORWKLQJIXUQLWXUHGUDSHULHVDQGRWKHU ÀDPPDEOHPDWHULDOVDZD\ )ire RisN NOTE )RUXVHZLWKVROLGZRRGIXHORQO\ 2WKHUIXHOVPD\RYHU¿UHDQGJHQHUDWH SRLVRQRXVJDVHVLHFDUERQPRQR[LGH 7RREWDLQD)UHQFKWUDQVODWLRQRIWKLVPDQXDOSOHDVH FRQWDFW\RXUGHDOHURUYLVLWZZZTXDGUD¿UHFRP ,QVWDOODWLRQDQGVHUYLFHRIWKLVDSSOLDQFHVKRXOG EHSHUIRUPHGE\TXDOL¿HGSHUVRQQHO+HDUWK +RPH7HFKQRORJLHVUHFRPPHQGV1),FHUWL¿HG SURIHVVLRQDOVRUWHFKQLFLDQVVXSHUYLVHGE\DQ1), FHUWL¿HGSURIHVVLRQDO May 23, 2013 /HDYHWKLVPDQXDOZLWK SDUW\ UHVSRQVLEOH IRU XVHDQGRSHUDWLRQ $ $) /. 3# / !2 4 $ 3RXUREWHQLUXQHWUDGXFWLRQIUDQoDLVHGHFHPDQXHOV¶LO YRXVSODvWFRQWDFWHUYRWUHUHYHQGHXURXYLVLWH]ZZZ TXDGUD¿UHFRP 7075-166C Page 1 R VOYAGEUR GRAND Wood Insert and Welcome to the Quadra-Fire Family! Hearth & Home Technologies welcomes you to our tradition of excellence! In choosing a Quadra-Fire appliance, you have our assurance of commitment to quality, durability, and performance. RIRXUVWRYHVLQVHUWVDQG¿UHSODFHV$QG\HWZHDUHROG fashioned when it comes to craftsmanship. Each unit is meticulously fabricated and gold and nickel surfaces are KDQG¿QLVKHGIRUODVWLQJEHDXW\DQGHQMR\PHQW2XUSOHGJH to quality is completed as each model undergoes a quality control inspection. This commitment begins with our research of the market, including ‘Voice of the Customer’ contacts, ensuring we make products that will satisfy your needs. Our Research and Development facility then employs the world’s most advanced technology to achieve the optimum operation :HZLVK\RXDQG \RXUIDPLO\PDQ\\HDUVRIHQMR\PHQW LQ the warmth and comfort of your hearth appliance. Thank you for choosing Quadra-Fire. NOTE: Clearances may only be reduced by means approved by the regulatory authority having jurisdiction SAMPLE OF SERIAL NUMBER / SAFETY LABEL LOCATION: UNDER ASH LIP, PULL OUT TO VIEW LISTED ROOM HEATER, SOLID FUEL TYPE. "For Use with Solid Wood Fuel Only." Also for use in Mobile Home. PREVENT HOUSE FIRES E Maximum Mantel Depth - 12 inch (305mm) Mantel Fascia or Trim L SideWall B C Insert A D M P Fuel Door E F Hearth Extension Minimum Clearances To Combustible Material Masonry, Heat Circulating & Factory-Built Refer to Clearances on other label for Canada USA ONLY 21.5 in. 25 in. 23 in. 11.5 in. 16 in. 8 in. A Sidewall to Fuel Loading Door Mantel to Top of unit Top Trim to Top of unit Side Trim to Fuel Loading Door Hearth Extension from Glass Hearth Extenson from Fuel Loading Door S A B C D E F Factory-Built Floor Protection under Hearth Extension Thermal & Ember Protection Floor height 0 to 5 inches below Insert Base: Materials with R value of 2.38 required. Ember Protection Only Greater than 5 inches below Insert Base: HOT WHILE IN OPERATION DO NOT CAUTION: TOUCH, KEEP CHILDREN, CLOTHING AND FURNITURE AWAY. CONTACT MAY CAUSE SKIN BURNS. SEE NAMEPLATE AND INSTRUCTIONS. R Test Lab & Report Number Serial Number Serial No. Model: 007045 VOYAGEUR ETL4001508 CONFORMS TO: UL 1482, ULC S628-93 Mfg by: GRAND WOOD INSERT 1445 N. Highway, Colville, WA 99114 www.quadrafire.com U.S. ENVIRONMENTAL PROTECTION AGENCY - Certified to comply with July 1990 particulate emission standards. JAN FEB MAR APR MAY JUN JUL AUG SEP OCT NOV DEC 2012 2013 2014 DO NOT REMOVE THIS LABEL Model Name Mfg Date Made in U.S.A. of US and imported parts. 7075-174 Page 2 7075-166C May 23, 2013 R VOYAGEUR GRAND Wood Insert ! Safety Alert Key: DANGER! Indicates a hazardous situation which, if not avoided willUHVXOWLQGHDWKRUVHULRXVLQMXU\ WARNING! Indicates a hazardous situation which, if not avoided mayUHVXOWLQGHDWKRUVHULRXVLQMXU\ CAUTION! Indicates a hazardous situation which, if not avoided, mayUHVXOWLQPLQRURUPRGHUDWHLQMXU\ NOTICE: Indicates practices which may cause damage to the appliance or to property. TABLE OF CONTENTS Congratulations ...............................................................2 Sample of Safety/Serial Number Label ...........................2 Warranty Policy ...............................................................4-5 Installer’s Guide Section 6: Getting Started Section 1: Listing and Code Approvals $ % & ' $SSOLDQFH&HUWL¿FDWLRQV.....................................6 0RELOH+RPH$SSURYHG.....................................6 *ODVV6SHFL¿FDWLRQV ..........................................6 %78(I¿FLHQF\6SHFL¿FDWLRQV ........................6 User’s Guide Section 2: Operating Instructions $ B. & D. E. F. * + , - K. L. M. N. O. P. 4 5 S. <RXU:RRG$SSOLDQFH .......................................7 Fire Safety .........................................................8 2YHU¿ULQJ...........................................................8 Combustible/Non-combustible Material ............8 Seasoned Wood................................................8 Burning Process ................................................9 $XWRPDWLF&RPEXVWLRQ&RQWURO$&& ..............10 $LU&RQWUROV .......................................................10 %XUQ5DWHVDQG2SHUDWLQJ(I¿FLHQF\ ................10 &RUUHFW%DIÀH%ODQNHW3ODFHPHQW ..................11 Building a Fire ...................................................12 Fuel Reloading Instructions...............................12 Wood Fuel & Storage ........................................13 Blower Control Box Snap Disc Operations .......14 Blower Operating Instructions ...........................14 Clear Space ......................................................15 )UHTXHQWO\$VNHG4XHVWLRQV .............................15 2SDFLW\6PRNH ...............................................15 Quick Start Guide ..............................................16 Section 3: Maintenance and Service $ 'LVSRVDORI$VKHV .............................................17 B. Chimney & Chimney Connector Inspection/Cleaning...........................................17 & $SSOLDQFH,QVSHFWLRQ5RXWLQH .........................17 D. Cleaning of Plated Surfaces..............................17 E. Glass Cleaning ..................................................18 F. Firebrick Inspection & Replacement Instruction 18 G. Quick Reference Maintenance Guide ...............19 Section 7: Dimensions and Clearances *ODVV5HSODFHPHQW ...........................................21 Snap Disc Replacement....................................21 Wiring Diagram .................................................21 Blower Replacement .........................................22 'RRU+DQGOH$VVHPEO\ .....................................23 %DIÀH&HUDPLF%ODQNHW5HPRYDO ...................23 7XEH&KDQQHO$VVHPEO\5HSODFHPHQW .............24 May 23, 2013 $ B. C. D. E. F. G. + I. J. K. 9HQWLQJ6\VWHPV ...............................................34 Inspections ........................................................34 Larger Chimneys ...............................................34 Masonry Chimney .............................................34-35 Metal Heat Circulating Chimney........................36 Prefabricated Metal Chimney ............................36 Securing Chimney Components .......................37 $OWHULQJWKH)LUHSODFH ........................................37 Factory-Built Solid Fuel Fireplaces ...................37 Ovalizing Round Stainless Steel Liners ............38 Chimney Height / Rise and Run ........................38 Section 9: Appliance Set-up $ % C. D. ( F. G. + I. 2XWVLGH$LU,QVWDOODWLRQ ......................................39 2SWLRQDO(OERZ)OXH$GDSWHU,QVWDOODWLRQ ..........40 Securing Stove Pipe/Liner to Flue Collar ..........40 Leveling Legs ....................................................40 6HFXULQJ$SSOLDQFHWR6WRYH3LSH/LQHU ............41 Standard Surround & Trim Installation ..............41 Standard Surround & Cast Trim, .......................42 $OO&DVW6XUURXQG ..............................................43 Blower Cord Installation - Left Side ...................43-45 Section 10: Moble Home Installation ................. 46 Section 5: Service Parts Replacement $ B. C. D. ( ) * $ $SSOLDQFH'LPHQVLRQV.......................................30 B. Clearances to Combustibles 8/DQG8/& and Hearth Protection Requirements ................31-32 & $OWHUQDWH)ORRU3URWHFWLRQ&DOFXODWLRQ...............33 Section 8: Chimney Systems Section 4: Troubleshooting Guide ..................... 20 $ 'HVLJQ,QVWDOODWLRQ/RFDWLRQ Considerations ..................................................25 B. Draft ..................................................................25 C. Negative Pressure.............................................26 ' /RFDWLQJ<RXU$SSOLDQFHDQG&KLPQH\ .............27 E. Chimney Termination Requirements.................27 F. 2-10-3 Rule .......................................................28 G. Tools and Supplies Needed ..............................29 H. Fire Safety .........................................................29 , ,QVSHFW$SSOLDQFHDQG&RPSRQHQWV and Pre-Burn Checklist .....................................29 Section 11: Reference Materials 7075-166C $ % C. D. E. ([SORGHG'UDZLQJV ...........................................47 6HUYLFH3DUWV$FFHVVRULHV .............................48-52 Service Maintenance Log..................................53-54 Homeowners notes ...........................................55 Contact Information ...........................................56 Page 3 R VOYAGEUR GRAND Wood Insert Hearth & Home Technologies Inc. LIMITED LIFETIME WARRANTY Hearth & Home Technologies Inc., on behalf of its hearth brands (”HHT”), extends the following warranty for HHT gas, wood, pellet, coal and electric hearth appliances that are purchased from an HHT authorized dealer. WARRANTY COVERAGE: HHT warrants to the original owner of the HHT appliance at the site of installation, and to any transferee taking ownership of the appliance at the site of installation within two years following the date of original purchase, that the HHT appliance will be free from defects in materials and workmanship at the time of manufacture. After installation, if covered components manufactured by HHT are found to be defective in materials or workmanship during the applicable warranty period, HHT will, at its option, repair or replace the covered components. HHT, at its own discretion, may fully discharge all of its obligations under such warranties by replacing the product itself or refunding the verified purchase price of the product itself. The maximum amount recoverable under this warranty is limited to the purchase price of the product. This warranty is subject to conditions, exclusions and limitations as described below. WARRANTY PERIOD: Warranty coverage begins on the date of original purchase. In the case of new home construction, warranty coverage begins on the date of first occupancy of the dwelling or six months after the sale of the product by an independent, authorized HHT dealer/ distributor, whichever occurs earlier. The warranty shall commence no later than 24 months following the date of product shipment from HHT, regardless of the installation or occupancy date. The warranty period for parts and labor for covered components is produced in the following table. The term “Limited Lifetime” in the table below is defined as: 20 years from the beginning date of warranty coverage for gas appliances, and 10 years from the beginning date of warranty coverage for wood, pellet, and coal appliances. These time periods reflect the minimum expected useful lives of the designated components under normal operating conditions. Warranty Period Parts Labor 1 Year 2 years HHT Manufactured Appliances and Venting Gas X X Wood X X X 3 years Pellet EPA Wood Coal X X X X X X X X X Components Covered Electric Venting X X All parts and material except as covered by Conditions, Exclusions, and Limitations listed Igniters, electronic components, and glass Factory-installed blowers Molded refractory panels Firepots and burnpots X 5 years 1 year 7 years 3 years 10 years 1 year X Limited 3 years Lifetime X X X X X 90 Days X X X X X X X X Castings and baffles X X Manifold tubes, HHT chimney and termination Burners, logs and refractory Firebox and heat exchanger X X All replacement parts beyond warranty period See conditions, exclusions, and limitations on next page. 4021-645C 12-29-10 Page 4 Page 1 of 2 7075-166C May 23, 2013 R VOYAGEUR GRAND Wood Insert WARRANTY CONDITIONS: 7KLVZDUUDQW\RQO\FRYHUV++7DSSOLDQFHVWKDWDUHSXUFKDVHGWKURXJKDQ++7DXWKRUL]HGGHDOHURUGLVWULEXWRU$OLVWRI ++7DXWKRUL]HGGHDOHUVLVDYDLODEOHRQWKH++7EUDQGHGZHEVLWHV 7KLVZDUUDQW\LVRQO\YDOLGZKLOHWKH++7DSSOLDQFHUHPDLQVDWWKHVLWHRIRULJLQDOLQVWDOODWLRQ &RQWDFW\RXULQVWDOOLQJGHDOHUIRUZDUUDQW\VHUYLFH,IWKHLQVWDOOLQJGHDOHULVXQDEOHWRSURYLGHQHFHVVDU\SDUWVFRQWDFW WKHQHDUHVW++7DXWKRUL]HGGHDOHURUVXSSOLHU$GGLWLRQDOVHUYLFHIHHVPD\DSSO\LI\RXDUHVHHNLQJZDUUDQW\VHUYLFH IURPDGHDOHURWKHUWKDQWKHGHDOHUIURPZKRP\RXRULJLQDOO\SXUFKDVHGWKHSURGXFW &KHFNZLWK\RXUGHDOHULQDGYDQFHIRUDQ\FRVWVWR\RXZKHQDUUDQJLQJDZDUUDQW\FDOO7UDYHODQGVKLSSLQJFKDUJHV IRUSDUWVDUHQRWFRYHUHGE\WKLVZDUUDQW\ WARRANTY EXCLUSIONS: 7KLVZDUUDQW\GRHVQRWFRYHUWKHIROORZLQJ &KDQJHVLQVXUIDFHILQLVKHVDVDUHVXOWRIQRUPDOXVH$VDKHDWLQJDSSOLDQFHVRPHFKDQJHVLQFRORURILQWHULRUDQG H[WHULRUVXUIDFHILQLVKHVPD\RFFXU7KLVLVQRWDIODZDQGLVQRWFRYHUHGXQGHUZDUUDQW\ 'DPDJHWRSULQWHGSODWHGRUHQDPHOHGVXUIDFHVFDXVHGE\ILQJHUSULQWVDFFLGHQWVPLVXVHVFUDWFKHVPHOWHGLWHPV RURWKHUH[WHUQDOVRXUFHVDQGUHVLGXHVOHIWRQWKHSODWHGVXUIDFHVIURPWKHXVHRIDEUDVLYHFOHDQHUVRUSROLVKHV 5HSDLURUUHSODFHPHQWRISDUWVWKDWDUHVXEMHFWWRQRUPDOZHDUDQGWHDUGXULQJWKHZDUUDQW\SHULRG7KHVHSDUWV LQFOXGHSDLQWZRRGSHOOHWDQGFRDOJDVNHWVILUHEULFNVJUDWHVIODPHJXLGHVOLJKWEXOEVEDWWHULHVDQGWKHGLVFRORUDWLRQRIJODVV 0LQRUH[SDQVLRQFRQWUDFWLRQRUPRYHPHQWRIFHUWDLQSDUWVFDXVLQJQRLVH7KHVHFRQGLWLRQVDUHQRUPDODQGFRPSODLQWVUHODWHGWRWKLVQRLVHDUHQRWFRYHUHGE\WKLVZDUUDQW\ 'DPDJHVUHVXOWLQJIURPIDLOXUHWRLQVWDOORSHUDWHRUPDLQWDLQWKHDSSOLDQFHLQDFFRUGDQFHZLWKWKHLQVWDOODWLRQ LQVWUXFWLRQVRSHUDWLQJLQVWUXFWLRQVDQGOLVWLQJDJHQWLGHQWLILFDWLRQODEHOIXUQLVKHGZLWKWKHDSSOLDQFHIDLOXUHWR LQVWDOOWKHDSSOLDQFHLQDFFRUGDQFHZLWKORFDOEXLOGLQJFRGHVVKLSSLQJRULPSURSHUKDQGOLQJLPSURSHURSHUDWLRQDEXVHPLVXVHFRQWLQXHGRSHUDWLRQZLWKGDPDJHGFRUURGHGRUIDLOHGFRPSRQHQWVDFFLGHQWRULPSURSHUO\ LQFRUUHFWO\SHUIRUPHGUHSDLUVHQYLURQPHQWDOFRQGLWLRQVLQDGHTXDWHYHQWLODWLRQQHJDWLYHSUHVVXUHRUGUDIWLQJ FDXVHGE\WLJKWO\VHDOHGFRQVWUXFWLRQVLQVXIILFLHQWPDNHXSDLUVXSSO\RUKDQGOLQJGHYLFHVVXFKDVH[KDXVWIDQVRU IRUFHGDLUIXUQDFHVRURWKHUVXFKFDXVHVXVHRIIXHOVRWKHUWKDQWKRVHVSHFLILHGLQWKHRSHUDWLQJLQVWUXFWLRQV LQVWDOODWLRQRUXVHRIFRPSRQHQWVQRWVXSSOLHGZLWKWKHDSSOLDQFHRUDQ\RWKHUFRPSRQHQWVQRWH[SUHVVO\DXWKRUL]HG DQGDSSURYHGE\++7PRGLILFDWLRQRIWKHDSSOLDQFHQRWH[SUHVVO\DXWKRUL]HGDQGDSSURYHGE\++7LQZULWLQJ DQGRULQWHUUXSWLRQVRUIOXFWXDWLRQVRIHOHFWULFDOSRZHUVXSSO\WRWKHDSSOLDQFH 1RQ++7YHQWLQJFRPSRQHQWVKHDUWKFRPSRQHQWVRURWKHUDFFHVVRULHVXVHGLQFRQMXQFWLRQZLWKWKHDSSOLDQFH $Q\SDUWRIDSUHH[LVWLQJILUHSODFHV\VWHPLQZKLFKDQLQVHUWRUDGHFRUDWLYHJDVDSSOLDQFHLVLQVWDOOHG ++7¶VREOLJDWLRQXQGHUWKLVZDUUDQW\GRHVQRWH[WHQGWRWKHDSSOLDQFH¶VFDSDELOLW\WRKHDWWKHGHVLUHGVSDFH,QIRUPDWLRQLVSURYLGHGWRDVVLVWWKHFRQVXPHUDQGWKHGHDOHULQVHOHFWLQJWKHSURSHUDSSOLDQFHIRUWKHDSSOLFDWLRQ&RQVLGHUDWLRQPXVWEHJLYHQWRDSSOLDQFHORFDWLRQDQGFRQILJXUDWLRQHQYLURQPHQWDOFRQGLWLRQVLQVXODWLRQDQGDLUWLJKWQHVVRI WKHVWUXFWXUH This warranty is void if: 7KHDSSOLDQFHKDVEHHQRYHUILUHGRURSHUDWHGLQDWPRVSKHUHVFRQWDPLQDWHGE\FKORULQHIOXRULQHRURWKHUGDPDJLQJ FKHPLFDOV2YHUILULQJFDQEHLGHQWLILHGE\EXWQRWOLPLWHGWRZDUSHGSODWHVRUWXEHVUXVWFRORUHGFDVWLURQEXEEOLQJ FUDFNLQJDQGGLVFRORUDWLRQRIVWHHORUHQDPHOILQLVKHV 7KHDSSOLDQFHLVVXEMHFWHGWRSURORQJHGSHULRGVRIGDPSQHVVRUFRQGHQVDWLRQ 7KHUHLVDQ\GDPDJHWRWKHDSSOLDQFHRURWKHUFRPSRQHQWVGXHWRZDWHURUZHDWKHUGDPDJHZKLFKLVWKHUHVXOWRIEXW QRWOLPLWHGWRLPSURSHUFKLPQH\RUYHQWLQJLQVWDOODWLRQ LIMITATIONS OF LIABILITY: 7KHRZQHU¶VH[FOXVLYHUHPHG\DQG++7¶VVROHREOLJDWLRQXQGHUWKLVZDUUDQW\XQGHUDQ\RWKHUZDUUDQW\H[SUHVVRU LPSOLHGRULQFRQWUDFWWRUWRURWKHUZLVHVKDOOEHOLPLWHGWRUHSODFHPHQWUHSDLURUUHIXQGDVVSHFLILHGDERYH,QQR HYHQWZLOO++7EHOLDEOHIRUDQ\LQFLGHQWDORUFRQVHTXHQWLDOGDPDJHVFDXVHGE\GHIHFWVLQWKHDSSOLDQFH6RPHVWDWHV GRQRWDOORZH[FOXVLRQVRUOLPLWDWLRQRILQFLGHQWDORUFRQVHTXHQWLDOGDPDJHVVRWKHVHOLPLWDWLRQVPD\QRWDSSO\WR\RX 7KLVZDUUDQW\JLYHV\RXVSHFLILFULJKWV\RXPD\DOVRKDYHRWKHUULJKWVZKLFKYDU\IURPVWDWHWRVWDWH(;&(3772 7+((;7(173529,'('%</$:++70$.(612(;35(66:$55$17,(627+(57+$17+(:$55$17< 63(&,),('+(5(,17+('85$7,212)$1<,03/,(':$55$17<,6/,0,7('72'85$7,212)7+( (;35(66(':$55$17<63(&,),('$%29( 4021-645C 12-29-10 May 23, 2013 Page 2 of 2 7075-166C Page 5 R VOYAGEUR GRAND Wood Insert st n nd ode A ro s D BTU Ef¿ciency Speci¿cations A Appliance Certi¿cation ode or tor Re ort No e 92<$*(85*5$1':RRG,QVHUW EPA Certi¿ed: 3.1 grams per hour Intertek Ef¿ciency: 80 UO t 100868597PRT-001 Solid Fuel Type, Listed Room Heater t nd rd L1482 and LC S628-93 and 80+8'0RELOH+RPH $SSURYHG t 10,700 to 28,500 per hr e tn Vent t 1,100 to 2,800 sq ft depending on climate zone e re o 6 inches e 2.35 cubic feet Wood en t e NOTE This installation must conform with local codes. In the absence of local codes you must comply with the L1482, 80+8'DQG13)$LQWKH86$DQGWKH8/&6 DQG&$1&6$%,QVWDOODWLRQ&RGHVLQ&DQDGD o est n NR e or tor ro ed o eA s O N t on A 7KHVWUXFWXUDOLQWHJULW\RIWKHPRELOHKRPHÀRRUFHLOing, and walls must be maintained. The appliance must be properly grounded to the frame of the mobile home with 8 copper ground wire, and use only listed connector pipe. 2XWVLGH$LU.LWSDUW2$.$&&PXVWEHLQVWDOOHGLQD mobile home installation. C Glass Speci¿cations This stove is equipped with 5mm ceramic glass. Replace glass only with 5mm ceramic glass. Please contact your dealer for replacement glass. 389 lbs Fire Risk. This appliance is approved for mobile home installations when not installed in a sleeping room and when an outside combustion air inlet is provided. t :$51,1* Re o n ed ro ed Cord Wood n We 7KH4XDGUD)LUH92<$*(85*5$1'PHHWVWKH86(QYLURQPHQWDO 3URWHFWLRQ$JHQF\¶V SDUWLFXODWH HPLVVLRQ standards. Interte est 21 inches Hearth & Home Technologies disclaims any responsibility for, and the warranty will be voided by, the following actions ,QVWDOODWLRQDQGXVHRIDQ\GDPDJHGDSSOLDQFH 0RGL¿FDWLRQRIWKHDSSOLDQFH ,QVWDOODWLRQ RWKHU WKDQ DV LQVWUXFWHG E\ +HDUWK +RPH Technologies. ,QVWDOODWLRQDQGRUXVHRIDQ\FRPSRQHQWSDUWQRWDSSURYHG by Hearth & Home Technologies. 2SHUDWLQJ DSSOLDQFH ZLWKRXW IXOO\ DVVHPEOLQJ DOO components. 2SHUDWLQJDSSOLDQFHZLWKRXWOHJVDWWDFKHGLIVXSSOLHGZLWK XQLW 'R1272YHU¿UH,IDSSOLDQFHRUFKLPQH\FRQQHFWRUJORZV \RXDUHRYHU¿ULQJ $Q\VXFKDFWLRQWKDWPD\FDXVHD¿UHKD]DUG ,PSURSHU LQVWDOODWLRQ DGMXVWPHQW DOWHUDWLRQ VHUYLFH RU PDLQWHQDQFHFDQFDXVHLQMXU\RUSURSHUW\GDPDJH )RUDVVLVWDQFHRUDGGLWLRQDOLQIRUPDWLRQFRQVXOWDTXDOL¿HG installer, service agency or your dealer. NOTE Hearth & Home Technologies, manufacturer of this appliance, reserves the right to alter its products, WKHLUVSHFL¿FDWLRQVDQGRUSULFHZLWKRXWQRWLFH Quadra-Fire is a registered trademark of Hearth & Home Technologies. Page 6 7075-166C May 23, 2013 R VOYAGEUR GRAND Wood Insert User G de O er t n Instr t ons WARNING O UR A E *ODVVDQGRWKHUVXUIDFHVDUHKRWGXULQJRSHUDWLRQ$1'FRROGRZQ ot ss se rns DO NO touch glass until it is cooled 1(9(5DOORZFKLOGUHQWRWRXFKJODVV .HHSFKLOGUHQDZD\ &$5()8//<683(59,6(FKLOGUHQLQVDPHURRPDVDSSOLDQFH $OHUWFKLOGUHQDQGDGXOWVWRKD]DUGVRIKLJKWHPSHUDWXUHV High temperatures may ignite clothing or other Àammable materials .HHSFORWKLQJIXUQLWXUHGUDSHULHVDQGRWKHUÀDPPDEOHPDWHULDOVDZD\ A Yo r Wood A n e If you expect that children may come into contact with this appliance, we recommend a barrier such as a decorative screen. See your dealer for suggestions. WARNING! DO NOT operate appliance before reading and understanding operating instructions. )DLOXUHWRRSHUDWHDSSOLDQFHDFFRUGLQJWRRSHUDWLQJLQVWUXFWLRQVFRXOGFDXVH¿UHRULQMXU\ Door Handle Surround and Trim Set Burn Rate Control ACC Start-up Air Control Convection Fan Blower Controls re May 23, 2013 Gener O er t n rts 7075-166C Page 7 R VOYAGEUR GRAND Wood Insert re et 7R SURYLGH UHDVRQDEOH ¿UH VDIHW\ WKH IROORZLQJ VKRXOG EH given serious consideration ,QVWDOO DW OHDVW RQH VPRNH GHWHFWRU RQ HDFK ÀRRU RI your home to ensure your safety. They should be located away from the heating appliance and close to the sleeping areas. Follow the smoke detector manufacturer s placement and installation instructions, and be sure to maintain regularly. $FRQYHQLHQWO\ORFDWHG&ODVV$¿UHH[WLQJXLVKHU $SUDFWLFHGHYDFXDWLRQSODQFRQVLVWLQJRIDWOHDVWWZR escape routes. ,QWKHHYHQWRIDFKLPQH\¿UH Prepare occupants for immediate evacuation 1RWLI\¿UHGHSDUWPHQW C Over¿ring WARNING re R s 'RQRWRYHU¿UH 2YHU¿ULQJ PD\ LJQLWH FUHRVRWH RU ZLOO GDPDJH the stove and chimney. 7RSUHYHQWRYHU¿ULQJ\RXUVWRYH'2127 :DUSHGDLUWXEH 'HWHULRUDWHGUHIUDFWRU\EULFNUHWDLQHUV 'HWHULRUDWHGEDIÀHDQGRWKHULQWHULRUFRPSRQHQWV D o st e Non o st e ter s a. E Hearth & Home Technologies WILL NOT warranty appliDQFHVWKDWH[KLELWHYLGHQFHRIRYHU¿ULQJ(YLGHQFHRI RYHU¿ULQJLQFOXGHVEXWLVQRWOLPLWHGWR 8VHÀDPPDEOHOLTXLGV 2YHUORDGZLWKZRRG %XUQWUDVKRUODUJHDPRXQWVRIVFUDSOXPEHU 3HUPLWWRRPXFKDLUWRWKH¿UH 8VHRISURFHVVHGVROLGIXHO¿UHORJV o st e ter Material made of or surfaced with wood, compressed SDSHU SODQW ¿EHUV SODVWLFV RU DQ\ PDWHULDO FDSDEOH RI LJQLWLQJ DQG EXUQLQJ ZKHWKHU ÀDPHSURRIHG RU QRW plastered or unplastered. Non o st e ter Material which will not ignite and burn. Such materials are those consisting entirely of steel, iron, brick, tile, slate, glass or plasters, or any combination thereof. 0DWHULDOV WKDW DUH UHSRUWHG DV SDVVLQJ$670 ( Standard Test Method for Behavior of Materials in a ertical Tube Furnance at 750 oC and L763 shall be considered non-combustible materials. Non o st e e nt ter Sealants which will not ignite and burn Rutland, Inc. Fireplace Mortar 63, Rutland 76R, Nuflex 304, GE 579RU*(57%RUHTXLYDOHQW E e soned Wood Burn only dry seasoned wood. to s o O er r n 6WRUHZRRGXQGHUFRYHURXWRIWKHUDLQDQGVQRZ 6\PSWRPV RI RYHU¿ULQJ PD\ LQFOXGH RQH RU PRUH RI WKH 'U\DQGZHOOVHDVRQHGZRRGZLOOQRWRQO\PLQLPL]HWKH following chance of creosote formation, but will give you the most HI¿FLHQW¿UH &KLPQH\FRQQHFWRURUDSSOLDQFHJORZLQJ (YHQGU\ZRRGFRQWDLQVDWOHDVWPRLVWXUHE\ZHLJKW 5RDULQJUXPEOLQJQRLVHV and should be burned hot enough to keep the chimney /RXGFUDFNLQJRUEDQJLQJVRXQGV hot for as long as it takes to dry the wood out - about one hour. 0HWDOZDUSLQJ ,WLVDZDVWHRIHQHUJ\WREXUQXQVHDVRQHGZRRGRIDQ\ &KLPQH\¿UH kind. 'HDGZRRGO\LQJRQWKHIRUHVWÀRRUVKRXOGEHFRQVLGHUHGZHW W t o Do Yo r A n e s O er r n and requires full seasoning time. ,PPHGLDWHO\close the door and air controls to reduce 6WDQGLQJGHDGZRRGFDQEHFRQVLGHUHGWREHDERXW DLUVXSSO\WRWKH¿UH seasoned. 7RWHOOLIZRRGLVGU\HQRXJKWREXUQFKHFNWKHHQGVRI ,I\RXVXVSHFWDFKLPQH\¿UHFDOOWKH¿UHGHSDUWPHQW the logs. and evacuate your house. ,IWKHUHDUHFUDFNVUDGLDWLQJLQDOOGLUHFWLRQVIURPWKHFHQWHU &RQWDFW \RXU ORFDO FKLPQH\ SURIHVVLRQDO DQG KDYH it is dry. your appliance and stove pipe inspected for any dam ,I\RXUZRRGVL]]OHVLQWKH¿UHHYHQWKRXJKWKHVXUIDFH age. is dry, it may not be fully cured. 'RQRWXVH\RXUDSSOLDQFHXQWLOWKHFKLPQH\SURIHVsional informs you it is safe to do so. Page 8 7075-166C May 23, 2013 R VOYAGEUR GRAND Wood Insert rn n e ond t ro ess In recent years there has been an increasing concern about air quality. Much of the blame for poor air quality has been placed on the burning of wood for home heating. In order to improve the situation, we at Quadra-Fire have developed cleaner-burning wood appliances that surpass the requirements for emissions established by our governing agencies. These wood appliances must be properly operated in order to ensure that they perform the way they are designed to perform. ,QWKHVHFRQGDU\VWDJHZRRGJLYHVRIIÀDPPDEOHJDVHVZKLFK EXUQDERYHWKHIXHOZLWKEULJKWÀDPHV During this stage of burning 7KHÀDPHVPXVWEHPDLQWDLQHGDQGQRWDOORZHGWRJRRXW toHQVXUHWKHFOHDQHVWSRVVLEOH¿UH ,IWKHÀDPHVWHQGWRJRRXWLWLVVHWWRRORZIRU\RXUEXUQing conditions. The air control located at the upper right hand corner is used to DGMXVWIRUEXUQUDWHV7KLVLVFDOOHGWKH%XUQ5DWH$LU&RQWURO. re on e n NO I E Improper operation can turn any wood appliance into a smoldering environmental hazard. nd n or rst t e It helps to know a little about the actual process of burning in order to understand what goes on inside the appliance. The ¿UVWVWDJHRIEXUQLQJLVFDOOHGWKHNLQGOLQJVWDJH In this stage Wood is heated to a temperature high enough to evaporate the moisture present in all wood. :RRGZLOOUHDFKWKHERLOLQJSRLQWRIZDWHU)DQGZLOO not get any hotter until the water is evaporated. This process takes heat from the coals and tends to cool the appliance. Fire requires three things to burn )XHO $LU +HDW e t e 7KH¿QDOVWDJHRIEXUQLQJLVWKHFKDUFRDOVWDJH7KLVRFFXUV ZKHQ WKH ÀDPPDEOH JDVHV KDYH EHHQ PRVWO\ EXUQHG DQG only charcoal remains. This is a naturally clean portion of WKHEXUQ7KHFRDOVEXUQZLWKKRWEOXHÀDPHV It is very important to reload your appliance while enough lively hot coals remain in order to provide the amount of heat needed to dry and rekindle the next load of wood. ,WLVEHVWWRRSHQWKH%XUQ5DWH$LUDQG6WDUW8S$LU&RQtrols before reloading. This livens up the coalbed and UHGXFHVH[FHVVLYHHPLVVLRQVRSDFLW\VPRNH 2SHQGRRUVORZO\VRWKDWDVKRUVPRNHGRHVQRWH[LWDSpliance through opening. Break up any large chunks and distribute the coals so that the new wood is laid on hot coals. $LUTXDOLW\LVLPSRUWDQWWRDOORIXVDQGLIZHFKRRVHWRXVH wood to heat our homes we should do so responsibly. We need to learn to burn in the cleanest way possible allowing us to continue using our wood appliances for many years to come. If heat is robbed from the appliance during the drying stage, the new load of wood has reduced the chances for a good clean burn. ,WLVDOZD\VEHVWWREXUQGU\VHDVRQHG¿UHZRRG:KHQWKH wood isn t dry, you must open the air controls and burn at a high burn setting for a longer time to start it burning. 7KH KHDW JHQHUDWHG IURP WKH ¿UH VKRXOG EH ZDUPLQJ \RXU KRPH DQG HVWDEOLVKLQJ WKH ÀXH GUDIW QRW HYDSRUDWLQJ WKH moisture out of wet, unseasoned wood, resulting in wasted heat. May 23, 2013 7075-166C Page 9 R VOYAGEUR GRAND Wood Insert G A to t o st on I Burn Rates and Operating Ef¿ciency ontro A 7\SLFDOO\ZKHQ\RXEXLOGD¿UH\RXRSHQWKHDLUFRQWUROVIXOO\ DQGPRQLWRUWKH¿UHWRSUHYHQWLWIURPJRLQJLQWRDQRYHU¿UH situation and/or burning your wood up too quickly before you shut down the air controls to the desired burn rate. :KHQXVLQJWKH$XWRPDWLF&RPEXVWLRQ&RQWURO$&&V\VWHP \RX GR QRW KDYH WR FRQWLQXDOO\ PRQLWRU WKH ¿UH 2QFH \RX VHWWKH$&&V\VWHPLWZLOOFRQWUROWKH¿UHIRU\RX)ROORZWKH instructions below to learn how to operate your stove with ease. Ar For maximum operating ef¿ciency 1. Burn dry, well-seasoned wood. 2. Follow these burn rate instructions below and refer to re NO E 7KHVHDUHJXLGHOLQHV$FWXDOVHWWLQJVPD\YDU\ZLWKW\SH of wood, chimney draft, altitude and other variables. rn R tes ontro s t rt U A r t rt n ontro 7KH IXQFWLRQ RI WKH 6WDUW8S$LU &RQWURO LV WR DFWLYDWH WKH $XWRPDWLF&RPEXVWLRQ&RQWUROV\VWHP$&& 3XVKWKH6WDUW8S$LU&RQWURODOOWKHZD\EDFNXQWLOLWVWRSV and then pull forward to the front of the appliance until it stops. re 7he air channel opens and allows air to enter the front of the appliance for approximately 20-25 minutes. re nd Re o d n 2SHQERWKFRQWUROVIXOO\E\UDLVLQJWKH%XUQ5DWH$LU&RQWURODOOWKHZD\XSXQWLOLWVWRSVDQGSXVKWKH6WDUWXS$LU Control back until it stops. The blower tends to cool the appliance. Leave the blower off until the burn is well established, i.e., 30 minutes. $IWHUORDGLQJWKHDSSOLDQFHZLWKZRRGDQGVWDUWLQJWKH¿UH set both controls to the desired setting by following the burn rate instructions below. rn R te e t 7KHDLUFKDQQHOJUDGXDOO\VKXWVGRZQXQWLOLWLVFRPSOHWHO\ closed at the end of the 20-25 minutes. 5DLVHWKH%XUQ5DWH$LU&RQWURODOOWKHZD\XSXQWLOLWVWRSV WRSPDUNHUWRDIXOO\RSHQSRVLWLRQ 7KH¿UHLVQRZFRQWUROOHGE\WKHDLUVXSSOLHGE\WKH%XUQ 5DWH$LU&RQWURO re 3XVKWKH6WDUW8S$LU&RQWURODOOWKHZD\EDFNXQWLOLWVWRSV and leave it there. 7KLVIXQFWLRQVKRXOGEHSHUIRUPHGHDFKWLPH\RXUHORDG the appliance. rn R te A r ontro 7KLVVHWWLQJRYHUULGHVWKHWLPHUV\VWHP$&&VR\RXPXVW PRQLWRUWKH¿UHFORVHO\ZKLOHLQWKLVVHWWLQJ ed rn R te to U r 7KH DLU VXSSO\ HQWHUV DW WKH XSSHU IURQW RI WKH ¿UHER[ 5DLVHWKH%XUQ5DWH$LU&RQWURODOOWKHZD\XSXQWLOLWVWRSV near the top of the glass door. to a fully open position. This preheated air supplies the necessary fresh oxygen 3XVKWKH6WDUW8S$LU&RQWURODOOWKHZD\EDFNXQWLOLWVWRSV to mix with the unburned gases, helping to create the and then pull forward until it stops. second, third and fourth combustion process. 7KLVDFWLYDWHVWKHWLPHUV\VWHP$&& 7KLVDLULVUHJXODWHGE\WKH%XUQ5DWH$LU&RQWURO ed o rn R te to U r There are four settings High, Medium-High, Medium-Low 5DLVHWKH%XUQ5DWH$LU&RQWUROXSIURPORZHVWSRVLand Low. tion. When the control is raised all the way up it is on the High setting and when pushed all the down it is on the Low 3XVKWKH6WDUW8S$LU&RQWURODOOWKHZD\EDFNXQWLOLWVWRSV and then pull forward until it stops. setting. HIGH Burn Rate Control 7KLVDFWLYDWHVWKHWLPHUV\VWHP$&& o LOW rn R te eo U r /HDYHWKH%XUQ5DWH$LU&RQWURODWLWVORZHVWSRVLWLRQ 3XVKWKH6WDUW8S$LU&RQWURODOOWKHZD\EDFNXQWLOLWVWRSV and then pull forward until it stops. 7KLVDFWLYDWHVWKHWLPHUV\VWHP$&& ACC Start-up Air Control To activate: Push back until it stops and then pull forward until it stops re Page 10 t rt nd rn R te A r ontro s 7075-166C May 23, 2013 R VOYAGEUR GRAND Wood Insert - Correct BafÀe BlanNet Placement IN ORRE O I ION WARNING re R s ,PSURSHUEDIÀHSODFHPHQWPD\FDXVH 2YHUKHDWLQJRI¿UHER[ Overheating the chimney %DIÀHPXVWEHSODFHGSURSHUO\VHHLQVWUXFWLRQV 5HSODFHEDIÀHLIGDPDJHGRUPLVVLQJ NO E $PLVVLQJGDPDJHGRULPSURSHUO\SRVLWLRQHGEDIÀH LVGDQJHURXVDQGPD\FDXVHGDPDJHDQGSRRUHI¿FLHQF\ It will also void your warranty. &HUDPLF%ODQNHWDQG%DIÀH%RDUGDUH127 LQFRQWDFWZLWKWKHEDFNRIWKH¿UHER[ Note: 7KLVDUHJHQHULFGUDZLQJVDQGPD\ QRWUHSUHVHQW\RXUVSHFL¿FPRGHO ORRE O I ION Back of Firebox Ceramic Blanket Ceramic Blanket is NOT in contact with the EDFNRIWKH¿UHER[DQG127HYHQZLWKWKH %DIÀH%RDUGLQWKHIURQW Back of Firebox Ceramic Blanket Baffle Board &HUDPLF%ODQNHWDQG%DIÀH%RDUG0867EH LQ FRQWDFW ZLWK WKH EDFN RI WKH ¿UHER[ DQG even with each other in the front. re Correct BafÀe and BlanNet Positions May 23, 2013 Baffle Board Ceramic Blanket is bunched up at the back RIWKH¿UHER[DQG127HYHQZLWKWKH%DIÀH Board in the front. re 7075-166C Incorrect BafÀe and BlanNet Positions Page 11 R VOYAGEUR GRAND Wood Insert dn A re e Re o d n Instr WARNING 1. This appliance has a large door with an exceptional YLHZRIWKH¿UH re R s Keep combustible materials, gasoline DQGRWKHUÀDPPDEOHYDSRUVDQGOLTXLGV clear of appliance. 'R127VWRUHÀDPPDEOHPDWHULDOVLQWKHDSSOLDQFH¶V vicinity. 2SHQVWRDERXWGHJUHHVDQGKDVDEXLOWLQVWRS 'RRURSHQVLQFKHVPPZKLFKJRHVEH\RQG WKH VWDQGDUG VL]H KHDUWK SDG FRYHULQJ WKH ÀRRU LQ front of the appliance. '212786(*$62/,1(/$17(51)8(/ .(526(1(&+$5&2$//,*+7(5)/8,'25 6,0,/$5/,48,'67267$5725³)5(6+(183´$ ),5(,17+,6+($7(5 .HHSDOOVXFKOLTXLGVZHOODZD\IURPWKHKHDWHUZKLOHLW is in use. 0D\ZDQWWRXVHDKHDUWKUXJLQIURQWRIWKHKHDUWK SDGWRSURWHFWWKHÀRRULQJIURPDVKVSLOODJHDQG continuous cleaning of carpet, etc. See drawing on e 2. Open door slowly so that ash or smoke does not exit appliance through opening. &RPEXVWLEOHPDWHULDOVPD\LJQLWH Check the level of the ash build-up. Remove ash if it UHDFKHVWKHWRSRIWKHEULFNFRYHUV$VKVKRXOGQRW be spilling over the brick covers onto the ashlip. %HIRUHOLJKWLQJ\RXU¿UVW¿UHLQWKHDSSOLDQFH &RQ¿UP WKH EDIÀH DQG FHUDPLF EODQNHW DUH FRUUHFWO\ positioned. They should be even with the front tube and resting on all tubes. ee e 2. t ons Remove all labels from glass. 7KHUHDUHPDQ\ZD\VWREXLOGD¿UH7KHEDVLFSULQFLSOHLV to light easily-ignitable tinder or paper, which ignites the fast EXUQLQJNLQGOLQJZKLFKLQWXUQLJQLWHVWKHVORZEXUQLQJ¿UHwood. Here is one method that works well 1. 2SHQWKH%XUQ5DWH$LUDQG6WDUW8S$LU&RQWUROVIXOO\ 3ODFHVHYHUDOZDGVRIFUXVKHGSDSHURQWKH¿UHER[ÀRRU +HDWLQJWKHÀXHZLWKVOLJKWO\FUXPSOHGQHZVSDSHUEHIRUH adding kindling keeps smoke to a minimum. $Q\DVKRQWKHDVKOLSFDQEHSUHVVHGLQWRWKHGRRU gasket and shorten the life of the gasket. ,I WKH DVK LV OHIW WR DFFXPXODWH RQ WKH DVKOLS LW FDQ interfere with the door closing and/or falling out onto the hearth pad or beyond. Check the ash level each time you reload. NO E %XLOG¿UHRQEULFN¿UHER[ÀRRURQO\ 'R127XVHJUDWHVRURWKHUPHWKRGVWRVXSSRUWIXHO It will adversely affect emissions. 3. Lay small dry sticks of kindling on top of the paper. 4. Make sure that no matches or other combustibles are in the immediate area of the appliance. Be sure the room LVYHQWLODWHGDQGWKHÀXHXQREVWUXFWHG 5. Light the paper in the appliance. NE ER light or rekindle ¿UHZLWKNHURVHQHJDVROLQHRUFKDUFRDOOLJKWHUÀXLGWKH results can be fatal. AU ION Odors and vapors released during initial operation. &XULQJRIKLJKWHPSHUDWXUHSDLQW 2SHQZLQGRZVIRUDLUFLUFXODWLRQ Odors may be irritating to sensitive individuals. 6. Once the kindling is burning quickly, add several full-length ORJVWRLQFKHVPPLQGLDPHWHU%HFDUHIXO QRWWRVPRWKHUWKH¿UH6WDFNWKHSLHFHVRIZRRGWR LQFKDSDUWPPQHDUHQRXJKWRNHHSHDFKRWKHU KRWEXWIDUHQRXJKDZD\IURPHDFKRWKHUWRDOORZDLUÀRZ between them. 6HWWKH%XUQ5DWH$LU&RQWURODQGDFWLYDWHWKHWLPHUV\VWHP$&& 8. When ready to reload, it is best to fully open both the Burn 5DWH$LUDQG6WDUWXS$LU&RQWUROVbefore reloading. 7KLVOLYHQVXSWKHFRDOEHGDQGUHGXFHVH[FHVVLYHHPLVVLRQVRSDFLW\VPRNH /DUJHORJVEXUQVORZO\KROGLQJD¿UHORQJHU Small logs burn fast and hot, giving quick heat. Page 12 7075-166C May 23, 2013 R VOYAGEUR GRAND Wood Insert Wood e o st re 7KHPDMRULW\RIWKHSUREOHPVDSSOLDQFHRZQHUVH[SHULHQFH are caused by trying to burn wet, unseasoned wood. WARNING Wet, unseasoned wood requires energy to evaporate the water instead of heating your home, and re R s '2127%851*$5%$*(25)/$00$%/( )/8,'668&+$6*$62/,1(1$37+$25 ENGINE OIL. &DXVHVHYDSRUDWLQJPRLVWXUHZKLFKFRROV\RXUFKLPQH\ accelerating formation of creosote. '212786(&+(0,&$/625)/8,'67267$57$ FIRE. 'R127EXUQWUHDWHGZRRGRUZRRGZLWKVDOWGULIWZRRG May generate carbon monooxide if burn material other than wood. May result in illness or possible death. WARNING re R s Do NOT burn wet or green wood. Store wood in dry location. Stack wood so both ends are exposed to air. Wet, unseasoned wood can cause accumulation of creosote. rd ood s o t ood e soned Wood <RXUDSSOLDQFHSHUIRUPDQFHGHSHQGVRQWKHTXDOLW\RIWKH ¿UHZRRG\RXXVH &XWORJVWRVL]H 6HDVRQHGZRRGFRQWDLQVDERXW%78VSHUSRXQG 6SOLWWRLQFKHVPPRUOHVVLQGLDPHWHU +DUGZRRGVDUHPRUHGHQVHWKDQVRIWZRRGV $LUGU\WRDPRLVWXUHFRQWHQWRIQRWPRUHWKDQ +DUGZRRGVFRQWDLQPRUH%78VWKDQVRIWZRRGV - Soft wood - about nine months to dry +DUGZRRGVUHTXLUHPRUHWLPHWRVHDVRQEXUQVORZHUDQG are harder to ignite. - Hard wood - about eighteen months to dry 6RIWZRRGVUHTXLUHOHVVWLPHWRGU\EXUQIDVWHUDQGDUH easier to ignite. 6WDUWWKH¿UHZLWKVRIWZRRGWREULQJWKHDSSOLDQFHXSWR operating temperature and to establish draft. $GGKDUGZRRGIRUVORZHYHQKHDWDQGORQJHUEXUQWLPH NO I E Seasoning time may vary depending on drying conditions. tor n Wood Steps to ensure properly seasoned wood Soft woods Hard woods 'RXJODV)LU 3LQH 6SUXFH &HGDU ro essed o d e 2DN 0DSOH $SSOH %LUFK 3RSODU $VSHQ $OGHU re o s 6WDFN ZRRG WR DOORZ DLU WR FLUFXODWH IUHHO\ DURXQG DQG through woodpile. (OHYDWH ZRRG SLOH RII JURXQG WR DOORZ DLU FLUFXODWLRQ underneath. 6PDOOHUSLHFHVRIZRRGGU\IDVWHU$Q\SLHFHRYHULQ PPLQGLDPHWHUVKRXOGEHVSOLW :RRGZKROHRUVSOLWVKRXOGEHVWDFNHGVRERWKHQGVRI each piece are exposed to air. More drying occurs through the cut ends than the sides. 6WRUH ZRRG XQGHU FRYHU WR SUHYHQW ZDWHU DEVRUSWLRQ IURP UDLQ RU VQRZ$YRLG FRYHULQJ WKH VLGHV DQG HQGV completely. 127SHUPLWWHGIRUXVHLQWKLVDSSOLDQFH WARNING re R s Do NOT store wood ,QIURQWRIWKHDSSOLDQFH ,QVSDFHUHTXLUHGIRUORDGLQJRUDVK removal. May 23, 2013 7075-166C Page 13 R VOYAGEUR GRAND Wood Insert N o er ontro O er t n Instr o n t ons Ds 1. The blower will turn on/off automatically when set to $872 re :KHQVHWWR0$18$/WKHIDQZLOOWXUQRQRIIRQO\ZKHQ you turn it on or off. This setting over-rides the internal snap disc. Blower Controls Under Ash Lip 3. Swing the grille downward to expose the blower conWUROV$GMXVWWKHVSHHGRIWKHIDQE\WXUQLQJWKH+,*+ LOW knob to the desired setting. O o er O er t n Instr t ons 1. In t o d st rt Open both controls fully by raisLQJWKH%XUQ5DWH$LU&RQWURODOOWKHZD\XSXQWLOLWVWRSV DQG 386+ WKH 6WDUWXS$LU &RQWURO EDFN XQWLO LW VWRSV The blower tends to cool the appliance. Leave the blower off until the burn is well established, i.e., 30 minutes. 2 rn ett n Both controls are open. Burn Rate $LU &RQWURO LV SXOOHG XS DQG WKH 6WDUWXS$LU &RQWURO LV fully pushed in. Blower may remain on. 3. ed rn ett n %XUQ 5DWH $LU &RQWURO LVFORVHGWKHQRSHQHGWRLQFKWRIXOO\RSHQSXOOXS Blower may remain on. 4. ed - o rn ett n %XUQ 5DWH $LU &RQWURO LVFORVHGWKHQRSHQHGWRLQFKWRLQFKSXOOXS Leave the blower off until the burn is well established, i.e., 30 minutes. 5. o rn ett n %XUQ 5DWH $LU &RQWURO LV FORVHG GRZQ SRVLWLRQ Leave the blower off until the burn is well established, i.e., 30 minutes. MANUAL: overrides the internal snap disc AUTO: Fan with turn ON/OFF automatically and is controlled by the internal Snap Disc re NOTICE! Do NOT operate a circulating fan within close proximLW\DSSUR[LPDWHO\IWPRIDSSOLDQFH &DQUHYHUVHDLUÀRZEORZLQJKRWDLULQWRDSSOLDQFH cavity. &DQGDPDJHDSSOLDQFHEORZHUGXHWRRYHUKHDWLQJ NO E )RUEXUQVHWWLQJVWRWKH6WDUWXS$LU&RQWURO QHHGV WR EH SXVKHG LQ 2SHQ WKHQ SXOOHG IRUZDUG WR DFWLYDWHWKH$XWRPDWLF&RPEXVWLRQ&RQWURO$&& NO E )RUPD[LPXPHI¿FLHQF\DQGORZHVWHPLVVLRQV when operating the blower in either the automatic or manual setting for the low and medium low burn settings leave the blower off until the burn is well established, i.e., 30 minutes. 7KHEORZHULVHTXLSSHGZLWKDUKHRVWDWVSHHGFRQWURO The highest blower speed is obtained by turning the UKHRVWDW RQ WKHQ DGMXVWLQJ EDFN WRZDUGV ³2))´ DV IDU as possible without turning the blower off. For a low blower speed, turn the control knob clockwise as far as possible Page 14 7075-166C May 23, 2013 R VOYAGEUR GRAND Wood Insert e r R O e 'R127SODFHFRPEXVWLEOHREMHFWVZLWKLQIWPRI WKHIURQWRI¿UHSODFH re . t o e Opacity is the measure of how cleanly your appliance is burning. Opacity is measured in percent RSDFLW\LVZKHQDQREMHFWLVWRWDOO\REVFXUHGE\ the smoke column from a chimney, and WARNING re R s 'R127SODFHFRPEXVWLEOHREMHFWVZLWKLQ inches in front of the appliance. High temperatures may ignite clothing, furniture or draperies. RSDFLW\PHDQVWKDWQRVPRNHFROXPQFDQEHVHHQ $V \RX EHFRPH IDPLOLDU ZLWK \RXU DSSOLDQFH \RX VKRXOG periodically check the opacity. This will allow you to know KRZWREXUQDVQHDUO\VPRNHIUHHDVSRVVLEOHJRDORI RSDFLW\ NOTICE! Do NOT operate a circulating fan within close proxLPLW\DSSUR[LPDWHO\IWPRIDSSOLDQFH &DQUHYHUVHDLUÀRZEORZLQJKRWDLULQWRDSSOLance cavity. &DQGDPDJHDSSOLDQFHEORZHUGXHWRRYHUKHDWing. Maintain 4 ft (1.22m) clearance to combustible in front of appliance re e r re ent I UE e As ed est ons O U ION Odor from appliance :KHQ¿UVWRSHUDWHGWKLVDSSOLDQFHPD\UHOHDVHDQRGRUIRUWKH¿UVWVHYHUDOKRXUV7KLVLV caused by the curing of the paint and the burning off of any oils remaining from manufacturing. Metallic noise Noise is caused by metal expanding and contracting as it heats up and cools down, similar to the sound produced by a furnace or heating duct. This noise does not affect the operation or longevity of the appliance. Whirring sound The blower may produce a whirring sound which increases in volume as the speed is increased. AU ION Odors and vapors released during initial operation. &XULQJRIKLJKWHPSHUDWXUHSDLQW 2SHQZLQGRZVIRUDLUFLUFXODWLRQ Odors may be irritating to sensitive individuals. May 23, 2013 7075-166C Page 15 R VOYAGEUR GRAND Wood Insert t rt G de Note: 7KHVHDUHJHQHULFGUDZLQJVDQGPD\QRWUHSUHVHQW \RXUVSHFL¿FPRGHO FIRST FIRE ITEMS NEEDED: LOW ADD NEW OAD WOOD O EN AIR ON RO HIGH 10 Pieces of Newspaper, 10-20 Pieces of Dry Kindling and a Few Pieces of Dry Split Wood. A ER BURN RATE Upper right corner START-UP AIR Lower right corner Push In and then Pull Out ADD 2 1 IND ING 3 WARNING R s O re DO NOT LEAVE UNATTENDED During startup, if additional draft is needed, allow the door to remain open approximately1/2 inch. Once the draft is established, close and securely latch the door to prevent 6SLOODJHRIVPRNHÀDPHDQGFDUERQ monoxide 6SLOODJHRIVSDUNVFRDOVDQGORJV 2YHU¿ULQJ IG E A ER DO NO tended 4 ADD ORE WOOD E URE Y A E DOOR e e t e sto e n t t t e door o en 5 REDU E AIR ON RO Set to desired heat output HIGH LOW The stove is ready for normal operation. BURN RATE CONTROL Upper Right Corner 6 Page 16 7 7075-166C May 23, 2013 R VOYAGEUR GRAND Wood Insert nten n e nd er A D s os e o As es FreTuency: When ash reaches the top of the brick FRYHUV VKRXOG QRW VSLOO RYHU FRYHUV /HDYH LQFK PPRIDVKLQWKHERWWRPRIWKHILUHER[ By: Homeowner WARNING! Risk of Fire! $VKHVFRXOGFRQWDLQKRWHPEHUV 3ODFHDVKHVLQDPHWDOFRQWDLQHUZLWKDWLJKW¿WWLQJOLG 7KHFORVHGFRQWDLQHUVKRXOGEHSODFHGRQDQRQFRPEXVWLEOH ÀRRU RU RQ WKH JURXQG ZHOO DZD\ IURP DOO FRPEXVWLEOH PDWHULDOVSHQGLQJ¿QDOGLVSRVDO ,IWKHDVKHVDUHGLVSRVHGRIE\EXULDOLQVRLORURWKHUZLVH locally dispersed, they should be retained in the closed container until all cinders have thoroughly cooled ne nd ne Ins e t on e n n reosote or t on nd Need or Re o When wood is burned slowly, it produces tar and other organic vapors, which combine with expelled moisture to form creosote. The creosote vapors condense in the relatively cool FKLPQH\ÀXHRIDVORZEXUQLQJ¿UH $VDUHVXOWFUHRVRWHUHVLGXHDFFXPXODWHVRQWKHÀXH lining. When ignited this creosote makes an extremely KRW¿UH The chimney and chimney connector shall be inspected every two months during the heating season to determine when a creosote buildup has occurred. When creosote has accumulated it shall be removed to UHGXFHWKHULVNRIDFKLPQH\¿UH A onne tor FreTuency: Every 2 months during heating season or DV UHFRPPHQGHG E\ D FHUWL¿HG FKLPQH\ VZHHS PRUH IUHTXHQWO\LIFKLPQH\H[FHHGVRULVXQGHUIHHW WRPPHDVXUHGIURPERWWRPRIDSSOLDQFH By: &HUWL¿HGFKLPQH\VZHHS 5HPRYH DOO DVK IURP WKH ¿UHER[ DQG H[WLQJXLVK DOO KRW embers before disposal. n e Ins e t on Ro t ne re en Every 2 months at the same time the chimney and chimney connector are inspected. By: Homeowner Check for &UDFNVLQJODVV 'RRUKDQGOHVPRRWKFDPRSHUDWLRQ %DIÀHDQGFHUDPLFEODQNHWFRUUHFWSODFHPHQW $OORZWKHDSSOLDQFHWRFRROFRPSOHWHO\ %DIÀHIRUZDUSDJH If your type of installation involves a full reline of the FKLPQH\LWZLOOEHQHFHVVDU\WRHLWKHUUHPRYHWKHEDIÀH IURP WKH LQVHUW RU UHPRYH WKH LQVHUW IURP WKH ¿UHSODFH and disconnect the vent prior to cleaning the chimney. Refer to e LQWKLVPDQXDOIRULQVWUXFWLRQVRQ%DIÀH Removal. )LUHEULFNIRUFUDFNVEURNHQRUFUXPEO\ If your type of installation is direct connect within a masonry chimney, the insert will need to be pulled out from the ¿UHSODFHDQGGLVFRQQHFWHGIURPWKHÀXHSULRUWRFOHDQLQJ the chimney. The creosote or soot should be removed with a brush VSHFL¿FDOO\GHVLJQHGIRUWKHW\SHRIFKLPQH\LQXVH &OHDQRXWIDOOHQDVKHVIURPWKH¿UHER[ It is also recommended that before each heating season the entire system be professionally inspected, cleaned and repaired if necessary. *ODVVIUDPHIRUORRVHVFUHZV D e nn ted FreTuency: $VGHVLUHG By: Homeowner r es &OHDQ DOO WKH ¿QJHUSULQWV DQG RLOV IURP SODWHG VXUIDFHV E ORE ¿ULQJWKHDSSOLDQFHIRUWKH¿UVWWLPH ,IQRWFOHDQHGSURSHUO\EHIRUHOLJKWLQJ\RXU¿UVW¿UHWKH oils can cause permanent markings on the plating. $IWHUWKHSODWLQJLVFXUHGWKHRLOVZLOOQRWDIIHFWWKH¿QLVK and little maintenance is required. Wipe clean as needed. WARNING! Risk of Fire! 'RQRWXVHFKLPQH\FOHDQHUVRUÀDPHFRORUDQWVLQ\RXU DSSOLDQFH,WZLOOFRUURGH\RXUSLSH May 23, 2013 'RRUJDVNHW'ROODUELOOWHVW3ODFHDGROODUELOOEHWZHHQ the stove and the door and then shut the door. If you can pull the dollar bill out, replace the door gasket. CAUTION! Do not use polishes with abrasives. ,W ZLOO VFUDWFKSODWHGVXUIDFHV 7075-166C Page 17 R VOYAGEUR GRAND Wood Insert E G ss Ins e t re r Instr t ons e nn FreTuency: $VGHVLUHG By: Homeowner &OHDQJODVVZLWKDQRQDEUDVLYHJODVVFOHDQHU$EUDVLYH cleaners may scratch and cause glass to crack. If the deposits on the glass are not very heavy, normal glass cleaners work well. Heavier deposits may be removed by using a damp cloth dipped in wood ashes or by using a commercially available oven cleaner. $IWHUXVLQJDQRYHQFOHDQHULWLVDGYLVDEOHWRUHPRYHDQ\ residue with a glass cleaner or soap and water. Oven FOHDQHU OHIW RQ GXULQJ WKH QH[W ¿ULQJ FDQ SHUPDQHQWO\ VWDLQ WKH JODVV DQG GDPDJH WKH ¿QLVK RQ SODWHG PHWDO surfaces. $SRUWLRQRIWKHFRPEXVWLRQDLUHQWHULQJWKH¿UHER[LVGHÀHFWHGGRZQRYHUWKHLQVLGHRIWKHGRRUJODVV 7KLVDLUÀRZ³ZDVKHV´WKHJODVVKHOSLQJWRNHHSVPRNH from adhering to its surface. :KHQRSHUDWHGDWDORZEXUQUDWHOHVVDLUZLOOEHÀRZLQJ over the glass and the smoky, relatively cool condition of DORZ¿UHZLOOFDXVHWKHJODVVWREHFRPHFRDWHG Re e ent FreTuency: $IWHUHDFKDVKUHPRYDO By: Homeowner 5HSODFHWKH¿UHEULFNLIWKH\EHFRPHFUXPEO\DQGRULI WKHUHLVDLQFKPPJDSEHWZHHQWKHEULFNV 7KH¿UHER[LVOLQHGZLWK¿UHEULFNZKLFKKDVH[FHSWLRQDO LQVXODWLQJSURSHUWLHV'RQRWXVHDJUDWHVLPSO\EXLOG D¿UHRQWKH¿UHER[ÀRRU'RQRWRSHUDWHDSSOLDQFH ZLWKRXW¿UHEULFN $IWHUWKHFRDOVKDYHFRPSOHWHO\FRROHGUHPRYHDOO ROGEULFNDQGDVKIURPXQLWDQGYDFXXP¿UHER[ 2. Remove new brick set from box and lay out to the diagram shown in the instructions that come with the replacement brick set. 3. Lay bottom bricks in unit. 4. Install rear bricks on the top of the bottom bricks. 5. Install side bricks. Slide top of brick under clips RQVLGHRI¿UHER[DQGSXVKWKHERWWRPRIWKHEULFN XQWLOLWLVÀXVKZLWKWKHVLGHRIWKHXQLW 2SHUDWLQJ WKH DSSOLDQFH ZLWK WKH %XUQ 5DWH$LU &RQWURO DQG6WDUW8S$LU&RQWURODOOWKHZD\RSHQIRUPLQutes should remove the built up coating. CAUTION! Handle glass assembly with care. Glass is breakable. se Part 832-0550 when ordering individual brick. Provide brick dimension or copy the page in the service parts list, mark the desired brick and take it to your authorized dealer. $YRLGVWULNLQJVFUDWFKLQJRUVODPPLQJJODVV $YRLGDEUDVLYHFOHDQHUV 'RQRWFOHDQJODVVZKLOHLWLVKRW Page 18 7075-166C May 23, 2013 R VOYAGEUR GRAND Wood Insert G Re eren e nten n e G de CAUTION! A o t e do n e ore er or n n n e to o ete oo e n n or nten n e %DIÀH%ODQNHW Blanket Baffle Optional Blower Chimney System 6WDUWWKH¿UVWLQVSHFWLRQDIWHUWKH¿UVWPRQWKVRIXVH RU LI SHUIRUPDQFH FKDQJHV DQG DGMXVW \RXU VFKHGXOH accordingly. Maintenance is required for safe operation and must be performed to maintain your warranty. Frequency 0217+/< or $IWHU(YHU\ Cord of Wood <($5/< or $IWHU(YHU\ 4 Cords of Wood (9(5< MONTHS or $IWHU(YHU\ 4 Cords of Wood Task %DIÀHDQGEODQNHWSODFHPHQWLVFULWLFDOWR KHDWRXWSXWHI¿FLHQF\DQGRYHUDOOOLIHRIWKH XQLW0DNHVXUHWKHEDIÀHLVSXVKHGDOORIWKH ZD\WRWKHEDFNRIWKH¿UHER[DQGWKHEODQNHW LVOD\LQJÀDW,QVSHFWEDIÀHIRUFUDFNV acuum the blower impellers. The chimney and chimney cap must be inspected for soot and creosote every two months during the burn season or more frequency if chimney exceeds or is under 14-16 ft PPPHDVXUHGIURPERWWRPRIDSSOLance. This will prevent pipe blockage, poor draft, DQGFKLPQH\¿UHV $OZD\VEXUQGU\ZRRGWRKHOSSUHYHQWFDS blockage and creosote build-up. )LUHEULFN$VK5HPRYDO :((./< or $IWHU(YHU\ 25 Loads of Wood 'RRU*ODVV$VVHPEOLHV Door Handle Latch Cam Spacing Washers :((./< or $IWHU(YHU\ 25 Loads of Wood :((./< or $IWHU(YHU\ Loads of Wood $VKHVPXVWEHFRROEHIRUH\RXFDQGLVSRVH of the ashes in a non-combustible container. )LUHEULFNLVGHVLJQHGWRSURWHFW\RXU¿UHER[ $IWHUDVKHVDUHUHPRYHGLQVSHFWWKH¿UHEULFNDQGUHSODFH¿UHEULFNVWKDWDUHFUXPbling, cracked or broken. Keep door and glass gasket in good shape to maintain good burn times on a low burn setting. To test place a dollar bill between the stove and door and then shut the door. If you can pull the dollar out, remove one washer from door handle behind latch cam and try again. If you can still pull it out, replace the door gasket. Check the glass frame for loose screws to prevent air leakage. Check glass for cracks. &KHFNWKHGRRUODWFKIRUSURSHUDGMXVWPHQW This is very important especially after the door rope has formed to the stove face. Check door handle for smooth cam operation. Note: 7KHVHDUHJHQHULFGUDZLQJVDQGPD\QRWUHSUHVHQW\RXUVSHFL¿FPRGHO May 23, 2013 7075-166C Page 19 R VOYAGEUR GRAND Wood Insert ro es oot n G de With proper installation, operation, and maintenance your woodstove will provide years of trouble-free service. If you do H[SHULHQFHDSUREOHPWKLVWURXEOHVKRRWLQJJXLGHZLOODVVLVW\RXRUDTXDOL¿HGVHUYLFHSHUVRQLQWKHGLDJQRVLVRIDSUREOHP and the corrective action to be taken. t rt re ro e s &DQQRWJHW¿UHVWDUWHG Excessive smoke or spillage Burns too slowly Not enough heat output oss e se o t on Not enough kindling/paper or no kindling/paper 8VHGU\NLQGOLQJPRUHSDSHU$UUDQJHNLQGOLQJ wood for air movement. Check for restricted termination cap &KHFNIRUEORFNDJHRIRXWVLGHDLUNLWLILQVWDOOHG &KHFNIRUÀXHEORFNDJH 1RWHQRXJKDLUIRU¿UHWRLJQLWH 3UHZDUPÀXHEHIRUHVWDUWLQJ¿UHUHIHUWR%XLOGLQJ D)LUH6HFWLRQ &KHFNIRUDGHTXDWHYHQWKHLJKWUHIHUWR&KLPQH\ +HLJKW6HFWLRQ Open window below the appliance towards the wind. Wood condition is too wet, too large 8VHGU\VHDVRQHGZRRGUHIHUWR6HDVRQHG:RRG 6HFWLRQ Bed of coals not established before adding wood Start with paper & kindling to establish bed of FRDOVUHIHUWR%XLOGLQJD)LUH6HFWLRQ Flue blockage such as birds nests or leaves in termination cap Have chimney inspected for creosote and cleaned E\DFHUWL¿HGFKLPQH\VZHHS Down draft or negative pressure Competition with exhaust devices 'RQRWXVHH[KDXVWIDQVGXULQJVWDUWXSUHIHUWR 1HJDWLYH3UHVVXUH6HFWLRQ Fire burns too fast Mix in hardwood. Extremely dry or soft wood 0L[LQOHVVVHDVRQHGZRRGDIWHU¿UHLVHVWDEOLVKHG UHIHUWR:RRG)XHO6HFWLRQ &KHFNIRUFRUUHFWYHQWKHLJKWWRRPXFKYHUWLFDO height creates overdrafting. Overdrafting Page 20 Open window below the appliance towards the wind. &KHFNORFDWLRQRIYHQWWHUPLQDWLRQUHIHUWR &KLPQH\7HUPLQDWLRQ5HTXLUHPHQW6HFWLRQ 7075-166C May 23, 2013 R VOYAGEUR GRAND Wood Insert er e rts Re e ent UN A G ss Re UG A I E RO ANY OWER OUR E E ORE RE A ING ANY O ONEN e ent n D s Re e ent ont d (Replace with 5mm ceramic glass only) 2. Remove the 2 screws from the blower access assembly 1. (QVXUHWKDWWKH¿UHLVRXWDQGWKHDSSOLDQFHLVFRROWR and slide assembly away from the appliance the touch. 3. Locate the snap disc bracket assembly behind the blower 2. Protect a table or counter top with padding or towels. controls on the right side under the ash lip. re 3URWHFW\RXUKDQGVDQGZHDUJORYHVWRSUHYHQWLQMXU\ 4. Remove the 2 mounting screws in the blower control 3. Remove the door with the broken glass by lifting the bracket and slide assembly towards you. door up and off of the hinges. 5. sing a Phillips head screw driver, remove the 2 screws 4. Lay door face down on a table or counter making sure from the snap disc and lift the snap disc off of the mounting WKHKDQGOHKDQJVRYHUWKHHGJHVRWKHGRRUOD\VÀDWRQ bracket. Disconect the wires and replace with new snap a soft surface. disc and re-connect the wires. 5. Remove the screws from each glass retainer and remove 6. Slide the blower control bracket back into position and WKHJODVV,IVFUHZVDUHGLI¿FXOWWRUHPRYHVRDNZLWK secure with the 2 mounting screws. SHQHWUDWLQJRLO¿UVW 6. Center the glass with edges evenly overlapping the RSHQLQJLQWKHGRRULHVDPHVSDFHWRSDQGERWWRP OHIWDQGULJKWVLGHV 7. Replace the glass retainers. Be careful not to cross thread the screws. Blower Controls & Snap Disc Under Ash Lip 8. 7LJKWHQ HDFK UHWDLQHU MXVW D IHZ WXUQV XQWLO HDFK LV secured. Check again for centering of glass in door frame. Continue to tighten each retainer alternately, a few turns at a time, until the glass is secure. DO NOT O ERTIGHTEN - can cause glass to break. Snap Disc 9. Replace the door on the appliance. WARNING! Risk of Fire or Injury! 8VHRQO\JODVVWKDWLVVSHFL¿HGLQWKHPDQXDO'2127 UHSODFHZLWKDQ\RWKHUPDWHULDO*ODVVEUHDNDJHZLOORFFXU re n Ds o t on CAUTION! Wrn D +DQGOHJODVVZLWKFDUH ,QVSHFWWKHJDVNHWWRHQVXUHLWLVXQGDPDJHG 'R127VWULNHVODPRUVFUDWFKJODVV 'R127RSHUDWHDSSOLDQFHZLWKJODVVGRRUDVVHPEO\ UHPRYHG 'R127RSHUDWHZLWKJODVVFUDFNHGEURNHQRU VFUDWFKHG Quadra-Fire appliances are equipped with ceramic super heat-resistant glass, which can only be broken by impact or misuse. r Blower Black White White Snap Disc Power Cord Black n D s Re White Black e ent 1. The grille on the blower access assembly is hinged. Swing the grille downward to expose the 2 screws. re on e Switch Rheostat re May 23, 2013 7075-166C Page 21 R VOYAGEUR GRAND Wood Insert D o er Re e ent AU ION 1. The grille on the blower access assembly is hinged. Swing the grille downward to expose the 2 screws. re o Rs . 'R127UHPRYHJURXQGLQJSURQJIURPSOXJ 3OXJGLUHFWO\LQWRSURSHUO\JURXQGHGSURQJ receptacle. 5RXWHFRUGDZD\IURPDSSOLDQFH Do NOT route cord under or in front of appliance. 2. Remove the 2 screws from the blower access assembly and slide assembly away from the appliance. 3. Disconnect the wires from the blower. 4. Remove the 2 screws from the hold down bracket and pull the blower and bracket forward. WARNING 5. Remove the blower from the hold down bracket. 6. Remove the protection guards from each end of the blower. 7. Re-install in reverse order. Be certain that the hold down bracket s screws are completely seated in the gromments. Insert the locating tab in the hold down bracket into the placement slot. re R s 'R127DOORZKRWFRDOVRUHPEHUVWRRYHUÀRZDVKOLS May melt protective wire coating on fan power FRUGFDXVLQJHOHFWULFDOVKRUW¿UHRULQMXU\ CAUTION! Unplug appliance from power source before replacing any components. Placement Slot Blower Access Assembly Grille hinges downward Remove Screws & Pull Access Assembly away from Insert Hold Down Bracket Remove Screws from Hold Down Bracket and Pull Forward re Page 22 7075-166C May 23, 2013 R VOYAGEUR GRAND Wood Insert E Door F BafÀe Ceramic BlanNet Removal nd e Asse 1. Install washer on door handle shaft. 5HPRYH DOO DVK IURP WKH ¿UHER[ DQG H[WLQJXLVK DOO KRW embers before disposal into a metal container. 2. Slide door handle through door. ,W LV HDVLHU WR UHPRYH ERWK EDIÀH ERDUGV DQG FHUDPLF blanket after the tube channel assembly has been partially 4. Install key in groove. disassembled and the right side lowered. Follow steps $OLJQJURRYHLQODWFKFDPZLWKNH\VOLGHODWFKFDPRYHU 1 through 4 on e for removal of the tube channel shaft assembly. It is not necessary to completely remove the tube channel assembly. 6. Install locknut but do not overtighten, the handle needs to move smoothly. 2QFHWKHEDIÀHSURWHFWLRQFRYHUKDVEHHQUHPRYHGSXOO WKHEDIÀHERDUGVDQGFHUDPLFEODQNHWIRUZDUGDERXWLQFK 7. Install handle turning in a counter-clockwise motion to PPDQGWKHQRYHUODSWKHEDIÀHVDERXWLQFKHV desired location on door handle rod. re PP re . ,QVWDOODGGLWLRQDOZDVKHUVDVVKRZQLQ re CAUTION!'RQRWRYHUWLJKWHQORFNQXW7KHGRRUKDQGOH QHHGVWRPRYHVPRRWKO\ Latch Cam 4. Slide the tube channel assembly to the left as far as it will JRDQGORZHUWKHULJKWVLGH5HPRYHWKHEDIÀHERDUGVDQG ceramic blanket together. re . 5HLQVWDOOLQUHYHUVHRUGHU%HVXUHWKHEDIÀHERDUGVDQG ceramic blanket are in their proper positions. ee re on e Door Cross Section Door Handle Shaft Ceramic Blanket Locknut Spacing Washers Baffle Boards Overlapping Square Key Fiber Handle re Figure 23.2 Slide Tube Channel to the Left and Lower Right Side Figure 23.3 May 23, 2013 7075-166C Page 23 R er . u e e e e e e 5HPRYLQJ7XEH&KDQQHO$VVHPEO\ Bend Back Tabs 1. Remove the 3 right side bricks. 5HPRYHWKHEDIÀHSURWHFWLRQFKDQQHOE\EHQGLQJEDFNWKHWDEV using needle nose pliers located at the right and left side of the protection cover. Lift the cover up slightly and pull toward the IURQWDQGRXWRIWKH¿UHER[Figure 2 . . Baffle Protection Channel 3. Locate the 2 channel nuts and two bolts inside of chamber and remove using a 7/16 socket wrench. Figure 2 .2. Figure 2 . : Soak the bolts with penetrating oil for at least 15 minutes before trying to remove them. 4. Slide the tube channel assembly all the way to left until it is off the threads. Drop the right side down, then slide the assembly back to right. Figure 2 .3. 7KHFHUDPLFEODQNHWDQGERWKEDIÀHERDUGVFDQEHUHPRYHGDW the same time you remove the tube channel assembly. 6. When the tube channel assembly is free of the left side supSRUWURWDWHFORFNZLVHDQGSXOODVVHPEO\EODQNHWDQGEDIÀHVRXW through the front opening. Use 7/16 Socket Wrench and Remove Channel Nuts 7. Re-install in reverse order. Tube Channel Assembly Figure 2 .2 2 Tube Channel Nuts Ceramic Blanket 2 Baffle Boards Baffle Protection Channel Figure 2 .3 Page 24 7075-166C May 23, 2013 R er er e i g ui e re . e ig i i er i . r Draft is the pressure difference needed to vent appliances successfully. When a appliance is drafting successfully, all combustion byproducts are e iting the home through the chimney. Check building codes prior to installation. ,QVWDOODWLRQ 0867 FRPSO\ ZLWK ORFDO UHJLRQDO VWDWH DQG national codes and regulations. &RQVXOW LQVXUDQFH FDUULHU ORFDO EXLOGLQJ ¿UH RI¿FLDOV RU DXWKRULWLHVKDYLQJMXULVGLFWLRQDERXWUHVWULFWLRQVLQVWDOODWLRQ inspection, and permits. uadra- ire wood inserts are designed for factory-built nonFRPEXVWLEOH ¿UHSODFHV WKDW KDYH EHHQ LQVWDOOHG LQ DFFRUdance with the ational, Provincial, State and local building codes. 1. Prior to installing the wood insert: Considerations for successful draft include: 3UHYHQWLQJQHJDWLYHSUHVVXUH /RFDWLRQRIDSSOLDQFHDQGFKLPQH\ o be sure that your appliance burns properly: 'XULQJDORZEXUQWKHFKLPQH\GUDIWVWDWLFSUHVVXUHVKRXOG EHDSSUR[LPDWHO\LQFKZDWHUFROXPQ:& 'XULQJDKLJKEXUQWKHFKLPQH\GUDIWVKRXOGEHDSSUR[LPDWHO\ LQFK:& 0HDVXUHWKH:&DWLQFKHVPPDERYHWKHWRSRIWKH appliance after one hour of operation at each burn setting. earth ome echnologies assumes no +DYHWKHFKLPQH\DQGDGMDFHQWVWUXFWXUHLQVSHFWHGDQG responsibility for the improper performance of the appliance FOHDQHGE\TXDOL¿HGSURIHVVLRQDOV+HDUW+RPH7HFKsystem caused by: QRORJLHVUHFRPPHQGVWKDW1),RU&6,$FHUWL¿HGSURIHVVLRQDOV RU WHFKQLFLDQV XQGHU WKH GLUHFWLRQ RI FHUWL¿HG nade uate draft due to environmental conditions SURIHVVLRQDOVFRQGXFWDPLQPXPRID1)3$/HYHO inspection of the chimney. 'RZQGUDIWV 7LJKWVHDOLQJFRQVWUXFWLRQRIWKHVWUXFWXUH 5HSODFH FRPSRQHQW SDUWV RI WKH FKLPQH\ DQG ¿UHSODFH DVVSHFL¿HGE\WKHSURIHVVLRQDOV 0HFKDQLFDOH[KDXVWLQJGHYLFHV 2YHUGUDIWLQJFDXVHGE\H[FHVVLYHFKLPQH\KHLJKWV (QVXUHDOOMRLQWVDUHSURSHUO\HQJDJHGDQGWKHFKLPQH\LV ,GHDOSHUIRUPDQFHLVZLWKKHLJKWRIFKLPQH\EHWZHHQ properly secured. IHHWPPHDVXUHGIURPWKHEDVHRI 2. Prior to installing, determine the following: the appliance. 7\SHRIFKLPQH\FRQQHFWRUWREHXVHG VLQJOHZDOOLQFKPPGLDPHWHUVWDLQOHVVVWHHO or double wall, LQFKPPGLDPHWHUVWDLQOHVVVWHHO Fire i . &RQVXOW ge 3 32 for clearances to combustibles earth ome echnologies disclaims any 3RZHURXWOHWORFDWHGFORVHE\IRURSWLRQDOEORZHU responsibility for, and the warranty will be i i i . '2127&211(&77+,681,772$&+,01(< )/8(6(59,&,1*$127+(5$33/,$1&( '2127&211(&772$1<$,5',675,%87,21 '8&7256<67(0 0D\DOORZÀXHJDVHVWRHQWHUWKHKRXVH May 23, 2013 voided by, the following actions: ,QVWDOODWLRQDQGXVHRIDQ\GDPDJHGDSSOLDQFH 0RGL¿FDWLRQRIWKHDSSOLDQFH ,QVWDOODWLRQ RWKHU WKDQ DV LQVWUXFWHG E\ +HDUWK +RPH echnologies. ,QVWDOODWLRQDQGRUXVHRIDQ\FRPSRQHQWSDUWQRWDSSURYHG by earth ome echnologies. 2SHUDWLQJ DSSOLDQFH ZLWKRXW IXOO\ DVVHPEOLQJ DOO components. 2SHUDWLQJDSSOLDQFHZLWKRXWOHJVDWWDFKHGLIVXSSOLHGZLWK XQLW 'R1272YHU¿UH,IDSSOLDQFHRUFKLPQH\FRQQHFWRUJORZV \RXDUHRYHU¿ULQJ Any such action that may cause a ¿re ha]ard. 7075-166C Page 25 R er . eg i e re ure i i i . 1HJDWLYHSUHVVXUHFDQFDXVHVSLOODJHRIFRPbustion fumes, soot and carbon mono ide. $SSOLDQFHQHHGVWRGUDIWSURSHUO\IRUVDIHW\ egative pressure results from the imbalance of air available for the appliance to operate properly. t can be strongest in lower levels of the house. Causes include: ([KDXVWIDQVNLWFKHQEDWKHWF 5DQJHKRRGV &RPEXVWLRQDLUUHTXLUHPHQWVIRUIXUQDFHVZDWHUKHDWHUV and other combustion appliances &ORWKHVGU\HUV /RFDWLRQRIUHWXUQDLUYHQWVWRIXUQDFHRUDLUFRQGLWLRQLQJ ,PEDODQFHVRIWKH+9$&DLUKDQGOLQJV\VWHP 8SSHUOHYHODLUOHDNVVXFKDV - Recessed lighting $WWLFKDWFK - Duct leaks o minimi e the effects of negative air pressure: ,QVWDOOWKHRXWVLGHDLUNLWZLWKWKHLQWDNHIDFLQJSUHYDLOLQJ winds during the heating season (QVXUHDGHTXDWHRXWGRRUDLUIRUall combustion appliances and e haust e uipment (QVXUHIXUQDFHDQGDLUFRQGLWLRQLQJUHWXUQYHQWVDUHQRW located in the immediate vicinity of the appliance $YRLG LQVWDOOLQJ WKH DSSOLDQFH QHDU GRRUV ZDONZD\V RU small isolated spaces 5HFHVVHGOLJKWLQJVKRXOGEHD³VHDOHGFDQ´GHVLJQ $WWLFKDWFKHVZHDWKHUVWULSSHGRUVHDOHG $WWLFPRXQWHGGXFWZRUNDQGDLUKDQGOHUMRLQWVDQGVHDPV taped or sealed %DVHPHQWLQVWDOODWLRQVVKRXOGEHDYRLGHG Page 26 7075-166C May 23, 2013 R er . i g ur e i e Location of the appliance and chimney will affect perforPDQFH$VVKRZQLQFigure 2 . the chimney should: ,QVWDOOWKURXJKWKHZDUPVSDFHHQFORVHGE\WKHEXLOGing envelope. his helps to produce more draft, espeFLDOO\GXULQJOLJKWLQJDQGGLHGRZQRIWKH¿UH 3HQHWUDWHWKHKLJKHVWSDUWRIWKHURRI7KLVPLQLPL]HV the affects of wind turbulence and down drafts. Recommended Location &RQVLGHU WKH DSSOLDQFH ORFDWLRQ LQ RUGHU WR DYRLG ÀRRUDQGFHLOLQJDWWLFMRLVWVDQGUDIWHUV /RFDWH WHUPLQDWLRQ FDS DZD\ IURP WUHHV DGMDFHQW structures, uneven roof lines and other obstructions. <RXUORFDOGHDOHULVWKHH[SHUWLQ\RXUJHRJUDSKLFDUHDDQG can usually make suggestions or discover solutions that will HDVLO\FRUUHFW\RXUÀXHSUREOHP Recommended Location Marginal Location Location Not Recommended Location NOT Recommended Windward Outside Termination Cap Leeward Multi-level Roofs Figure 2 . . i e er i i e uire e ollow manufacturer s instructions for clearance, securing ÀDVKLQJDQGWHUPLQDWLQJWKHFKLPQH\ Must have an approved and Listed cap Must not be located where it will become plugged by snow or other material 0XVWWHUPLQDWHDWOHDVWIHHWFPDERYHWKHURRI DWOHDVWIHHWFPDERYHDQ\SRUWLRQRIWKH URRIZLWKLQIHHWFP 0XVWEHORFDWHGDZD\IURPWUHHVRURWKHUVWUXFWXUHV NOTICE: /RFDWLQJWKHDSSOLDQFHLQDEDVHPHQWRULQDORFDWLRQ RIFRQVLGHUDEOHDLUPRYHPHQWFDQFDXVHLQWHUPLWWHQWVPRNH VSLOODJHIURPDSSOLDQFH'RQRWORFDWHDSSOLDQFHQHDU )UHTXHQWO\RSHQGRRUV &HQWUDOKHDWRXWOHWVRUUHWXUQV NOTICE &KLPQH\SHUIRUPDQFHPD\YDU\ 7UHHVEXLOGLQJVURRIOLQHVDQGZLQGFRQGLWLRQVDIIHFW SHUIRUPDQFH &KLPQH\KHLJKWPD\QHHGDGMXVWPHQWLIVPRNLQJRU RYHUGUDIWRFFXUV May 23, 2013 7075-166C Page 27 R er F. 2 3 ue These are safety reTuirements and are not meant to assure proper Àue draft. 7KLVDSSOLDQFHLVPDGHZLWKDLQFKPPGLDPHWHUFKLPQH\FRQQHFWRUDVWKHÀXHFROODURQWKHXQLW &KDQJLQJWKHGLDPHWHURIWKHFKLPQH\FDQDIIHFWGUDIWDQGFDXVHSRRUSHUIRUPDQFH ,WLVQRWUHFRPPHQGHGWRXVHRIIVHWVDQGHOERZVDWDOWLWXGHVDERYHIHHWDERYHVHDOHYHODQGRUZKHQ WKHUHDUHRWKHUIDFWRUVWKDWDIIHFWÀXHGUDIW Less than 10 ft. (305cm) 2 ft. (61cm) 2 ft. (61cm) 3 ft. (91cm) Minimum 10 ft. (305cm) To Nearest Roofline 3 ft. (91cm) Minimum Pitched Roof Figure 2 . 10 ft. (305cm) or more Less than 10 ft. (305cm) Wall or Parapet 2 ft. (61cm) Minimum 3 ft. (91cm) Minimum 3 ft. (91cm) Minimum Flat Roof Figure 2 .2 Page 2 7075-166C May 23, 2013 R er . u ie ee e re ur e i efore beginning the installation be sure the following tools and building supplies are available: 7/16 Socket raming materia 1. Reciprocating saw igh temp caulking material l 3ODFHWKHDSSOLDQFHLQDORFDWLRQQHDUWKH¿QDO installation area and follow the procedures below: 2. Pliers loves pen the appliance and remove all the parts and articles packed inside the Component Pack. nspect all the parts and glass for shipping damage. Contact your dealer if any irregularities are noticed. 3. $OOVDIHW\ZDUQLQJVKDYHEHHQUHDGDQGIROORZHG ammer raming s uare Phillips screwdriver lectric drill and bits lat blade screwdriver Plumb line Safety glasses 4. his ape measure 5. loor protection re uirements have been met. Level Wire Cutters to remove from pallet 1/2-3/4 in. length, 6 or self-drilling screws Misc. screws and nails . Fire ,QVWDOO DW OHDVW RQH VPRNH GHWHFWRU RQ HDFK ÀRRU RI your home to ensure your safety. hey should be located away from the heating appliance and close to the sleeping areas. ollow the smoke detector manufacturer s placement and installation instructions, and be sure to maintain regularly. . 6. enting is properly installed per vent manufacturing instructions. 7. he proper clearances from the appliance and chimney to combustible materials have been met. . he masonry chimney is inspected by a professional and is clean, or the factory built metal chimney is installed according to the manufacturer s instructions and clearances. . he chimney meets the re uired minimum height. e 7R SURYLGH UHDVRQDEOH ¿UH VDIHW\ WKH IROORZLQJ VKRXOG EH given serious consideration: 10. $OOODEHOVKDYHEHHQUHPRYHGIURPWKHJODVV door. 11. Plated surfaces have been wiped clean, if applicable. 12. $ SRZHU RXWOHW LV DYDLODEOH QHDUE\ IRU XVH RI WKH blower assembly. $ FRQYHQLHQWO\ ORFDWHG &ODVV $ ILUH H[WLQJXLVKHU to contend with small fires resulting from burning embers. e i e e 5HPRYHDSSOLDQFHDQGFRPSRQHQWVIURPSDFNDJLQJDQG inspect for damage. 9HQW V\VWHP FRPSRQHQWV DQG GRRUV DUH VKLSSHG LQ separate packages. 5HSRUWWR\RXUGHDOHUDQ\SDUWVGDPDJHGLQVKLSPHQW wner s Manual has been read. Fire i . nspect appliance and components for damage. Damaged parts may impair safe operation. 'R127LQVWDOOGDPDJHGFRPSRQHQWV 'R127LQVWDOOLQFRPSOHWHFRPSRQHQWV 'R127LQVWDOOVXEVWLWXWHFRPSRQHQWV Report damaged parts to dealer. Read all the instructions before starting the i i . F e e i ru i re u uri g e i i e ure i u e bene¿t. May 23, 2013 7075-166C Page 2 R er i e . i i e r e i e e F ue i r i ei i 2 i 32 5/8 (829mm) 23 3/4 (602mm) e er A 17 15/16 456 mm B 5 (127mm) Figure 3 . ie Figure 3 .2 Fr er 14 (356mm) ie i urr u i e Metal Surround w/Cast Trim-STD 42.5 in. (1080mm) 30 in. (762mm) Metal Surround w/Cast Trim-LRG 48 in. (1219mm) 34 in. (864mm) All Cast Surround 44 in. (1016mm) 33 in. (762mm) Metal Surround w/Standard Trim-STD 43 in. (1092mm) 31 in. (787mm) Metal Surround w/Standard Trim-LRG 51 in. (1295mm) 34 in. (2184mm) 25 3/4 (655mm) 14 (356mm) 11 (279mm) 4 (102mm) 15 (382mm) 30° 23 1/2 (597mm) 25 1/2 (648mm) 6 1/16 (154mm) 2 7/8 (73mm) Figure 3 . Figure 3 .3 Page 30 i e ie i i F ue i e ie i u i F ue er 7075-166C May 23, 2013 er R er e r e u i e ie e 22 1/2 (572mm) 32 5/8 (829mm) SIDE TRIM (3” max depth) TOP TRIM (3/4” max depth) SIDE WALL 43 (1092 mm) HEARTH EXTENSION (MINIMUM EMBER PROTECTION) USA 38 1/4 CANADA 46 1/4 (1175mm) MANTEL (12” max depth) USA 17 1/2 CANADA 19 1/2 (495mm) 45 (1143 mm) MANTEL DEFLECTOR REQUIRED FIREPLACE FRONT SURFACE . HEARTH EXTENSION (EMBER PROTECTION) May 23, 2013 7075-166C Page 31 R er . e r e u i e ie e . Re qu ire d Pr Su ote gg cti es on ted Pr ote cti on NOTE: Keep Ashlip Clear of Ashes 0 to 5 inches from bottom of unit, thermal protection required. R value of 2.38. Figure 32.2 5 inches or more from bottom of unit, ember protection only required Figure 32. e r ug eu e i ugge e re Fire i . &RPSO\ZLWKDOOPLQLPXPFOHDUDQFHVWR FRPEXVWLEOHVDVVSHFL¿HG )DLOXUHWRFRPSO\PD\FDXVHKRXVH¿UH e r r i i Page 32 e e e regu r u e re u e e ri i g uri 7075-166C May 23, 2013 R er . u i g er eF r r e i eri er u i i ue 7KHNYDOXHLQGLFDWHVWKHDPRXQWRIKHDWLQ%78¶VWKDW ZLOOÀRZLQKRXUWKURXJKVTXDUHIRRWRIDXQLIRUPPDWHULDOLQFKWKLFNIRUHDFKGHJUHH)RIWHPSHUDWXUHGLIIHUence from one side of the material to the other. he L W R the k factor means less heat is being conducted through the non-combustible material to the combustible material beneath it. he k value of a material must be e ual or smaller then the re uired k value to be acceptable. %78LQFK IRRW2KRXUo) er e i e ue he R value is a measure of a material s resisteance to heat transfer. R value is convenient when more than one material is used since you can add the R values together, whereas you can not do this for k value. he R the R factor means less heat is being conducted through the non-combustible material to the combustible material beneath it. he R value of a material must be e ual or larger then the re uired R value to be acceptable. er i g Divide 1 by k and multiply the results times the thickness in inches of the material. R 1/k inches of thickness er i g Divide the inches of thickness by R. k inches of thickness/R u ample: loor protection re uires k value of 0. 4 and 3/4 inch thick. $OWHUQDWLYH PDWHULDO KDV D N YDOXH RI DQG LV LQFK thick. Divide 0.6 by .75 k value of 0. 0. his k value is smaller than 0. 4 and therefore is acceptable. May 23, 2013 7075-166C Page 33 R er i . e e i g i e e . e e e 0XVWKDYHDWOHDVWLQFKPP¿UHFOD\OLQLQJMRLQHG with refractory cement. i i i e ee i er re u e r er r e i u e e g r u e e e i e re e i ue . e : he chimney can be new or e isting, masonry or prefabricated and must meet the following minimum UHTXLUHPHQWVDVVSHFL¿HGEHORZ WARNING! Risk of Fire! )ROORZ YHQWLQJ PDQXIDFWXUHU¶V FOHDUDQFHV DQG LQVWUXFWLRQVZKHQLQVWDOOLQJYHQWLQJV\VWHP . i 0XVWPHHWPLQLPXPVWDQGDUGVRI1)3$ r ,W LV DOVR NQRZQ DV ÀXH SLSH RU VWRYH SLSH ,W PXVW EH LQFKHV PP PLQLPXP GLDPHWHU VWDLQOHVV VWHHO connector pipe. i r e i sting i chimneys should be inspected and cleaned by a TXDOL¿HG SURIHVVLRQDO SULRU WR LQVWDOODWLRQ 7KH FKLPQH\ must not have cracks, loose mortar or other signs of deterioration and blockage. earth ome recommends a 1),RU&6,$FHUWL¿HGSURIHVVLRQDORUDWHFKQLFLDQXQGHU WKHGLUHFWLRQRIDFHUWL¿HGSURIHVVLRQDOFRQGXFWD/HYHO,, LQVSHFWLRQSHU1)3$ ue i i u e r e re e r u he masonry wall of the chimney, if brick or modular EORFNPXVWEHDPLQLPXPRILQFKHVPPQRPLQDO thickness. $ FKLPQH\ RI UXEEOH VWRQH PXVW EH DW OHDVW LQFKHV PPWKLFN &URVVVHFWLRQDO DUHD VKDOO FRQIRUP WR 1)3$ Section 12.4.5.1. 6KRXOG EH OLQHG ZLWK D LQFK PP VWDLQOHVV VWHHO ÀXHOLQHUWRLPSURYHSHUIRUPDQFHDQGUHGXFHFUHRVRWH EXLOGXSDQGGLI¿FXOW\VWDUWLQJD¿UH $QHTXLYDOHQWOLQHUPXVWEHDOLVWHGFKLPQH\OLQHUV\VWHP or other approved material. 1RGLOXWLRQDLULVDOORZHGWRHQWHUWKHFKLPQH\ 1. 6HFXUHWKH¿UHSODFHGDPSHULQWKHRSHQSRVLWLRQ,I this cannot be accomplished, it will be necessary to remove the damper ire Risk nspection of Chimney: &KLPQH\PXVWEHLQJRRGFRQGLWLRQ 0HHWVPLQLPXPVWDQGDUGRI1)3$ )DFWRU\EXLOWFKLPQH\PXVWEHLQFK PP8/+7 2. Seal damper area of chimney around chimney connector with a high temperature sealant or seal LQVHUWDJDLQVWWKHIDFHRIWKH¿UHSODFH 3. oth methods must be removable and replaceable for cleaning and re-installation. :KHQ SRVVLEOH LQVWDOO DQ DLUWLJKW FOHDQRXW GRRU WR WKH rear of the smoke shelf. . rger i e earth ome recommends that chimneys with larger GLDPHWHUVWKDQLQFKHVPPEHIXOO\UHOLQHG$QRYHUVL]HGÀXHFDQDIIHFWGUDIWDQGLPSDLUSHUIRUPDQFHDQGZLOO allow increased build-up of creosote which is why a full reline is stongly recommended. 0DVRQU\FKLPQH\VDUHVLJQL¿FDQWO\OHVVWKDQLGHDO IRUYHQWLQJVROLGIXHODSSOLDQFHV$PDVRQU\FKLPQH\LVQRW VXEMHFWWRDQ\WHPSHUDWXUHOLPLWWHVWWKHUHIRUHDIXOOUHOLQH is strongly recommended. NOTICE: Check with your local building authorities DQGRUFRQVXOWWKH1DWLRQDO)LUH3URWHFWLRQ$VVRFLDWLRQ 1)3$ Page 34 7075-166C May 23, 2013 R er r i e his insert conforms with the L 14 2 and LC S62 &DQDGD LQ DOO UHVSHFWV DQG LV DSSURYHG WR 8/ 8/& VDIHW\ VWDQGDUGV IRU LQVWDOODWLRQ DQG XVH ZLWKLQ D ¿UHSODFH ZLWKDPDVRQU\FKLPQH\LQDFFRUGDQFHZLWK1)3$DQG &$1&6$% In USA a minimum 5 foot length, 6 inch diameter Àue i er i re uire er 2 e er e r e e gie strongly re e u re i e r i u er r e. ,Q&DQDGDWKLV¿UHSODFHLQVHUWPXVWEHLQVWDOOHG ZLWKDFRQWLQXRXVFKLPQH\OLQHURIDLQFKPPGLDPHWHUH[WHQGLQJIURPWKH¿UHSODFHLQVHUWWRWKHWKHWRSRIWKH chimney. he chimney liner must conform to the Class 3 re uirePHQWVRI&$18/&66WDQGDUGIRU/LQLQJ6\VWHPVIRU sting i Masonry or actory- uilt Chimneys and ents, RU&$18/&66WDQGDUGIRU/LQLQJ6\VWHPVIRU1HZ Masonry Chimneys. UL 1777 Insulated Stainless Steel Liner or Other Approved Lining System Follow Manufacturer’s Instructions for Maximum Liner Extension Above Chimney Follow Manufacturer’s Instructions on Insulation and Support Maximum 30 Degrees Offset in Chimney For Zero or Other Non-Code Clearances, Follow Approved Liner Manufacturer’s Specific Insulation Requirements: Different Clearances May Require Different Specifications Masonry Chimney Must Have Structural Integrity UL 1777 Insulated Stainless Steel Liner or Other Approved Lining System Minimum 8 in. (203mm) Masonry Thickness in Front of Smoke Chamber Damper Plate Removed or Fastened in Open Position Minimum Clearance in Accordance with Insert Listing Floor Protection in Accordance with Insert Listing Seal with Non-Combustible Material Combustible Floor 127(*HQHULFZRRGLQVHUWVKRZQQRWPRGHOVSHFL¿F Figure 3 . r May 23, 2013 i e i Fu i er i e 7075-166C 3 uire e er Page 35 R er . e e ir u i g Inches r his insert conforms with the safety standard L-14 2 and 8/&6&DQDGDLQDOOUHVSHFWVDQGLVDSSURYHGWR8/ 8/&VDIHW\VWDQGDUGVIRULQVWDOODWLRQDQGXVHZLWKLQD¿UHSODFHZLWKPDVRQU\FKLPQH\LQDFFRUGDQFHZLWK1)3$ DQG&$1&6$% F. re ri e e i e he chimney can be new or e isting, masonry or prefabricated and must meet the following minimum re uirements: 0XVW EH PLQLPXP LQFK PP LQVLGH GLDPHWHU RI KLJKWHPSHUDWXUHFKLPQH\OLVWHGWR8/+7o) or LC S62 . 0XVWXVHFRPSRQHQWVUHTXLUHGE\WKHPDQXIDFWXUHUIRU installation. 0XVWPDLQWDLQFOHDUDQFHVUHTXLUHGE\WKHPDQXIDFWXUHU for installation. 5HIHUWRPDQXIDFWXUHUVLQVWUXFWLRQVIRULQVWDOODWLRQ 7KLV LQVHUW LV OLVWHG WR 8/ 6WDQGDUG DQG LV approved for installation into listed factory-built solid fuel ¿UHSODFHVOLVWHGWR8/FRQIRUPLQJWRWKHIROORZLQJVSHFL¿FDWLRQVDQGLQVWUXFWLRQV Minimum Width of Cavity Opening - Front 32-7/ 35 Minimum Width of Cavity Opening - Rear 24 610 Minimum Height 24 610 Minimum Depth from Front to Rear 1 457 <RXZLOOQHHGWRDGGDGGLWLRQDOFOHDUDQFHVWRWKHVH GLPHQVLRQVIRU\RXUVSHFL¿FLQVWDOODWLRQ$OVRDOORZVXI¿FLHQWFOHDUDQFHLI\RXDUHLQVWDOOLQJDQRXWVLGHDLUNLW e er i e i er u urer r re e i u r i g e i er. i i ¿replaces without a permit will void the listing. NOTICE: n Canada when using a factory-built chimney it must be safety listed, e 3 2 F or conforming to 2 F F . :$51,1* ire Risk. When lining air-cooled factory-built chimneys:. 5XQFKLPQH\OLQHUDSSURYHGWR8/7\SH +7UHTXLUHPHQWVGHJUHHV) 5HLQVWDOORULJLQDOIDFWRU\EXLOWFKLPQH\FDS 21/< '2127EORFNFRROLQJDLURSHQLQJVLQFKLPQH\ %ORFNLQJFRROLQJDLUZLOORYHUKHDWWKHFKLPQH\ 7KH RULJLQDO IDFWRU\EXLOW FOHDUDQFH ¿UHSODFH FKLPQH\ cap must be re-installed after installing the approved chimney liner meeting type L 103 re uirements )SHU8/ 7KH OLQHU PXVW EH VHFXUHO\ DWWDFKHG WR WKH LQVHUW ÀXH collar and the chimney top. 7KH DLU ÀRZ RI WKH IDFWRU\EXLOW VROLG IXHO ¿UHSODFH V\VWHPPXVWQRWEHDOWHUHG7KHÀXHOLQHUWRSVXSSRUW DWWDFKPHQWPXVWQRWUHGXFHWKHDLUÀRZIRUWKHH[LVWLQJ air-cooled chimney system. 1RGLOXWLRQDLULVDOORZHGWRHQWHUWKHFKLPQH\ 1. 6HFXUHWKH¿UHSODFHGDPSHULQWKHRSHQSRVLWLRQ f this cannot be accomplished, it will be necessary to remove the damper. 2. Seal damper area of chimney around chimney connector with a high temperature sealant or seal LQVHUWDJDLQVWWKHIDFHRIWKH¿UHSODFH 7R PDLQWDLQ WKH IXQFWLRQDOLW\ RI WKH ¿UHSODFH¶V FKLPQH\ system you may use a Simpson Dura- ent DuraLiner Slip anger, Part 4671, and attach to the bottom of the ¿UHSODFH FKLPQH\ FDS WR VXSSRUW WKH OLQHU <RX KDYH WZR options to completing the installation. i e re uire u e i er : Re-attach the e isting top of the chimney cap. i i g i er Re-attach the e isting top of the chimney cap and install a new storm collar and a new liner cap. 3. oth methods must be removable and replaceable for cleaning and re-installation. Page 36 Millimeters 7075-166C WARNING! Risk of Fire! )ROORZ YHQWLQJ PDQXIDFWXUHU¶V FOHDUDQFHV DQG LQVWUXFWLRQVZKHQLQVWDOOLQJYHQWLQJV\VWHP May 23, 2013 R er . e uri g i e . F e $OO MRLQWV VKRXOG EH VHFXUHG ZLWK VKHHW PHWDO VFUHZV RU rivets per pipe manufacturers instructions. he sections must be attached to the insert and to each other with the crimped PDOHHQGSRLQWLQJWRZDUGWKHLQVHUWFigure 3 . . LINER CONNECTOR r ui Fue Fire e $SHUPLWPD\EHUHTXLUHGIRULQVWDOODWLRQV¿QDODSSURYDOLV FRQWLQJHQWRIWKHDXWKRULW\KDYLQJORFDOMXULVGLFWLRQConsult LQVXUDQFHFDUULHUORFDOEXLOGLQJ¿UHRI¿FLDOVRUDXWKRULWLHV KDYLQJ MXULVGLFWLRQ DERXW UHVWULFWLRQV LQVWDOODWLRQ LQVSHFtion, and permits. ,QVSHFWWKHH[LVWLQJ¿UHSODFHDQGFKLPQH\IRUDQ\GDPDJH RUÀDZVVXFKDVEXUQRXWVPHWDORUUHIHFWRU\ZDUSLQJ CRIMPED END TOWARDS STOVE FLUE GAS DIRECTION ,QVSHFWLRQ WR D PLQLPXP RI 1)3$ /HYHO ,, LV UHFRPPHQGHG $OO UHSDLUV PXVW EH PDGH SULRU WR LQVWDOOLQJ DQ LQVHUW 7KH ¿UHSODFH PXVW EH VWUXFWXUDOO\ VRXQG DQG EH able to support the weight of the solid-fuel insert he factory-built chimney must be listed per L 127 or LC 610-M 7 for all installations. nstall thermal protection per this appliance listing re uirements. Figure 3 . . eri g e Fire e 7KH IROORZLQJ PRGL¿FDWLRQV RI IDFWRU\EXLOW ¿UHSODFHV DUH permissible: 7KHIROORZLQJSDUWVPD\EHUHPRYHG Damper 6PRNH6KHOIRU%DIÀH mber Catches iewing Screen/Curtain ire rate Doors 7KH¿UHSODFHPXVWQRWEHDOWHUHGH[FHSWWKDWWKHGDPSHU may be removed to accommodate a direct-connect starter pipe or chimney liner, ternal trim pieces which do not affect the operation RIWKH¿UHSODFHPD\EHUHPRYHGSURYLGLQJWKH\FDQEH VWRUHG RQ RU ZLWKLQ WKH ¿UHSODFH IRU UHDVVHPEO\ LI WKH insert is removed. he permanent metal warning label provided in the component pack must be attached to the back of the ¿UHSODFHZLWKVFUHZVRUQDLOVVWDWLQJWKDWWKH¿UHSODFH may have been altered to accommodate the insert, and must be returned to original condition for use as a FRQYHQWLRQDO¿UHSODFHFigure 3 .2. 0DQXIDFWXUHU GHVLJQHG DGMXVWDEOH VXSSRUW NLW FDQ EH ordered from your dealer. inal approval of this installation type is contingent upon WKHDXWKRULW\KDYLQJMXULVGLFWLRQ WARNING u eig i i e er i e ee u eig i e i e i er u ei e ee i g e 2 F re uire e er r 3 i e r e r . e u i er must be attached to the insert Àue collar and to the top ee i i g i e . 7KHÀXHOLQHUWRSVXSSRUWDWWDFKPHQWPXVWQRWUHGXFHWKH DLU ÀRZ IRU WKH H[LVWLQJ DLUFRROHG FKLPQH\ V\VWHP 5H install original factory-built chimney cap 6HH6HFWLRQ)3UHIDEULFDWHG0HWDO&KLPQH\ o prevent room air passage to the chimney cavity of the ¿UHSODFHVHDOHLWKHUWKHGDPSHUDUHDDURXQGWKHFKLPQH\ OLQHURUWKHLQVHUWVXUURXQG&LUFXODWLQJDLUFKDPEHULHLQ D VWHHO ¿UHSODFH OLQHU RU PHWDO KHDUWK FLUFXODWRU PD\ QRW EHEORFNHG7KHDLUÀRZZLWKLQDQGDURXQGWKH¿UHSODFH shall not be altered, blocked by the installation of the insert. LHQRORXYHUVRUFRROLQJDLULQOHWRURXWOHWSRUWVPD\EH blocked by the insert or the insert surround. 6HH³+$OWHULQJWKH)LUHSODFH´IRUPRGL¿FDWLRQVDOORZHGIRU IDFWRU\EXLOW¿UHSODFHV WARNING! Risk of Asphyxiation! '2127&211(&77+,6$33/,$1&(72 $&+,01(<)/8(6(59,&,1*$127+(5 $33/,$1&(2572$1<$,5',675,%87,21 '8&7256<67(0 7KLVPD\DOORZÀXHJDVHVWRHQWHUWKHKRXVH THIS FIREPLACE MAY HAVE BEEN ALTERED TO ACCOMMODATE AN INSERT. IT MUST BE RETURNED TO ITS ORIGINAL CONDITION BEFORE USE AS A SOLID FUEL BURNING FIREPLACE. 250-2061 250-2061 Figure 3 .2 May 23, 2013 7075-166C Page 37 R er . i i g u i e ee i er vali ing round stainless steel liners to accommodate the OLQHUSDVVLQJWKURXJKWKHGDPSHUUHJLRQRID¿UHSODFHLVDQ allowable and acceptable practice. nsure that the ovali ation is minimi ed to the e tent UHTXLUHGWR¿WWKURXJKWKHGDPSHU . i e eig i e ire Risk. ailure to install a full reline may cause: &UHRVRWHDFFXPXODWLRQFUHDWLQJLQFUHDVHGULVNRI FKLPQH\¿UH /RVHSURWHFWLRQWRFRPEXVWLEOHVXUIDFHVIURPWKH OLQHULQFDVHRI¿UH u o be sure that your uadra- ire insert burns properly, the FKLPQH\GUDIWVWDWLFSUHVVXUHVKRXOGEHDSSUR[LPDWHO\ LQFKHV ZDWHU FROXPQ :& GXULQJ D KLJK EXUQ DQG LQFKHV:&GXULQJDORZEXUQPHDVXUHGLQFKHVPP above the top of the insert after one hour of operation at each burn setting. 3RRUSHUIRUPDQFHDQGVWDUWXSV /HVVDFFHVVWRFKLPQH\IRUUHTXLUHGPDLQWHQDQFH : hese are guidelines only, and may vary somewhat for individual installations. his product was designed for and tested on a 6 inch PP FKLPQH\ WR IHHW P KLJK LQFOXGHV DSSOLDQFH KHLJKW PHDVXUHG IURP WKH EDVH RI WKH appliance. he further your stack height or diameter varies from this FRQ¿JXUDWLRQWKHSRVVLELOLW\RISHUIRUPDQFHSUREOHPVH[ists. Chimney height may need to be increased by 2 - 3 HDFKIHHWPDERYHVHDOHYHO per t is not recommended to use offsets or elbows at altitudes DERYHIHHWPDERYHVHDOHYHORUZKHQWKHUH DUHRWKHUIDFWRUVWKDWDIIHFWÀXHGUDIW ire Risk. Do pack insulation or other combustibles between spacers. $/:$<6PDLQWDLQVSHFL¿HGFOHDUDQFHVDURXQG venting and spacers. ,QVWDOOVSDFHUVDVVSHFL¿HG ailure to keep insulation or other material away from YHQWSLSHPD\FDXVH¿UH ire Risk. his appliance relies upon natural draft to operate properly. &KLPQH\KHLJKWVH[FHHGLQJIHHWPIURP base of appliance may create an over-draft situation. 2YHUGUDIWFRQGLWLRQPD\FUHDWHRYHU¿ULQJ 2YHU¿ULQJPD\LJQLWHFUHRVRWHDQGRUGDPDJHDSSOLance and chimney. Page 3 7075-166C May 23, 2013 R er i e e u e e e er . e i ie e er er. i re e e e i g uri g i i g. u i e ir i Fire ee e i r . i i i . Do not draw outside combustion air from: :DOOÀRRURUFHLOLQJFDYLW\ (QFORVHGVSDFHVXFKDVDQDWWLFRUJDUDJH &ORVHSUR[LPLW\WRH[KDXVWYHQWVRU chimneys umes or odor may result $VRXUFHRIDLUR[\JHQLVQHFHVVDU\LQRUGHUIRUFRPEXVWLRQWR WDNHSODFH:KDWHYHUFRPEXVWLRQDLULVFRQVXPHGE\WKH¿UH PXVWEHUHSODFHG$LULVUHSODFHGYLDDLUOHDNDJHDURXQGZLQdows and under doors. n homes that have tightly sealed doors DQGZLQGRZVDQRXWVLGHDLUVRXUFHLVQHHGHG$QRSWLRQDO2XWVLGH$LU.LWLVDYDLOable. e i i u ie i i LQFK ÀH[ DOXPLQXP SLSH RU LI XVLQJ DOWHUQDWH PDWHULDO then it shall be made from durable, non-combustible, heat resistant material up to 350o . Cut the pipe to the re uired length for your installation. 3KLOOLSVKHDGVFUHZGULYHU i . utside air inlet must be located to prevent blockage from: /HDYHVVQRZLFHRURWKHUGHEULV lock may cause combustion air starvation Smoke spillage may set off alarms or irritate sensitive individuals. 6LOLFRQHVHDODQW i e u i e ir i ru i 1. Swing grille down to e pose the two screws. Figure 3 . 2. Remove the two screws and pull the access assembly away from the appliance. $VVHPEOHWKHRXWVLGHDLUFRYHUSODWH$VXSSOLHGLQFRPponent pack. i i i . Length of outside air supply duct shall e ceed WKHOHQJWKRIWKHYHUWLFDOKHLJKWRIWKHH[KDXVWÀXH ire will not burn properly Smoke spillage occurs when door is opened due to air starvation. 4. Re-install the access assembly. 5. Remove the outside air cover plate card. Figure 3 .2. on outer can and dis- ,QVWDOO RSWLRQDO ÀH[ DGDSWHU WR RXWHU FDQ ZLWK WKH VDPH screws. Do not use plastic wire ties that come with the kit as WKH\ZLOOPHOW127(<RXPD\QHHGWRLQVWDOOWKHÀH[SLSH LQWRWKH¿UHER[¿UVWGHSHQGLQJRQLQVWDOODWLRQ$WWDFKÀH[WR adapater with at least 2 screws. (QVXUHH[LVWLQJDFFHVVKROHLQ¿UHSODFHLVVXI¿FLHQWWRIHHG WKHLQFKÀH[ $IWHUVOLGLQJFDQLQWR¿UHSODFHIHHGÀH[LQWRFXWRSHQLQJWR obtain outside combustion air. . Level outer can and install appliance. See i u i e ir 1. ollow steps 1-5 in ption i ge Grille hinges downward Remove Screws & Pull Access Assembly away from Insert Remove Outside Cover Plate A (Discard) Figure 3 . . ru i ne above Outside Air Cover Plate B (Discard) (QVXUHH[LVWLQJDFFHVKROHLQ¿UHSODFHZLOOQRWEHFRYHUHGE\ the outer can. isting outside air intake hole may be under at the rear or side of outer can. utside air may also enter down e isting chimney chase in some situations. 5HSHDWVWHSXQGHU2SWLRQ2QHZLWKRQHH[FHSWLRQ$IWHU LQVWDOOLQJ WKH DSSOLDQFH LQ WKH RXWHU FDQ VHDO WKH ¿UHSODFH opening and trim package with insulation to prevent air leakage into the room. May 23, 2013 7075-166C Termination Cap Flex Adapter Figure 3 .2 Page 3 R er . i F ue er i . 2SWLRQDOXVHRID6LPSVRQ'XUDYHQW8QLYHUVDO(OERZ Part umber 4615 may be purchased directly through your local Simpson Durvent Pipe Distributor or from your local 4XDGUD)LUHGHDOHU3DUW1XPEHU'9'/5($'66 Figure . shows a vertical installation and also how to FUHDWHDQRSWLRQDOHOERZLQVWDOODWLRQ e uri g e i e i er F ue 7KHUHDUHSUHGULOOHGKROHVLQWKHÀXHFROODUGHJUHHV DSDUW$WWDFKWKHÀXHFROODUWRWKHVWRYHSLSHOLQHU,IWKH seal is uestionable use stove mastic Figure .2. $WWDFKJDVNHWWRERWWRPVLGHRIÀXHFROODUZLWKDWKLQFRDW of silicone. 7KH HOERZ PD\ EH VHFXUHG GLUHFWO\ WR WKH ÀXH FROODU ollow the pipe manufacturer s instructions for using screws or rivets for attachment. Most pipe manufacturer s 6 inch PP GLDPHWHU ÀXH OLQHUV PD\ EH DWWDFKHG GLUHFWO\ WR WKHWRSRIWKHHOERZ A Gasket Flue Collar Vertical Figure B Stove Pipe/Liner .2 A 30 o . 30 degree B e e i g eg 1. Remove the 2 screws already installed on each leg. 2. Move legs to the desired height. 3. Re-install the screws to secure in place. Figure . F ue er ertical 30 Degree LQPP LQPP LQPP LQPP Remove 2 screws from both sides. Adjust the legs up or down to level appliance. Figure Page 40 r 7075-166C .3 May 23, 2013 R er . 1. e uri g i e e i e i er F. nce you have the appliance in place and secured, UHPRYH WKH WXEH FKDQQHO DVVHPEO\ EDIÀH ERDUG DQG ceramic blanket. Detailed instructions are found on ge 23 2 . 5HDFKXSWKURXJKWKHÀXHRSHQLQJDQGJUDEWKHDWWDFKPHQWEDUDQGSXOOGRZQLQVLGHÀXHRSHQLQJFigure . . ,QVHUWWKHEROWVLQVLGHWKHFDVWÀXHDQGWKURXJKWKH chimney mounting bar. Securely tighten the nuts. asteners are provided. 5HLQVWDOO WKH WXEH FKDQQHO DVVHPEO\ EDIÀH ERDUG FHUDPLFEODQNHWDQGEDIÀHSURWHFWLRQFKDQQHO r urr u ri i i Standard Si e: 43 in. W 31 in. Large Si e: 51 in. W 34 in. 1. Lay surround face down on a protected surface to prevent scratching. 2. sing a 4 to 6 inches long Phillips head screw driver DWWDFKWKHVLGHVXUURXQGVWRWKHWRSVXUURXQGXVLQJ sheet metal screws on each side provided with the kit. Figure .2. 3. Lay the trim face down and place the corner brackets into position. 8VLQJ D VWDQGDUG ÀDW VFUHZ GULYHU WLJKWHQ WKH FRUQHU brackets. Figure .3. 5. Slide the assembled trim set over the surround set. and then over the appliance matching the mounting tabs on the side pieces with the slots on the appliance. Figure .2. $OLJQ WKH VFUHZV LQ WKH WRS VXUURXQG SLHFH WR WKH alignment holes on the appliance top. Secure in place. Figure .2. 7. se the strain relief in the surround side for blower cord installation and use the cover plug to insert into the hole where the blower cord is not installed. Secure 2 Sides to op Secure to irebo ace Mounting abs Slide into Slots on irebo ace 5/16 Bolts Strain Relief for lower Cord and Cover Plug for hole in each side eat Deflector Attachment Bar Figure .2 5/16 Nuts Figure . Corner Brackets Figure May 23, 2013 7075-166C .3 Page 41 R er . r urr u ri i 7. Place the cast footers under the metal sides aligning the top and bottom holes in the cast footers and metal sides. Standard Si e: 42-1/2 in. W 30 in. Large Si e: 4 in. W 34 in. u e i urr u i VLGHSLHFHVOHIWDQGULJKW OWRSSLHFHIDVWHQHUSDFNDJH u e i ri i FDVWWULPOHJVOHIWDQGULJKW FDVWWULPKHDGHUFDVWWULPIRRWHUVOHIWDQGULJKW fastener package. ee e Powered 4 to 6 inches long Phillips head VFUHZGULYHUSOLHUV 1. Remove contents from bo being careful not to scratch or damage the cast trim pieces. 2. Lay surround face down on a protected surface to prevent scratching. 3. sing a 4 to 6 inches long Phillips head screw driver attach WKHVLGHVXUURXQGVWRWKHWRSVXUURXQGXVLQJVKHHW metal screws on each side provided with the kit . he mounting clips are shipped in one long strip. break apart or use pliers. and . ach clip has a clearance notch to allow room for the cast on the insert. Place the clip so the notch is facing the outer edges of the surrounds. Figure 2.3. 10. t is best to install all of the 1/4-20 screws only half way at ¿UVWWRDOORZIRUDGMXVWPHQWV$IWHUDGMXVWPHQWWLJKWHQWKH VFUHZVLQHDFKFDVWIRRWHU¿UVWDQGWKHQZRUN\RXUZD\ around to the rest. 11. Slide surround and trim over the top of the insert into place matching the mounting tabs on the metal sides with the slots on the insert. Figure 2. . 12$OLJQWKHVFUHZVLQWKHWRSPHWDOVXUURXQGSLHFHWRWKH 2 alignment holes on the appliance top. Secure in place. Figure 2. . 4. Place the peel and stick round felt vibration insulation pads on the front side in each corner of the top metal piece and on the back side in each corner of the top cast piece. Figure 2. . Clearance Notch 3ODFHWKHFRUUHVSRQGLQJFDVWWULPSLHFHVFDVWWULPVLGHV DQGFDVWWULPKHDGHUXQGHUQHDWKWKHSDQHOVHWDOVRIDFH GRZQ$OLJQWKHKROHVLQWKHPHWDOSLHFHVZLWKWKHERVVHV on the top cast piece and 2 bosses on each side piece. Back of Side Piece 6. Secure the magnet to the bracket and attach the magnet and bracket to each metal side piece at the bottom. he magnet is facing the front. Figure 2.2. (4) Felt Vibration Insulation Pads Secure Surrounds to Cast Trim Kit Figure 2.3 Magnet Attached - Faces Front Figure 2.2 Attach Magnet before installing Cast Footers Cast Footers, Left & Right Match Mounting Tabs to Slots on the appliance Magnet Installed Figure 2. Page 42 Figure 2. 7075-166C May 23, 2013 R er . urr u Si e: 40 in. W 30 in. i . u e i urr u i VLGHSLHFHVOHIWDQGULJKW OWRSSLHFHIDVWHQHUSDFNDJH ee e Powered 4 to 6 inches long Phillips head VFUHZGULYHUSOLHUV 1. Remove contents from bo being careful not to scratch or damage the cast trim pieces. er r i e i e he blower cord is shipped to be installed on the right side RIWKHDSSOLDQFH<RXPD\UHORFDWHWKHFRUGVRLWLVRQWKH left side. er ie <RX DUH UHPRYLQJ WKH SRZHU FRUG IURP WKH blower controls, re-routing the cord to the left side and reinstalling the power cord to the blower controls. Refer to the e ploded drawing on ge . 2. Lay surround pieces face down on a protected surface to prevent scratching. $OLJQWKHERVVHVRQWKHWRSSLHFHWRWKHKROHVRQWKHVLGH pieces. Secure the 3 pieces together. $WWDFKWKHPRXQWLQJEUDFNHWVWRWKHVLGHSLHFHVLQFOXGHGZLWK the kit. Figure 3. . 5. n order to get a tight seal for the surround, you must reposition a side shield. here are two holes on the shield and it will come IURPWKHIDFWRU\VHFXUHGLQWKH¿UVWOHIWKROH5HPRYHWKH VKLHOGDQGUHLQVWDOOXVLQJWKHVHFRQGULJKWKROH)LJXUH 5. Position the trim on the appliance matching up the mounting brackets with the slots on the appliance. $WWDFKWKHVXUURXQGWRWKHDSSOLDQFHVFUHZV F . Figure 3.3 1. Swing the grille down to e pose the 2 bolts, one at each end. Remove the bolts and pull blower access assembly away from appliance and store away from your work area. 4 Mounting Brackets Figure 3. Figure 3. 2. Remove the 2 screws in the hold down bracket in IURQWRIWKHEORZHUDVVHPEO\<RXGRQRWQHHGWR remove the blower from the hold down bracket. Mounting Brackets Attach to Appliance with Screws Do not overtighten - may damage porcelain finish Remove and Reposition Side Shield using Second Hole 3. Disconnect the 2 blower wires that are attached to the wire harness and pull the blower assembly away from the appliance. Figure 3.2 May 23, 2013 7075-166C Page 43 R er Green Grounding Wire Remove Screw Figure Figure . 6. Remove the screw that is holding the ground lug to the control plate. . 4. Remove the 2 screws at the top of the control plate. Push the bottom of the control plate to the inside of the appliance and partially remove the control plate assembly. White Wire Black Wire Figure 7. Figure . se needle nose pliers to remove the strain relief that protects the power cord from the control plate. .2 5. Locate the black and white wires that are part of the power cord and disconnect those wires from the wire harness. Placement Slot Blower Access Assembly Grille hinges downward Hold Down Bracket Snap Disc Bracket Blower Control Plate Remove Screws & Pull Access Assembly away from Insert Figure Page 44 .3 Remove Screws from Hold Down Bracket and Pull Blower Assembly Forward. Do not Remove Blower from the Hold Down Bracket 7075-166C May 23, 2013 R er White Wire Black Wire Fiber Wrapped Wire Figure . . Figure he power cord is now disconnected from the blower control plate. Pull the cord out through the right side of the appliance. Green Grounding Wire . 11. Connect the white wire on the power cord into the ¿EHUZUDSSHGZLUHRQWKHZLUHKDUQHVV&RQQHFWWKH black wire on the power cord to the white wire on the rheostat. Re-attach the green ground terminal to the control plate. Grommet Route Cord Through Retainer Clip Figure .2 . nsert the power cord throught the left side of the appliance in the hole contains the grommet. Pull the connection ends to the right side. Route the power cord through the retainer clip. Figure . 12. nsert the control plate assembly back into the appliance as shown. ilt the assembly forward and then lift up and rotate the bottom towards the front of the appliance at the same time ensure that the snap disc holder is properly seated. Secure plate to the appliance. Route Wires through Retainer Clip Strain Relief Replace Screws in Hold Down Bracket Figure .3 10. Replace the strain relief on the power cord in the same position as before. Locate the indentation on the cord made by the strain relief. nce replaced, push the strain relief back into the control plate. May 23, 2013 Figure . 13. Push in the blower and hold down bracket into appliance matching up the tab on the bracket and placement slot on the appliance. Secure bracket DQG UHFRQQHFW EORZHU ZLUHV QR SRODULW\ WR ZRUU\ DERXWURXWLQJZLUHVWKURXJKWKHUHWDLQHUFOLS 7075-166C Page 45 R er ie e i $QRXWVLGHDLULQOHWPXVWEHSURYLGHGIRUFRPEXVWLRQDQG must remain clear of leaves, debris, ice and/or snow. t must be unrestricted while unit is in use to prevent room air starvation which can cause smoke spillage and an LQDELOLW\WRPDLQWDLQD¿UH6PRNHVSLOODJHFDQDOVRVHW off smoke alarms. 2. nit must be secured to the mobile home structure. Remove bolts from each side of insert and use plumbers WDSHWRVHFXUHWRVWUXFWXUHDZDVKHUPD\EHUHTXLUHG Re-install bolts. 3. nit must be grounded with solid copper grounding wire or e uivalent and terminated at each end with . .C. approved grounding device. 7KH IDFWRU\EXLOW ILUHSODFH PXVW PHHW 80+8' re uirements for outside combustion air supply to the ¿UHSODFH¿UHFKDPEHUDQGWKHFKLPQH\PXVWEHOLVWHGWR 8/+7RUDOLVWHG8/IXOOOHQJWKVL[LQFKPP diameter liner must be used. t must be e uipped with a spark arrestor cap and the outside air must be installed on the insert. 5. Spark Arestor Cap Storm Collar Roof Flashing Joist Shield/Firestop Figure se silicone to create an effective vapor barrier at the location were the chimney or other component penetrates to the e terior of the structure. 7. ollow the chimney and chimney connector manufacturer s LQVWUXFWLRQVZKHQLQVWDOOLQJWKHÀXHV\VWHPIRUXVHLQD mobile home. . urn wood only. ther types of fuels may generate SRLVRQRXVJDVHVHJFDUERQPRQR[LGH . f unit burns poorly while an e haust blower is on in home, LHUDQJHKRRGLQFUHDVHFRPEXVWLRQDLU 10. nstallation shall be in accordance with the Manufacturers +RPH6DIHW\6WDQGDUG+8'&)53DUW 2IIVHWVIURPWKHYHUWLFDOQRWH[FHHGLQJDUHDOORZHG SHU 6HFWLRQ D RI WKH 8QLIRUP 0HFKDQLFDO &RGH 80& 2IIVHWVJUHDWHUWKDQDUHFRQVLGHUHGKRUL]RQWDODQGDUH also allowed, providing the hori ontal run does not e ceed 75 of the vertical height of the vent. Construction, clearance and termination must be in compliance with the MC able C. his installation must also FRPSO\ZLWK1)3$ . :$51,1* i i Refer to ge 3 of this manual for clearance to FRPEXVWLEOHV DQG ÀRRU SURWHFWLRQV UHTXLUHPHQWV $OO clearances must be followed precisely. 6. Double Wall Connector Pipe i . 1(9(5,167$//,1$6/((3,1*5220 Consumes o ygen in the room. :$51,1* Fire i . i i i . Do not draw outside combustion air from: :DOOÀRRURUFHLOLQJFDYLW\ (QFORVHGVSDFHVXFKDVDQDWWLFRUJDUDJH &ORVHSUR[LPLW\WRH[KDXVWYHQWVRUFKLPQH\V umes or odor may result &$87,21 7+(6758&785$/,17(*5,7<2)7+(02%,/(+20( )/225:$//$1'&(,/,1*522)0867%(0$,17$,1(' Do cut through: )ORRUMRLVWZDOOVWXGVRUFHLOLQJWUXVVHV $Q\VXSSRUWLQJPDWHULDOWKDWZRXOGDIIHFWWKHVWUXFWXUDOLQWHJrity. op sections of chimney must be removable to allow PD[LPXPFOHDUDQFHRIIHHWFPIURPJURXQGOHYHO for transportation purposes. Page 46 7075-166C May 23, 2013 R er . er i e e er i e May 23, 2013 i e e g er r e e 7075-166C ri i er i e Page 53 R er . er i e e Page 54 er i e i e e g er r e e 7075-166C ri i er i e May 23, 2013 R er . e er May 23, 2013 e 7075-166C Page 55 R CONTACT INFORMATION e r e e r ig i e gie i i i e e F r ur u r Fire e er i ue i r e u er ur e re u r Fire e er g www.Tuadra¿re.com mportant operating and maintenance instructions included. e re i Read, understand and follow these instructions for safe installation and operation. e r u re i r Leave this manual with party responsible for use and operation. r e er . $ $) /. 3# / !2 4 $ i g er i e ur er Date purchased/installed: Serial umber: Location on appliance: Dealership purchased from: Dealer phone: otes: his product may be covered by one or more of the following patents: 7047962 or other U.S. and foreign patents pending. Page 56 7075-166C nited States 5341794, 5263471, 6688302, 7216645, May 23, 2013