Download Konelab Service Manual
Transcript
.RQHODE6HUYLFH 0DQXDO ZZZWKHUPRFRPNRQHODE Manual version: I Program version 6.0 Code: 48953054-4081 Version I Preface Preface-1 Preface This manual gives technical information about Konelab 20, Konelab 30 and Konelab 60 analyzers and explains how to maintain and adjust them. Audience This manual is intended for personnel who service Konelab analyzers. Scope This Manual is divided into the following sections. Warnings and Recommendations Section 1 General Section 2 Adjustments Section 3 Cable Charts Section 4 Different Parts of Konelab Section 5 Maintenance Section 6 Error Messages Section 7 Boards Section 8 Spare Parts & Consumables Section 9 Installation Instructions Section 10 Workstation Software The CE mark attached on Konelab indicates the conformity with the EMC (electromagnetic compatibility) directive 89/336/EC. Information in this manual is subject to change without prior notice. November 2, 2003 Thermo Clinical Labsystems Tel: +358 9 802 766 Ratastie 2 Fax: +358 9 8027 6300 FIN-01620 VANTAA www.thermo.com/konelab 48953054-4081 Konelab Service Manual Preface-2 Konelab Service Manual Preface 48953054-4081 Version I November 2, 2003 Version I Warnings and Recommendations Warnings-1 Warnings and Recommendations Warnings in the Instrument 2 3 1 1 4 6 7 5 1 WARNING: Follow the instructions to ensure correct and safe operation.Do not open the cover when analysing is going on, because moving dispensers and mixer cause biohazard if hitting you by accident. 2 BIOHAZARD: All dispensers, mixers and washing stations are potential sources of infectious agents. Do not put your hand inside the analyzer when dispensers and mixers are moving. When cleaning them, be cautious and always use gloves. 3 BIOHAZARD: The Kusti dispenser is a potential source of infectious agents. Do not put your hand to the area where Kusti dispenser is moving. November 2, 2003 48953054-4081 Konelab Service Manual Warnings-2 Warnings and Recommendations Version I 4 BIOHAZARD: The cuvette waste box is a potential source of infectious agents. Be cautious and always use gloves and protective clothes when handling it. 5 BIOHAZARD: The waste water canister is a potential source of infectious agents. Be cautious and always use gloves and protective clothes when handling it. 6 WARNING: The low current switch, found in Konelab and KUSTI models, does not turn power totally off. The low current switch has two settings: • The analyzer has power on, when the lo current switch is ON (I), and at the same time the main power switch, in the back of the analyzer, is on. • When the low current switch is in the stand by setting (O), only the boards of analyser and the internal PC are power off. To turn the power totally off, turn the main power switch, in the back of the analyser, off. If you cannot reach the main power switch, unplug the mains cable. • If you take the mains cable off when the low current switch is on, the back-up batteries of the instrument are turned on. You can boot the internal PC by turning the low current switch in the stand by setting and waiting at least one minute before turning it on. 7 WARNING: The lamp house can be hot. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Warnings and Recommendations Warnings-3 PINCH HAZARD! Be careful with heavy parts of Konelab instrument when servicing and adjusting it. Recommendations for the Instrument It is highly recommended that the workstation PC is equipped with UPS (= uninterruptible power system) to avoid problems after power failure between PC's XP operating system and database management software. November 2, 2003 48953054-4081 Konelab Service Manual Warnings-4 Konelab Service Manual Warnings and Recommendations 48953054-4081 Version I November 2, 2003 Version I General 1-1 Section 1 General 1.1 Main Parts of the Analyzer ................................................................................... page 1-2 1.2 Samples ............................................................................................................... page 1-3 1.2.1 Konelab 20 ............................................................................................. page 1-4 1.2.2 Konelab 30 and 60 ................................................................................. page 1-4 1.3 Reagents ............................................................................................................. page 1-5 1.4 Cuvettes .............................................................................................................. page 1-5 1.5 Graphical User Interface....................................................................................... page 1-6 1.5.1 General Features ................................................................................... page 1-6 1.5.2 Special Keys on the Keyboard ............................................................... page 1-8 1.5.3 The Covers and the Leds in the analyzer ............................................... page 1-8 1.5.3.1 Konelab 60 and Konelab 30 ............................................ page 1-8 1.5.3.2 Konelab 20 ...................................................................... page 1-10 1.5.4 Main Window .......................................................................................... page 1-13 1.5.5 Brief Description of Windows .................................................................. page 1-15 1.6 Operation Principle .............................................................................................. page 1-17 1.6.1 Photometric Measurement ..................................................................... page 1-17 1.6.2 ISE Measurement ................................................................................... page 1-21 November 2, 2003 48953054-4081 Konelab Service Manual 1-2 General Version I Konelab, the selective chemistry analyzer for in vitro diagnostic purposes is an integrated system solution for convenient and automatic testing of routine clinical chemistry tests, electrolytes and special chemistries, such as specific proteins, TDM, DoA and toxicology tests. The Konelab family consists of six models: • • • • • • Konelab 60 which throughput is up to 600 photometric tests per hour. Konelab 60i has the ISE unit, which raises the throughput up to 780 tests/hour. Konelab 30 which throughput is up to 300 photometric tests per hour. Konelab 30i has the ISE unit, which raises the throughput up to 480 tests/hour. Konelab 20 which throughput is up to 200 photometric tests per hour. Konelab 20i has the ISE unit, which raises the throughput up to 380 tests/hour. The ISE unit combines the direct measurement of Na+, K+ and Cl- electrolytes with a sample volume as low as 50 µl. Li+, Ca2+ and pH are offered as option for Konelab 60 and 30, Li+ for Konelab 20. Konelab 60 and 30 can be connected to the laboratory automation for direct sample dispensing from the conveyor to the analyzer. The instrument workstation has fully graphical user-interface software. The software provides reliable control over the analyzing process and gives easy access to advanced functions. 1.1 Main Parts of the Analyzer * % & $ ' ( ) Figure 1-1 Konelab, the selective chemistry analyzer for in vitro diagnostic purposes A. Segment loader E. Cuvette waste compartment B. Sample disk F. Wastewater and distilled water containers C. Cuvette loader G. Optional interface for the automated sample transport line, so called KUSTI module D. Reagent disk Konelab Service Manual 48953054-4081 November 2, 2003 Version I General % 1-3 A. Segment/ STAT sample loader B. Reagent disk C. Cuvette loader D. Cuvette waste compartment & E. Wastewater and distilled water containers $ ' ( Figure 1-2 Konelab 20, the selective chemistry analyzer for in vitro diagnostic purposes 1.2 Samples Samples are inserted in a 14 positions sample segment. Continuous processing is made possible by the use of independent bar-coded sample segments, which the user can insert or remove during analysis to enable loading and unloading of samples. After loading the segment, samples are immediately identified by direct barcode reading and cup type recognition. Six segments can be in the sample disk at the same time. For the STAT samples there are dedicated positions between the segments, 5 positions in Konelab 20 and 6 positions in Konelab 30 and 60. Standard segment holds 5 and 7 ml primary tubes as well as 0.5 and 2 ml sample cups. A special segment for 10 ml tubes is available. The data can be given and results reported according to a patient or according to a sample. In addition the data can be entered during analysis. Figure 1-3 A sample segment November 2, 2003 48953054-4081 Figure 1-4 A KUSTI segment available to Konelab 30 and 60 Konelab Service Manual 1-4 General Version I 1.2.1 Konelab 20 Calibrators and controls are introduced as normal samples into a segment or into STAT positions. One STAT sample position is reserved for the ISE prime sample. 67$7VDPSOHV 3DWLHQWFDOLEUDWRUDQGFRQWURO VDPSOHV Figure 1-5 The sample disk of Konelab 20 1.2.2 Konelab 30 and 60 Calibrator, control and ISE prime samples have 40 fixed cooled positions in the middle of the sample disk. The positions are marked from S0 to S19, from C1 to C19 and ISE PRIME. Calibrators and controls can also be without fixed positions. In that case they are introduced as normal samples into a segment or into STAT positions. In case automated sample transport is used, the analyzer is equipped with the optional KUSTI module and samples are dispensed to a disposable 92 positions segment. Further analysis of the sample from the KUSTI segment is continued in a normal manner according to the analysis requested. Simultaneous manual sample operation, e.g. for STAT and special samples, is possible. &DOLEUDWRUDQGFRQWUROVDPSOHV 67$7VDPSOHV 3DWLHQWVDPSOHV Figure 1-6 The sample disk of Konelab 30 and 60 Konelab Service Manual 48953054-4081 November 2, 2003 Version I 1.3 General 1-5 Reagents The analyzer has a cooled reagent disk for 60 ml vessels, 20 ml and 10 ml bottles. The reagent disk of Konelab 30 and 60 includes integrated barcode reader, in Konelab 20 the barcode reader for reagents is external. The data for the reagents without a barcode has to be entered in the REAGENT DEFINITION window. Dilution as well as buffer solutions are placed in the reagent disk. Figure 1-7 Reagent vials and the 35-position reagent disk in the Konelab 20. Figure 1-8 Reagent vials and the 45-position reagent disk in the Konelab 30 and 60. 1.4 Cuvettes Samples and reagents are dispensed into a cell of multicell cuvette. One multicell cuvette has 12 cells. Figure 1-9 A multicell cuvette WARNING! The quality of results is guaranteed only with new cuvettes. Do not reuse the cuvettes. November 2, 2003 48953054-4081 Konelab Service Manual 1-6 1.5 General Version I Graphical User Interface 1.5.1 General Features Note: This window is only for instructions, you cannot find it in the software. <RXFDQRSHQWKHOLVWRIWKHZLQGRZLWHPV HJWHVWVVDPSOHVUHDJHQWVVDPHDV) 7KHVHEXWWRQVDUHLQHYHU\ZLQGRZ $OODFWLYHIXQFWLRQVKDYHDEODFNWH[W7KHIXQFWLRQLVDFWLYDWHGE\FOLFNLQJZLWKWKH PRXVHOHIWEXWWRQRYHUWKHEXWWRQLQWKHZLQGRZRUE\SUHVVLQJWKHIXQFWLRQNH\ ))RQWKHNH\ERDUG )XQFWLRQVZKLFKFDQQRWEHXVHGDUHVKRZQJUH\ 1 2 3 4 5 Coloured labels: • Yellow: Warning, e.g., the volume of reagent is below the alarm limit. • Green: User actions are needed, e.g., results are waiting for acceptance. • Red: Alarm, e.g., the cuvette loader is empty. • Blue: Information, e.g., the analyzer's status. Fields to display data: This data cannot be edited. Fields to edit data: Type the value to the field or select the value from the list. Group of buttons: Select several items. Buttons to press: Click the button to open the window for further actions. The coloured line gives an additional information, e.g.,segment button with a green line means that the segment has been analyzed. Clicking the button opens the sample segment window. Konelab Service Manual 48953054-4081 November 2, 2003 Version I General 1-7 Moving in the window from the field to another: To move from the field to another : - click the left mouse button: - or press enter - or tabulator To move backwards press: - shift and tabulator at the same time Selection from the list and from the table: Clicking the left mouse button or moving the cursor with the arrow keys on the keyboard and pressing Space bar selects an item from the list and from the table. When you select the same list/ table item again, the item becomes unselected. Symbol in the window Symbol on the keyboard Meaning / Function: Function, e.g. Saving, is not allowed. Activating the analyzer. Selection list. Changing the window. ! STAT sample Undefined value, e.g. a limit in test parameters marked with * is not checked. * November 2, 2003 F9 Sample/ patient data and test requests. F10 Tests results 48953054-4081 Konelab Service Manual 1-8 General Symbol in the window Version I Symbol on the keyboard Meaning / Function: F11 The status of all reagents in the reagent disk. F12 The analyzer's status. 1.5.2 Special Keys on the Keyboard Start Press START to begin analysis. Note that you must be on the Main window to get it working. Stop Press STOP to stop all analyzing. To restart analyzing, press START. 1.5.3 The Covers and the Leds in the analyzer 1.5.3.1 Konelab 60 and Konelab 30 A. The segment insert cover: • When the green LED (LA) is on, the user is allowed to open the cover. • When the red LED is on, the user must NOT open the cover because all six segment positions are reserved or the analyzer is transporting the segment between the segment loader and the sample disk. B. The STAT insert cover: • The LED (LB) red light starts to blink when the user opens the STAT insert cover. The analyzer turns a free position to the STAT insert position. AFTER the LED stops blinking and remains green, the user can insert the STAT sample. Konelab Service Manual 48953054-4081 November 2, 2003 Version I General &DO&WUO VDPSOHGLVN FRYHU 1-9 /$ % $ /% C. The cuvette loader: • When the green LED (LC) is on, the user is allowed to open the cuvette loader cover. • When the red LED is on, the user must NOT open the cover because the analyzer is transporting the cuvettes between the cuvette loader and the cuvette storage or the cuvette storage is full. & /& D. The reagent insert cover: The LED (LD) red light starts to blink when the user opens the reagent insert cover. The analyzer turns a free position to the reagent insert position. AFTER the LED stops blinking and remains green, the user can insert the reagent. ' 5HDJHQWGLVN FRYHU /' November 2, 2003 48953054-4081 Konelab Service Manual 1-10 General Version I 1.5.3.2 Konelab 20 E. The segment/ Stat insert cover: Inserting the segment The procedure to insert segment into Konelab 20 must be started from the workstation, select F2 either in the Sample/Patient entry window or in the Segment window. The LED (LE) starts to blink red light. The analyzer turns a free position to segment/ STAT insert position. After the LED stops blinking and remains green the user can open the cover and insert the segment. When the cover is closed the LED goes out. ( /( Konelab Service Manual 48953054-4081 November 2, 2003 Version I General 1-11 Inserting the STAT sample Select F5, Insert stat sample in the Sample/Patient entry window. The LED (LE) starts to blink red light. The analyzer turns a free position to segment/ STAT insert position. After the LED stops blinking and remains green the user can open the cover and insert the STAT sample. When the cover is closed the LED goes out. F. The cuvette loader: • When the green LED (LF) is on the user is allowed to open the cuvette loader cover. • When the red LED is on the user must NOT open the cover because the analyzer is transporting the cuvettes between the cuvette loader and the cuvette storage or the cuvette storage is full. ) /) November 2, 2003 48953054-4081 Konelab Service Manual 1-12 General Version I G. The reagent insert cover: The procedure to insert reagent into Konelab 20 must be started from workstation. Select F2 in the Reagent disk window. If user levels have been set on (refer to section 3.7 in Ref. manual) the password is required to login the instrument Old calibrations and reagent vials are seen in Start up. The user must insert new vials and request new calibrations or accept the old ones before continuing.To look at Maintenance actions is reminded if the workstation has not been booted during a week. Booting makes the system work faster. The LED (LG) starts to blink red light. The analyzer turns a free position to reagent insert position. After the LED stops blinking and remains green the user can open the cover and insert the reagent vial. When the cover is closed the LED goes out. * /* Konelab Service Manual 48953054-4081 November 2, 2003 Version I General 1-13 1.5.4 Main Window ( % ) / 0 ' & * $ + 1 - , . A B C D E November 2, 2003 ) 4& UHVXOWV ) ,QVWU DFWLRQV ) 0DQDJH PHQW ) 3URILOH GHILQLWLRQ ) 7HVW GHILQLWLRQ ) 5HDJHQW GHILQLWLRQ ) &DO&WUO GHILQLWLRQ ) &RQILJ ) 5HVXOW DUFKLYH ) 3HQGLQJ UHTXHVWV ) %DWFK HQWU\ ) ([WHUQDO UHVXOWV ) 6HQGHU GHILQLWLRQ ) 5HIFODVV GHILQLWLRQ ) PRUH ) PRUH STATUS: • The analyzer's status (e.g. start up needed, analyzing etc.) is seen and if cuvettes are missing (for example), a red label Cuvettes appears. For further information refer to section 1.3.1 in Ref. manual. STATISTICS: • The number of all unanalyzed requests, the number of unanalyzed requests in the sample disk, and the number of analyzed requests are seen. TESTS TO ACCEPT: • Calibrations and tests, which have unaccepted results, are seen. Refer to sections 3.4.2 and 3.3.1 in Ref. manual. SAMPLES/ PATIENTS TO ACCEPT: • Samples/ Patients, who have analyzed, unaccepted results are seen. Samples/ Patients with STAT requests are listed first. Refer to section 3.3.2 in Ref. manual. OPEN COVERS: • The name of the open cover is listed. When the cover is closed, the name disappears. The covers are reagent insert cover, segment insert cover, STAT insert cover, cuvette loader, reagent disk cover, and sample disk cover. 48953054-4081 Konelab Service Manual 1-14 General F G H I J K L M N Version I SHORT SAMPLES: • List of short and old samples is seen. Refer to section 3.2.2 in Ref. manual. REAGENTS BELOW ALARM: • List of reagents with volume below the defined alarm limit is seen. Refer to section 3.1.2 in Ref. manual. SHORT REAGENTS: • List of short reagents is seen. Refer to section 3.1.2 in Ref. Manual. SHORT CALIBRATORS AND CONTROLS: • List of short and old calibrators and controls is seen. Refer to section 3.4.1 in Ref. manual. INVALID TESTS: • Invalid tests are listed; e.g., calibration, reagent or antigen excess sample is missing or the analyzer is unable to do the test because the checking of test's parameters is needed. MESSAGES: • All messages are seen in the MESSAGES window with an explanation, an identification number, and time. Refer to section 8.2. SAMPLE DISK: • The status of all segments and patient samples is seen. Refer to section 3.2.8 in Ref. manual. SEGMENTS: • Segments on board are seen. Segment identification is in a button. Refer to section 3.2.7 in Ref. manual. The segment's status is seen beside the button: • In process: The segment is under analyzing. • Ready (the green line in the button): The segment has been analyzed. • Not started (a yellow line in the button): The segment is in the sample disk but the barcode is not read yet. • In loader: The segment is in the loader and can be taken away. • Check data (a red line in the button): There is unrecognised sample in the segment. Refer to section 3.2.7.1.1 in Ref. manual. • Discarded segment (a red line in the button): The analyzer has been unable to read segment's barcode. Click the button or press F9 and further F8/F5 keys on the keyboard; with F3, remove the segment and check the barcode. STAT SAMPLES: • Samples on the STAT positions are seen. Sample identification is in a button. The green line in the sample button means that the sample is ready to accept or report. The red line means short sample. Refer to section 3.2.4 in Ref. manual. To open the needed window for further actions: Click the name on the list (C, D, F, G, H, I and K). Click the button (L, M and N). - or Select the name from the list (C, D, F, G, H, I and K) and press the appropriate key on the keyboard, e.g. F10 to open the TEST RESULTS window. Press the appropriate keys on the keyboard (L, M and N), e.g. F9 and further F8/F6 keys to open the SAMPLE SEGMENT window. Konelab Service Manual 48953054-4081 November 2, 2003 Version I General 1-15 1.5.5 Brief Description of Windows Batch entry Functions to give test requests for a batch of samples. Refer to section 3.2.2.3 in Ref. manual. Configuration In the Configuration window, the user can see e.g., the installed wavelengths. In addition the user can e.g., define the criterion for data entering: sample or patient, change the default sample type used in Sample/ Patient entry, define the printing type: manual or automatic and connect the ISE unit on and off. Refer to section 3.8 in Ref. manual. LIMS configuration The used laboratory information management protocol is defined. Refer to section 3.8.1 in Ref. manual. Management Functions to stop the instrument immediately and to clear the daily files and simultaneously to save accepted QC results to the cumulative data. Refer to section 3.6 in Ref. manual. User management Functions to set user levels on and change passwords. Refer to section 3.7 in Ref. manual. Restrictions Functions to determine different user levels. Refer to section 4.10 in Ref. manual. Messages Detailed information from the messages is seen. Refer to section 8.2. Profile definition Functions to define the profiles. Refer to section 4.7 in Ref. manual. Reagent definition Functions to give the reagent data. Refer to section 3.1.3 in Ref. manual. Reagent disk The status of all reagents in the reagent disk is seen in this window. The user has access to the REAGENT DISK window from every window. Refer to section 3.1.1 in Ref. manual Reference class definition Functions to define reference classes. Refer to section 4.8 in Ref. manual. Reports Functions to report the results manually. Refer to section 3.5 in Ref. manual. LIMS connection Functions to manually ask requests or send results online. Refer to section 3.5.1 in Ref. manual. Sample disk The status of all segments and patient samples on board is seen in this window. Refer to section 3.2.8 in Ref. manual. Sample/ Patient entry Functions to give sample/patient data and test requests. The criterion for the data entering (sample or patient) is defined in the Configuration window. The user has access to the SAMPLE/ PATIENT ENTRY window from every window. Refer to section 3.2.2 in Ref. manual. Sample list A brief preview of all samples is seen in this window. Refer to section 3.2.9 in Ref. manual. Sample/ Patient results Functions to see the results of samples/ patients. The unaccepted results can be accepted, rejected, or rerun. Refer to section 3.3.2 in Ref. manual. Sample segment The status of sample segment with all 14 positions is seen. Refer to section 3.2.7 in Ref.manual. Pending requests Pending requests and the time estimation for analyzing them are seen in this window. Refer to section 3.2.10 in Ref. manual. Sender definition Functions to define the sender data, which is seen in Sample/ Patient entry and in reports. Refer to section 4.9 in Ref. manual. Calibrator & Control definition Functions to define calibrators and controls and to give the test values. Refer to section 4.6 in Ref. manual. Calibration parameters Functions to define the test calibration parameters. Refer to section 4.4 in Ref. manual. Calibration results The status of the test calibration is seen. Calibration can be accepted and compared to the previous one. Every calibration request can be rejected and rerun. Refer to section 3.4.2 in Ref. manual. Calibration/ QC selection The list of tests in the order of the calibration status and the status of calibrators is seen. The user can calibrate the test and ask the Manual QC for the test. The status of controls is seen. Refer to section 3.4.1 in Ref. manual. November 2, 2003 48953054-4081 Konelab Service Manual 1-16 General Version I Quality control results Cumulative data and quality control results are seen on the lists or graphically. Refer to section 3.4.3 in Ref. manual. Results by controls Daily quality control results by controls are seen. Refer to section 3.4.4 in Ref. manual. Quality control parameters Functions to define tests' quality control parameters for manual qc and routine qc. Refer to section 4.5 in Ref. manual. Test definition Functions to define tests. Tests' general parameters are given in this window. Refer to section 4.1 in Ref. manual. Test flow Functions to define the test flow i.e. the parameters for reagent and sample dispensings, for dilution, incubation and measurement. Additional mixing can also be defined. Refer to section 4.2 in Ref. manual. Electrodes Function to define which electrodes is used. Refer to section 4.3 in Ref. manual. Test results Functions to see the results of the tests. Unaccepted results can be accepted, rejected or rerun. The user has access to the TEST RESULTS window from every window. Refer to section 3.3.1 in Ref. manual. External results Functions to enter results for tests analyzed by other instruments to provide fully collated patient reports. Refer to section 3.2.6.1in Ref. manual. Result archive Result archive includes sample and control results. Refer to section 3.9 in Ref. manual. Calibration archive Calibration archive includes old, accepted calibrations. Refer to section 3.9.1 in Ref. manual. Reagent lot archive Reagent lot archive includes information of used reagent lots. Refer to section 3.9.2 in Ref. manual. Statistics Both daily and cumulative number of accepted and rejected requests of samples, calibrators and controls are seen test by test. Refer to section 3.10 in Ref. manual. Report formats Functions to format the patient, sample, or test report. Refer to section 3.11 in Ref. manual. Instrument actions Functions for the user service actions, e.g. to order water blank and ISE prime and to remove cuvettes. Adjustment and test programs for Service Engineers. Refer to section 3.12 in Ref. manual. Water blank Functions to check water blank measurements wavelength by wavelength. Refer to section 3.13 in Ref. manual. Maintenance Maintenance checking table. The user is reminded to perform tasks after the given time period. Refer to section 6.1 in Ref. manual. Accuracy results After the preventive maintenance done once per year, it is recommended to perform accuracy measurements to check the condition of instrument. Results of these measurements are seen in this window. Refer to section 6.4 in Ref. manual. Accuracy factors Accuracy measurements are done with the accuracy solution kit. Authority measures values of these solutions. Lot dependant factors, affecting accuracy result calculations, are given in this window. Refer to section 6.4.1 in Ref. manual. Konelab Service Manual 48953054-4081 November 2, 2003 Version I 1.6 General 1-17 Operation Principle 1.6.1 Photometric Measurement Figure 1-10 Photometric analysis proceeding in Konelab 60. Multicell cuvettes are transported in the Konelab by precisely controlled cuvette arms. The arm takes a cuvette from the loader and places it into a free slot in the incubator. When the incubator rotates in Konelab 60 the cuvette is first moved to the photometer to check its optical quality and after that to the dispensing positions where the dispensing arms dispense sample and reagents appropriate to the test. The mixer in both dispensing positions performs efficient mixing. November 2, 2003 48953054-4081 Konelab Service Manual 1-18 General Version I 3+2720(7(5 237,21 ,6(02'8/( ,6(',63(16(5 $ % !"!& !" # ,1&8%$725 !" 6$03/( 75$163257 /,1( .21(/$% 6$03/( 75$163257 ,17(5)$&( %8))(5 ',63(16(5 6$03/($1' 5($*(17 ',63(16(5 6$03/(',6. %XI I HU VHJPHQW !" &89(77(/2$'(5 &89(77(6 5($*(17', 6. &89(77(6725$*( &89(77(6 &89(77( 81, 7 %$5&2'( 5($'(5 %$5 &2'( 5($'(5 0DQXDO VDPSOHORDGLQJ Figure 1-11 Photometric analysis proceeding in Konelab 30. In Konelab 30 the cuvette is also first moved to the photometer to check its optical quality. After that the cuvette is placed in the incubator where the dispensing arm dispenses sample and reagents appropriate to the test. The mixer performs efficient mixing. The cuvette is then moved through the photometer. The photometer measures the absorbance of one cell of the multicell cuvette at a time. It is possible to make a fixed measurement, i.e. so that the time between dispensing and measurement is the same with every cell of a test's cuvette. In the kinetic measurement the absorbance measurement is repeated as many times as defined in the test parameters during the given time period. The maximum number of the measurements is 12 and the maximum time is 20 minutes. After measurement the cuvette is discarded into the waste compartment. Konelab Service Manual 48953054-4081 November 2, 2003 Version I General 1-19 Figure 1-12 Photometric analysis proceeding in Konelab 20. In Konelab 20 the cuvette is first moved to the photometer to check its optical quality. After that the cuvette is placed in the incubator where the dispensing arm dispenses sample and reagents appropriate to the test. The efficient vibration of the dispensing needle in the cuvette cell performs mixing. The cuvette is then moved through the photometer. The photometer measures the absorbance of one cell of the multicell cuvette at a time. It is possible to make a fixed measurement, i.e. so that the time between dispensing and measurement is the same with every cell of a test's cuvette. In the kinetic measurement the absorbance measurement is repeated as many times as defined in the test parameters during the given time period. The maximum number of the measurements is 12 and the maximum time is 20 minutes. After measurement the cuvette is discarded into the waste compartment. DISPENSING Konelab 60 has separate dispensers for samples, reagents and ISE tests. Konelab 30 and 20 has common dispenser for samples and reagents but separate for ISE tests. The dispensers are equipped with a level detector, which ensures that there is enough sample/reagent for the analyzes requested. The level detector also controls the depth of immersion of the needle in the sample cup. A sample is dispensed either into a new cuvette or into the partly used cuvette. One cuvette consists of twelve reaction cells. The sample/ reagent can be dispensed to the cuvette with water or with a sample/ reagent extra. The water volume is dispensed to the cell with the sample/ reagent. The extra volume is discarded after the real volume is dispensed. November 2, 2003 48953054-4081 Konelab Service Manual 1-20 General Version I 3+2720(7(5 Figure 1-13 The operation principle of the photometer. 1. Halogen lamp 5. Quartz fibre 2. Condensing lenses 6. Beam divider 3. Filter wheel 7. Reference detector 4. Light chopper 8. Multicell cuvette 9. Signal detector 10.Measurement electronics The light goes from the lamp through the condensing lenses to the interference filter. The plane surface of the first condensing lens is coated with the material, which reflects heat and infrared light. The filters are mounted on a filter wheel. In the standard instrument there are 15 positions for filters. After the filter the light is converted into a stream of light pulses by the chopper. Then the light is led via the quartz fibre through the focusing lens and the slit to the beam divider. The beam divider divides the light into two parts. A certain amount is reflected to the reference detector, which monitors the light level fluctuations. The main part of the light goes through the liquid in the cell to the signal detector, which measures the amount of light after absorption. FILTER WHEEL QPRSWLRQ QP QP QP %ODFN QP (PSW\ QPRSWLRQ QP QP QP QP QP Konelab Service Manual QP QP 48953054-4081 November 2, 2003 Version I General 1-21 1.6.2 ISE Measurement The Konelab measures: • • • • Na, K and Cl in serum and plasma, Na and K in urine, Li, which is offered as an option, in serum and plasma. Ca and pH in Konelab 60 and 30, which are offered as an option, in serum and plasma. The measurement is done with the direct ISE technique. The measured sample activity is compared to the activity of calibrators, which are adjusted to mimic activity normally found in serum samples. The electrode block is comprised of the measurement electrodes and the reference electrode. The potentials produced at each membrane are measured once every second. One dispensing arm, one pump and one 500 *l syringe are provided for the ISE measurement in Konelab 60 and 30. In Konelab 20 one dispensing arm and FMI pump perform the ISE measurement. A sample is aspirated through the needle from the sample cup. The sample is moved to the electrode block where the measurement takes place. Sample measurement is followed by ISE Calibrator solution 1 measurement. The ISE dispensing pump transfers ISE Calibrator solution 1 from the bag to the block. At the same time the sample is discarded. After the measurement ISE Calibrator solution 1 is pumped through the needle to the waste. The tubes and the measurement channel of the ion selective electrode block are washed with the Washing Solution. The solution is dispensed via the dispensing arm into the block. From there it is pushed by the ISE washing pump into the wastewater container. The washing procedure is done during the STAND BY function. MEASUREMENT PRINCIPLE Each ion-selective electrode has an electrode -specific membrane. The membrane will attract the desired ion to the membrane phase when the sample solution comes into contact with it. The potential of each ion-selective electrode is measured against the reference electrode. The potential difference is developed at the electrode membrane. This potential (in mV) is read and amplified sequentially. It should reach the 'steady state' stage within a given time interval. If the measurement does not stabilise in an allowed time the measurement is repeated once. In case of repeated instability an error message is given. November 2, 2003 48953054-4081 Konelab Service Manual 1-22 Konelab Service Manual General 48953054-4081 Version I November 2, 2003 Version I Adjustments 2-1 Section 2 Adjustments 2.1 Adjustments of Konelab 60 ....................................................................... page 2-3 2.1.1 General ...................................................................................... page 2-3 2.1.2 How to Start Adjusting ? ............................................................ page 2-4 2.1.3 Cuvette Unit ............................................................................... page 2-6 2.1.4 Incubator .................................................................................... page 2-11 2.1.5 Reagent Unit .............................................................................. page 2-13 2.1.5.1 Cuvette Arm .................................................................... page 2-13 2.1.5.2 Reagent Disk ................................................................... page 2-14 2.1.5.3 Reagent Dispenser ......................................................... page 2-15 2.1.5.4 Reagent Mixer ................................................................. page 2-20 2.1.6 Sample Unit ............................................................................... page 2-23 2.1.6.1 Cuvette Arm .................................................................... page 2-23 2.1.6.2 Sample Disk .................................................................... page 2-24 2.1.6.3 Sample Dispenser page 2-28 2.1.6.4 Sample Mixer .................................................................. page 2-36 2.1.7 Measuring Unit .......................................................................... page 2-39 2.1.7.1 Cuvette Arm .................................................................... page 2-39 2.1.7.2 Filter Disk / Beam Alignment ........................................... page 2-41 2.1.7.3 Measuring Positions ........................................................ page 2-42 2.1.7.4 Lamp Voltages and Gains ............................................... page 2-42 2.1.8 ISE Unit ..................................................................................... page 2-43 2.1.9 KUSTI Unit ................................................................................. page 2-49 2.1.10 Syringe Zero Position .............................................................. page 2-53 2.1.11 Saving and Restoring Adjustment Values ............................... page 2-53 2.1.11.1 Saving Adj. Values to Floppy Disk ............ page 2-53 2.1.11.2 Restoring Adj. Values from Floppy Disk .... page 2-53 2.2 Adjustments of Konelab 30 ...................................................................... page 2-55 2.2.1 General ...................................................................................... page 2-55 2.2.2 How to Start Adjusting ? ............................................................ page 2-56 2.2.3 Incubator .................................................................................... page 2-58 2.2.4 Cuvette Unit ............................................................................... page 2-59 2.2.5 Reagent Disk ............................................................................. page 2-60 2.2.6 Sample Disk .............................................................................. page 2-61 2.2.7 Measuring Unit .......................................................................... page 2-65 2.2.7.1 Cuvette Arm .................................................................... page 2-65 2.2.7.2 Filter Disk / Beam Alignment ........................................... page 2-66 2.2.7.3 Measuring Positions ........................................................ page 2-67 2.2.7.4 Lamp Voltages and Gains ................................................ page 2-67 2.2.8 Dispensing Unit ......................................................................... page 2-68 2.2.8.1 Dispenser ......................................................................... page 2-68 2.2.8.2 Mixer ............................................................................... page 2-78 2.2.9 ISE Unit ..................................................................................... page 2-81 2.2.10 KUSTI Unit ............................................................................... page 2-87 2.2.11 Syringe Zero Position .............................................................. page 2-91 2.2.12 Saving and Restoring Adjustment Values ............................... page 2-91 2.2.12.1 Saving Adj. Values to Floppy Disk ............ page 2-91 2.2.12.2 Restoring Adj. Values from Floppy Disk .... page 2-91 November 2, 2003 48953054-4081 Konelab Service Manual 2-2 Adjustments Version I 2.3 Adjustments of Konelab 20 .................................................................................. page 2-93 2.3.1 General .................................................................................................. page 2-93 2.3.2 How to Start Adjusting ? ........................................................................ page 2-94 2.3.3 Incubator ................................................................................................ page 2-96 2.3.4 Cuvette Unit ........................................................................................... page 2-97 2.3.5 Measuring Unit ...................................................................................... page 2-98 2.3.5.1 Cuvette Arm .................................................................... page 2-98 2.3.5.2Filter Disk / Beam Alignment ............................................. page 2-99 2.3.5.3 Measuring Positions ........................................................ page 2-100 2.3.5.4 Lamp Voltages and Gains ............................................... page 2-100 2.3.6 Reagent Disk ......................................................................................... page 2-101 2.3.7 Sample Disk .......................................................................................... page 2-102 2.3.8 Dispensing Unit of Konelab 20, 20i ....................................................... page 2-104 2.3.8.1 Dispenser ....................................................................... page 2-104 2.3.9 Dispensing Unit of Konelab 20XT, 20XTi ............................................... page 2-111 2.3.9.1 Dispenser ........................................................................ page 2-111 2.3.9.2 Mixer ............................................................................... page 2-119 2.3.10 ISE Unit ............................................................................................... page 2-122 2.3.11 Saving and Restoring Adjustment Values ........................................... page 2-126 2.3.11.1 Saving Adj. Values to Floppy Disk ................................ page 2-126 2.3.11.2 Restoring Adj. Values from Floppy Disk ........................ page 2-126 2.4 Konelab Dispenser Arms ..................................................................................... page 2-127 Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2.1 Adjustments of Konelab 60 2.1.1 General Keys in use 1-9 Y/N b ALT+89/ ALT+78 ALT+78 ALT+73 ALT+82 ALT+97 – ALT+115 A+65 – ALT+83 ALT+119 – ALT+122 ALT+87 – ALT+90 ALT+99 – ALT+118 ALT+67 – ALT+86 ALT+98 B ALT+66 T ALT+84 M ALT+77 Q ALT+81 N I R A <-> S Shift + A <-> S Note! Keep CapsLock OFF when adjusting Alternative keys W <-> Z Shift + W <-> Z C <-> V Shift + C <-> V 2-3 Function Module selection To save / cancel changes Next Initialisation To restore old adjustment 1. Motor, Left <-> Right movement Left - Right with a long movement 2. Motor, Up <-> Down movement Up-Down with a long movement 3. Motor, Forward <-> Backward Forward - Backward with a long movement To read barcode in the reagent disk / sample disk. (In the sample disk, the segment barcode is read.) In the sample disk, segment and tube barcodes are read. Automatic BCR reading position adjustment To rotate mixer when adjusting mixer cuvette positions Quit Note! During adjustment program, sample / reagent covers can be taken off. In that time the analyzer is not responding to the opening of covers. Attach the covers back before quitting the adjustment program. Note! After each maintenance or adjustment procedure QC run is recommended ! November 2, 2003 48953054-4081 Konelab Service Manual 2-4 Adjustments Version I 2.1.2 How to Start Adjusting ? • Open Konelab user interface: • Click Main -button • Press F8 -key (More) • Press F2 -key (Instr. Actions) • Press F8 (More) • Press F5 (Adjustment program) Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-5 Recommended order to adjust • Cuvette unit • Incubator • Reagent unit • Sample unit • Measuring unit • ISE unit • KUSTI unit Good to know • The instrument adjusts 'Syringe zero position' automatically. (refer section 2.1.10) • The instrument performs ‘Cuvette movement test’ automatically • 'Fetch new cuvette to incubator position' is recommended to use when a cuvette has to be moved to the selected incubator position. (E.g. for adjustment of measuring positions in measuring unit (refer section 2.1.7.3)) Note! After each adjustment section program asks: "Save adjustments (y / n) ?" Press key Y (yes) to save adjustments automatically to internal PC hard disk. Dispenser needles / Mixer paddle • Before the adjustment of dispensers and mixer, the arms of them have to be adjusted mechanically so that needles go to their checking points. Refer to checking points below. Needle / Paddle checking points are the following: Reagent Dispenser Sample Dispenser ISE dispenser KUSTI dispenser Mixers November 2, 2003 The hole in the reagent dispensing station The hole in the sample dispensing station The left edge of the washing station The right edge of the washing station The right edge of the dispensing hole in the reagent / sample dispensing station 48953054-4081 Konelab Service Manual 2-6 2.1.3 Adjustments Version I Cuvette Unit Adjustment tools needed: • a feeler gauge (886650) Note! Pusher is moving cuvettes from the revolver to the cuvette feeder. Mover is moving cuvettes from the feeder to the incubator. Cuvette unit adjustments are: 1. Revolver 2. Latch 3. Pusher 4. Mover Note! • Remove all cuvettes from feeder. • Keep the menu order when adjusting, especially if the instrument is new or adjustments are in disorder. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-7 1. Revolver Note! Make sure that the pusher is not blocking the revolver movement. Revolver 1 position: • Adjust revolver slot 1straight against cuvette feeder. Revolver positions 2-6 are adjusted in a similar way. Revolver free position: • Pusher must move freely to open position. Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-8 Adjustments Version I 2. Latch Note! Make sure that the pusher is not blocking the revolver movement. Latch open position: • When the latch is open make sure that it is below the cuvette feeder base. Cuvettes must move over the latch without touching it. Latch closed position: • The revolver must rotate freely without hitting the latch motor axle. Revolver part Latch motor axle Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-9 3. Pusher Note! Make sure that the feeder is empty and revolver can rotate freely. Pusher open position: • The pusher will automatically find out the location of the opto. • Adjust 1- 2 mm clearance between the pusher and revolver. Pusher position for cuvette fetch: • Insert one cuvette into the loader when command is seen on the screen. First the program will automatically adjust the distance to cuvette sensing opto. For example: - On the screen is seen text : "Adjusting pusher position for cuvette fetch, opto detected at 74063". - Compare opto value to adjustment value. - Adjust 4-6 steps more from detection point. Adjustment absolute value must be bigger. Note! Each time when Pusher position for cuvette fetch is adjusted, Incubator (2.1.4) Cuvette loader position must be checked /adjusted. Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-10 Adjustments Version I 4. Mover Note! • Take incubator covers off. • Turn an empty incubator position against cuvette feeder. Mover position in incubator: • Mover will push one cuvette to the incubator. • Adjust the mover that there is 0.1 mm distance between cuvette rear end and incubator wall. Use a feeler gauge (886650). Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I 2.1.4 Adjustments 2-11 Incubator Adjustment tools needed: • Take incubator metal cover off. • A cuvette in incubator position 1. Incubator position1 is next to mounting cross headed screw and opposite side is a hole for heating wires going under incubator block. Note! All cuvette arms are powerless. Check manually cuvette movement from incubator to stations during adjustments. Incubator adjustment positions are: • • • • • Reagent channel Sample channel Measuring channel Cuvette loader Manual cuvette exit All positions are adjusted according the Incubator position 1. Other position (2-20) are calculated by the software. Reagent channel: • Fetch cuvette manually with cuvette arm. • Move cuvette into the channel and check that cuvette is not touching to guiding bearings. • Adjust incubator if needed. November 2, 2003 48953054-4081 Konelab Service Manual 2-12 Adjustments Version I Sample / Measuring channel is adjusted in a similar way. Cuvette loader: • Move cuvette from loader to incubator by rotating the Mover belt wheel manually and check that the cuvette moves straight to incubator position 1. • Adjust incubator if needed. Manual cuvette exit: • In the right side of incubator vessel assembly is a exiting hole. • Exit cuvette manually. • Adjust incubator if needed. After adjustment, the program asks if wanted to check all incubator positions: Check adjustments y/n? If answered y (yes), all incubator positions can be checked in reagent, sample and measurement station position. Check all positions (1-20) with a cuvette, because incubator motor steps are not equal. Adjust the position 1 again if necessary. The final adjustment should be the best possible choice for all incubator positions (1-20). Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I 2.1.5 Adjustments 2-13 Reagent Unit 2.1.5.1 Cuvette Arm Adjustment tools needed: • A cuvette in incubator position 1. • feeler gauge (886650) Cuvette arm adjustment position is: • Incubator position Incubator position: • The adjustment is valid when you can hardly lift the feeler gauge (0.1 mm) from the space between the cuvette rear end and the incubator wall . Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-14 2.1.5.2 Adjustments Version I Reagent Disk Adjustment tools needed: • Empty bar-coded 20 ml reagent bottle Reagent disk adjustment positions are: • Vial inserting position • Barcode reader position Vial inserting position: • Open vial/inserting cover and insert a reagent bottle to disk. • Adjust reagent disk if needed. Barcode reader position: • Press b to read the reagent bottle barcode. • If reading is OK, no beep is heard. By adjusting the disk, find the both ends of the reading area until beep sound is heard. • Count the steps from side to side and set the adjustment to the middle. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-15 2.1.5.3 Reagent Dispenser Reagent dispenser adjustment positions are: • • • • Dividing partition 1. General positions 2. Cuvette positions 3. Reagent positions 8. Test wash Wash position Resting position Extra wash position 1. General positions • • • • • • Phi drive level position Needle check position Manual needle wash position Wash position Extra wash position Resting position Phi drive level: • Adjust needle tip 3 - 4 mm above the reagent disk where the reagent dispenser moves. Needle check position: • The needle check position is a hole in the reagent dispensing station. • Adjust the needle tip close to the dispensing station's top surface level. Manual needle wash position: • Adjust the needle to the middle of the washing station and reagent dispensing unit. ( = 15 long steps from edge of the washing station) November 2, 2003 48953054-4081 Konelab Service Manual 2-16 Adjustments Version I Wash position: • Move the needle over the dividing partition. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the dividing partition. • Adjust 3 steps up W ( Ý ) from the partition Phi-movement: • Adjust back to the middle of the wash position. Extra wash position: Phi movement: • Adjust to the middle of the extra wash position. • Wash position Y-movement adj. value is used in Extra wash position. Resting position: • Dispenser arm is adjusted 1 mm above the stick. • Adjust the Phi-movement to the middle of the resting position. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-17 2. Cuvette positions • Cuvette cell 1 upper position • Cuvette cell 1 position • Cuvette cell 12 position Note! Cuvette arm is adjusted cell 1 upper / cell 1 positions. • Insert a cuvette into the reagent arm if there is not already. Cuvette cell 1 upper position: Phi-movement: • Adjust dispenser needle to the middle of the cuvette cell Cuvette arm: • Adjust arm that needle is in the middle of the cuvette cell 1. Y-movement: • Adjust the needle tip 1 mm under the cuvette top surface. Cuvette cell 1 position: Phi-movement: • Adjust dispenser needle to the middle of the cuvette cell 1. Cuvette arm: • Adjust arm that needle is in the middle of the cuvette cell 1. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the bottom of the cuvette. • Adjust 3 steps up W ( Ý ) from the bottom. November 2, 2003 48953054-4081 Konelab Service Manual 2-18 Adjustments Version I Cuvette cell 12 position: Phi-movement: • Adjust dispenser needle to the middle of the cuvette cell 12. Y-movement: • Press Z (ß ) and find the position when the needle is touching the bottom of the cuvette. • Adjust 3 steps up W ( Ý ) from the bottom. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-19 3. Reagent position: • Cuvette cell 1 upper position • Cuvette cell 1 position • Cuvette cell 12 position Note! • Take reagent cover off. • Insert 20 ml reagent bottle into the reagent disk positions 1, 12, 23 and 35. • Each reagent bottle position have an own bottom adjustment value. Reagent disk position cups: Phi-movement: • Adjust dispenser needle to middle of the bottle neck. Reagent disk: • Adjust disk that the needle is in middle of the bottle neck. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the bottom of the bottle. • Adjust 4 steps up W ( Ý ) from the bottom. Positions 12, 23 and 33: • Check Y-movement 4 steps up from the bottom. Save adjustments ? November 2, 2003 48953054-4081 Konelab Service Manual 2-20 Adjustments Version I 2.1.5.4 Reagent Mixer Reagent mixer adjustment positions are: • 1. General positions • 2. Cuvette positions • 9. Test mixing in cuvette Wash position 1. General positions • Phi drive level position • Paddle check position • Manual needle wash position • Wash position • Resting position Phi drive level: • Adjust mixer paddle tip 4-5 mm above the reagent dispensing station. Paddle check position: • Adjust the mixer paddle tip to the right edge of the dispensing hole in the reagent dispensing station. • Adjust the paddle tip close to the dispensing station's upper surface level. Manual needle wash position: Phi-movement: • Adjust mixer paddle to the middle of the dispensing reagent unit. ( = 120 long steps from the wash position) Y-movement: • Adjust mixer paddle tip 20 long steps up from the surface of the washing station. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-21 Wash position: Phi-movement: • Adjust mixer paddle to the middle of the washing position. Y-movement: • Straight part of the paddle is above the washing station as shown in figure under. Resting position: Phi-movement: • Adjust paddle to the middle of the wash position. Y-movement: • Adjust the mixer arm 1 mm above the rubber. Save adjustments y/n ? November 2, 2003 48953054-4081 Konelab Service Manual 2-22 Adjustments Version I 2. Cuvette positions • Insert a cuvette into the reagent arm if there is not already. Cuvette cell 1position: Phi-movement: • Adjust the mixer paddle to the middle of the cuvette cell. Y-movement: • Press Z ( ß ) and find the position when the paddle is touching the bottom of the cuvette. • Adjust 3 steps up W ( Ý ) from the bottom. • Press key m to check that the mixer can rotate freely. Cuvette cell 12 position: Phi-movement: • Adjust the mixer paddle to the middle of the cuvette cell. Y-movement: • Press Z ( ß ) and find the position when the paddle is touching the bottom of the cuvette. • Adjust 3 steps up W ( Ý ) from the bottom. • Press key m to check that the mixer can rotate freely. Save adjustments y/n? 9. Test mixing in cuvette: • Mixing is tested in all 12 positions in cuvette. • If mixing is noisy, readjust cuvette cell 1 and 12 positions. Konelab Service Manual 48953054-4081 November 2, 2003 Version I 2.1.6 Adjustments 2-23 Sample Unit 2.1.6.1 Cuvette Arm Adjustment tools needed: • A cuvette in incubator position 1. • feeler gauge (886650) Cuvette arm adjustment is: Incubator position: • The adjustment is valid when you can hardly lift the feeler gauge (0.1 mm) from the space between the cuvette rear end and the incubator wall. Save adjustments y/n ? November 2, 2003 48953054-4081 Konelab Service Manual 2-24 Adjustments Version I 2.1.6.2 Sample Disk Sample disk adjustments are: • Segment / vial inserting position, segments 1-6 • Barcode reader position, segments 1-6 • STAT sample inserting, positions 1-6 • Barcode reader position, STAT samples 1-6 • Segment loader positions Note! • Segment loader is powerless during adjustment. • It can be moved manually. Be sure that loader is not blocking sample disk movement when entering next position. • Take sample cover off. Segment / vial inserting position segment position 1: • Move the segment loader to down position • Adjust the disk that segment is in correct position when loader lifts it out. • Check movement manually that segment loader´s 2 pins goes straight through segment´s bottom plate holes. Note! Good quality barcode stickers are needed. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-25 Barcode reader position segment position 1: • Insert a segment with barcoded sample tubes into the sample disk position 1. • Press b to read the segment barcode. If reading is OK, no beep is heard. By adjusting the disk, find the both ends of the reading area until beep sound is heard. • Count the steps from side to side and set the adjustment to the middle. Automatic BCR adjustment: • After the segment barcode reading position is adjusted, the analyser will adjust the barcode reading positions automatically for all sample tubes. Press T to start adjustment. • When the automatic adjustment has been made, new and old values are seen on the screen and asked: Save new values y/n? • You can check the segment and tube barcode readings. Press B (Shift + b). • When the first segment has been adjusted the program asks if the user wants that all other 5 segment positions are calculated: Calculate other segment positions before adjusting them? y/n Choose Yes. Note! All other positions (2-6) are adjusted in a similar way. • Save adjustments y/n? STAT sample inserting position: • With cover on, insert a sample tube into the STAT sample position 1. • Adjust disk if needed. November 2, 2003 48953054-4081 Konelab Service Manual 2-26 Adjustments Version I Barcode reader position: • Insert barcoded sample tube into the STAT sample position 1. • Press b to read the sample tube barcode. If reading is OK, no beep is heard. By adjusting the disk, find the both ends of the reading area until beep sound is heard. • Count the steps from side to side and set the adjustment to the middle. • When the STAT sample position 1 has been adjusted, the program asks if the user wants that all other 5 STAT sample positions are calculated: Calculate other STAT positions before adjusting them? y/n. Choose Yes. STAT sample inserting / barcode positions 2-6 are adjusted in a similar way. • Save adjustments y/n? Segment loader positions: Segment loader up position: • Segment must rest over the sample unit, not over the segment loader. Adjust about 1 mm space between the segment bottom and loader. 1 mm space between segment and loader Important! Sample disk position 1 must be empty. Close the segment loader cover before next (n) position. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-27 Segment loader positions Segment loader down position: • Adjust the loader that the sample disk can rotate freely without touching the segment loader pins. • Distance between sample disk bottom and loader pins is 2-3 mm. DO NOT adjust it lower because the loaders mechanical movement area ends. • Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-28 2.1.6.3 Adjustments Version I Sample Dispenser Dispenser adjustment positions are: 1. General positions Dividing partition • Phi drive level position • Needle check position • Manual needle wash position • Wash position • Extra wash position • Resting position Wash position Resting position Extra wash position 2. Cuvette positions 4. STAT positions, all 6 5. Standard / Control positions, all 40 6. Segment positions • Outer ring, position 10 for all 6 segments • Inner ring, position 3 for all 6 segments • Sample tube in position 11 for the segment position 1 7. KUSTI segment positions 8. Test wash 1. General positions Phi drive level position: • Adjust dispenser needle 3 - 4 mm above the sample disk where the sample dispenser moves. Needle check position: • The needle check position is a hole in the sample dispensing station. Adjust the needle tip to the dispensing station's top surface level. Manual needle wash position: • Adjust dispenser needle 20 long steps outside from edge of the sample disk. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-29 Wash position: • Move the needle over the dividing partition. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the dividing partition. • Adjust 3 steps up W ( Ý ) from the partition. Phi movement: • Adjust to the middle of the wash position. Extra wash position: Phi movement: • Adjust to the middle of the extra wash position. Wash position Y-movement adj. value is used in Extra wash position. Resting position: • Dispenser arm is adjusted about 1 mm above the stick. • Adjust the Phi-movement to the middle of the resting position. Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-30 Adjustments Version I 2. Cuvette positions • Cuvette cell 1 upper position • Cuvette cell 1 position • Cuvette cell 12 position Insert a cuvette into the sample arm if there is not already. (refer section 2.1.6.1) Note! Incubator is adjusted cell 1 upper / cell 1 positions. Cuvette cell 1 upper position: Phi-movement: • Adjust dispenser needle to the middle of the cuvette cell 1. Cuvette arm: • Adjust arm that needle is in the middle of the cuvette cell 1. Y-movement: • adjust the needle tip 1 mm under the cuvette top surface. Cuvette cell 1 position Phi-movement: • Adjust dispenser needle to the middle of the cuvette cell 1. Cuvette arm: • Adjust arm that needle is in the middle of the cuvette cell 1. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the bottom of the cuvette. • Adjust 3 steps up W ( Ý ) from the bottom. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-31 Cuvette cell 12 position Phi-movement: • Adjust dispenser needle to the middle of the cuvette cell 12. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the bottom of the cuvette. • Adjust 3 steps up W ( Ý ) from the bottom. Save adjustments y/n? Note! Sample disk has four (4) circles for samples: • STAT (1-6) • Std/Ctrl (40) • Segment outer (8-14) • Segment inner (1-7) • (KUSTI segment rings 1 to 5) Dispenser has only one Y- and Phi- adjustment value for all positions in one circle. November 2, 2003 48953054-4081 Konelab Service Manual 2-32 Adjustments Version I 4. STAT positions Note! Take sample cover off and insert 0.5 ml cups into the STAT positions. Phi-movement: • Adjust dispenser needle into the middle of sample cup. Sample disk: • Adjust disk that the needle is in the middle of the sample cup. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the sample cup bottom. • Adjust 2 steps up W ( Ý ) from the bottom. When the first STAT position has been adjusted the program asks if the user wants that all other 5 STAT positions are calculated: Calculate other STAT positions before adjusting them? y/n Choose Yes. Check all STAT positions one by one that the needle goes to the middle of the cup without touching the cup bottom. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-33 5. Standard / Control positions Note! Insert 0.5 ml cups into the ISE PRIME, C10, S0 and S10 positions and place the sample disk cover and STD/CTRL plastic cover on. Phi-movement: • Adjust the dispenser needle into the middle of sample cup. Sample disk: • Adjust disk that the needle is in the middle of the sample cup. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the sample cup bottom. • Adjust 2 steps up W ( Ý ) from the bottom. When the ISE wash/prime position has been adjusted the program asks if the user wants that all other Std / Ctrl positions are calculated: Calculate other Std / Ctrl positions before adjusting them? y/n Choose Yes. Check Std /Ctrl sample positions C10, S0 and S10 that the needle goes to the middle of the cup without touching the cup bottom. Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-34 Adjustments Version I 6. Segment positions Note! • Take sample cover off. • Insert 0.5 ml cups into the segment positions 3 and 10 and a sample tube into the position 11. • Insert segment to the sample disk position 1. • Insert second segment with cups in positions 3 and 10 to sample disk position 2. Cup position 10 adjustment: Phi-movement: • Adjust the dispenser needle into the middle of sample cup. Sample disk: • Adjust disk that the needle is in the middle of the sample cup. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the sample cup bottom. • Adjust 3 steps up W ( Ý ) from the bottom. Cup position 3 is adjusted in a similar way. Tube bottom level in the position 11: • Press Z ( ß ) and find the position when the needle is touching the tube bottom. • Adjust as many steps up W ( Ý ) from the bottom as is reasonable. When the first segment has been adjusted the program asks if the user wants that all other 5 segment positions are calculated: Calculate other segment positions before adjusting them? y/n Choose Yes. Check all segments positions 3 and 10 one by one that the needle goes into the middle of the cup without touching the cup bottom. Tube bottom level is adjusted only once in disk position 1. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-35 7. KUSTI segment positions Note! • Take sample cover off and insert KUSTI segments into the sample disk position 1 and 2 Ring5 Cup 1 Ring4 Cup 17 Ring3 Cup 35 Ring2 Cup 53 Ring1 Cup 73 Phi-movement: • Adjust the dispenser needle into the middle of the ring 1 cup position 73. Sample disk: • Adjust disk that the dispenser needle is in the middle of the ring 1 cup position 73. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the bottom. • Adjust 3 steps up W ( Ý ) from the bottom. Ring2 /cup 53 , ring3 / cup35 , ring4 / cup17 and ring5 / cup1 are adjusted in a similar way. When all positions in the first segment has been adjusted the program asks if the user wants that all other segment positions are calculated: Calculate other segment positions before adjusting them y/n? Choose Yes. All other segment positions 2 - 6 are adjusted in a similar way. Save adjustments y/n ? November 2, 2003 48953054-4081 Konelab Service Manual 2-36 Adjustments Version I 2.1.6.4 Sample Mixer Sample mixer adjustment positions are: • General positions • Cuvette positions • Test mixing in cuvette Wash position 1. General positions • Phi drive level position • Paddle check position • Manual needle wash position • Wash position • Resting position Phi drive level: • Adjust mixer paddle tip 4 - 5 mm above the sample dispensing channel where the mixer moves. (Note that mixer does not touch the wires on dispensing channel.) Check position: • Adjust the mixer paddle tip in the left edge of the washing station and to the top surface level of the washing station. Manual needle wash position Phi-movement: • Adjust mixer paddle to the middle of the sample dispensing unit.( = 227 long steps from wash position) Y-movement: • Adjust mixer paddle tip 20 long steps up from surface of the washing station. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-37 Wash position Phi-movement: • Adjust mixer paddle to the middle of the washing position. Y-movement: • Straight part of the paddle is above the washing station as shown in figure under. Resting position: Phi-movement: • Adjust paddle to the middle of the wash position. Y-movement: • Adjust the mixer arm 1 mm above the rubber. Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-38 Adjustments Version I 2. Cuvette positions • Insert a cuvette into the reagent arm if there is not already. Cuvette cell 1 position: Phi-movement: • Adjust the mixer paddle into the middle of the cuvette cell. Y-movement: • Press Z ( ß ) and find the position when the paddle is touching the bottom of the cuvette. • Adjust 3 steps up W ( Ý ) from the bottom. • Press key m to check that the mixer can rotate freely. Cuvette cell 12 position: Phi-movement: • adjust the mixer paddle to the middle of the cuvette cell. Y-movement: • Press Z ( ß ) and find the position when the paddle is touching the bottom of the cuvette. • Adjust 3 steps up W ( Ý ) from the bottom. • Press key m to check that the mixer can rotate freely. Save adjustments y/n? 3. Test mixing in cuvette: • Mixing is tested in all 12 positions in cuvette. • If mixing is noisy, readjust cuvette cell 1 and 12 positions. Konelab Service Manual 48953054-4081 November 2, 2003 Version I 2.1.7 Adjustments 2-39 Measuring Unit Measuring unit adjustment positions are: • Cuvette arm • Filter disk/ beam alignment • Measuring positions • Lamp voltages and gains 2.1.7.1 Cuvette Arm Adjustment tools needed: • A cuvette in incubator position 1 • A feeler gauge (886650) 1. Cuvette arm adjustment positions: • Incubator positions 1, 6, 11 and 16 • Cuvette exit position Note! • Cuvette arm is adjusted with incubators 4 side because it is always slightly uneven and all positions are not exactly equal from the cuvette arms point of view. • Program calculates the difference between pos. 1 16 and uses it also with reagent and sample cuvette arms. Incubator position: • Rotate incubator position 1 against cuvette arm. The adjustment is valid when you can hardly lift the feeler gauge (0.1 mm) from the space between the cuvette rear end and the incubator wall . • Adjust the positions 1, 6, 11 and 16. Each position has an own adjustment value. November 2, 2003 48953054-4081 Konelab Service Manual 2-40 Adjustments Version I Cuvette exit position: • Adjust position 4 long steps ( Ý+S ) toward incubator and save adjustments. • Insert a cuvette to incubator position 1 and enter the Cuvette arm menu again. • In exit position, press the adjustment key ( A ) until you find the position where the cuvette will drop to the waste compartment. • Adjust 20 steps more ( key A ) from the dropping point. • Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-41 2.1.7.2 Filter Disk / Beam Alignment • When filter disk / beam alignment is selected, the instrument first drives the filter wheel into its empty position (15). • Adjust the light spot over the fiber bundle. (refer to figure below). Adjustment is done by the adjustment screws in the lamp assembly. Light spot Fiber bundle Filter wheel filter position 1 • Adjust filter wheel that the lamp beam is in the middle of the 1 filter cover. Save adjustments y/n ? Note! After filter wheel adjustment procedure QC run is recommended ! November 2, 2003 48953054-4081 Konelab Service Manual 2-42 Adjustments Version I 2.1.7.3 Measuring Positions Quit to adjustment program main menu to fetch a new cuvette to incubator position 1 (refer section 2.1.2 ) Return back to Measuring unit / Measuring positions. Measuring positions: • Instrument adjusts positions automatically. • Program finds cuvette cell walls starting from rear end of cuvette (=position 12) and sets the value to the middle of the cell one by one. (In software 5.0.X or lower). • Program finds cuvette cell walls starting from front end of cuvette (=position 1) and sets the value to the middle of the cell one by one. (In software 6.0.X). • After adjustment is seen old and new values and asked: Save new values YES/NO. If adjustment fails, it stops and gives an error message. 2.1.7.4 Lamp Voltages and Gains The lamp voltages and gains are adjusted automatically during Start up. Note! Results what are seen in this function are from the latest Start up. Gain values are: 0, 1, 2, 3, 4, 5. When gain is low the filter is good. With 340 and 380 the gain is usually 2 or 3. All the rest filter gains are usually 0, 1 or 2. If the gain is 5, filter or lamp is getting old or beam alignment is bad or blocked. Note! The lamp voltage is 0 when the filter position has a cover plate. Konelab Service Manual 48953054-4081 November 2, 2003 Version I 2.1.8 Adjustments 2-43 ISE Unit ISE dispenser adjustment positions are: 1.General positions • Phi drive level position • Needle check position • Manual needle wash position • Wash position • Resting position 4.STAT positions, all 6 Wash position Dividing partition Waste/ resting position 5.Standard / Control positions, all 40 6.Segment positions, • outer ring, position 10 for all 6 segments • inner ring, position 3 for all 6 segments • sample tube position 11 for the segment 1 7. KUSTI segment positions 8. Test wash Note! Sample disk has four (4) circles for samples: • STAT (1-6) • Std /Ctrl (40) • Segment outer (8-14) • Segment inner (1-7) • (KUSTI segment rings 1 to 5) ISE dispenser has only one Y- and Phi- adjustment value for all positions in one circle. November 2, 2003 48953054-4081 Konelab Service Manual 2-44 Adjustments Version I 1. General positions Phi drive level position: • Adjust dispenser needle tip 3 - 4 mm above the sample disk cover where the ISE dispenser moves. Needle check position: • ISE needle check position is in the left edge of the washing station. • Adjust needle tip to washing station top surface level. Manual needle wash position: Phi-movement: • Adjust to the middle of the washing station and reagent storage (disk). Wash position: • Move the needle over the dividing partition. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the dividing partition. • Adjust 3 steps up W ( Ý ) from the partition. Phi-movement: Adjust to the middle of the wash position. Waste position: • Adjust the needle to the middle of the waste position. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-45 Resting position: • Adjust dispenser arm about 1 mm above the stick. • Adjust the dispenser needle to the middle of the resting position. Save adjustments y/n? 2. STAT positions Note! Take sample cover off and insert 0.5 ml cups into the STAT positions. Phi-movement: • Adjust dispenser needle into the middle of sample cup. Sample disk: • Adjust disk that the needle is in the middle of the sample cup. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the sample cup bottom. • Adjust 2 steps up W ( Ý ) from the bottom. When the STAT position 1 has been adjusted the program asks if the user wants all other 5 STAT positions to be calculated: Calculate all STAT positions before adjusting them? y/n Choose Yes. Check all STAT sample positions one by one that the needle goes to the middle of the cup without touching the cup bottom. Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-46 Adjustments Version I 3. Standard / Control positions Note! Insert 0.5 ml cups into the ISE PRIME, C10, S0 and S10 positions and place the sample disk cover and STD/CTRL plastic cover on. Phi-movement: • Adjust dispenser needle into the middle of sample cup. Sample disk: • Adjust disk that the needle is in the middle of the sample cup. -Y-movement: • Press Z ( ß ) and find the position when the needle is touching the sample cup bottom. • Adjust 2 steps up W ( Ý ) from the bottom. When the ISE PRIME position has been adjusted the program asks if the user wants that all other positions are calculated: Calculate all other positions before adjusting them? y/n Choose Yes. Check STD/CTRL sample positions C10, S0 and S10 that the needle goes to the middle of the cup without touching the cup bottom. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-47 4. Segment positions Note! • Take sample cover off. • Insert 0.5 ml cups into the segment positions 3 and 10 and a sample tube into the position 11. • Insert segment to the sample disk position 1. • Insert second segment with cups in positions 3 and 10 to sample disk position 2. Cup position 10 adjustment: Phi-movement: • Adjust the dispenser needle into the middle of sample cup. Sample disk: • Adjust disk that the needle is in the middle of the sample cup. Y-movement: • Press Z (ß) and find the position when the needle is touching the sample cup bottom. • Adjust 2 steps up W ( Ý ) from the bottom. Cup position 3 is adjusted in a similar way. Tube bottom level in the position 11: • Press Z ( ß ) and find the position when the needle is touching the tube bottom. • Adjust as many steps up W ( Ý ) from the bottom as is reasonable. When positions in the first segment has been adjusted, the program asks if the user wants that all other positions are calculated: Calculate all other positions before adjusting them? y/n Choose Yes. Check all segments positions 3 and 10 one by one that the needle goes into the middle of the cup without touching the cup bottom. Tube bottom level is adjusted only once in segment 1. Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-48 Adjustments Version I 7. KUSTI segment positions Note! Take sample cover off and insert KUSTI segments into the sample disk positions 1 and 2. Ring5 Cup 1 Ring4 Cup 17 Ring3 Cup 35 Ring2 Cup 53 Ring1 Cup 73 Phi-movement: • Adjust the ISE dispenser needle into the middle of the ring 1 cup position 73. Sample disk: • Adjust disk that the ISE dispenser needle is in the middle of the ring 1 cup position 73. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the bottom. • Adjust 3 steps up W( Ý ) from the bottom. Ring2 /cup 53 , ring3 / cup35 , ring4 / cup17 and ring5 / cup1 are adjusted in a similar way. When all positions in the first segment has been adjusted the program asks if the user wants that all other segment positions are calculated: Calculate other segment positions before adjusting them y/n? Choose Yes. All other segment positions 2 - 6 are adjusted in a similar way. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I 2.1.9 Adjustments 2-49 KUSTI Unit KUSTI dispenser adjustment positions are: Dividing partition 1. General positions • • • • • • Phi drive level position Needle check position Manual needle wash position Wash position Extra wash position Resting position Wash position Resting position Extra wash position 2. Sample transfer line position 7. KUSTI segment positions 8. Test wash 1. General positions Phi drive level: • Adjust dispenser needle tip 2 - 3 mm above the sample disk cover where the KUSTI dispenser moves. Needle check position: • The needle check position is in the right edge of the washing station. • Adjust the needle tip to the washing station top surface level. Manual needle wash position: Phi-movement: • Adjust the needle over the bottle of washing solution November 2, 2003 48953054-4081 Konelab Service Manual 2-50 Adjustments Version I F Wash position: • Move the needle over the dividing partition. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the dividing partition. • Adjust 3 steps up W ( Ý ) from the partition Phi-movement: • Adjust to the middle of the wash position. Extra wash position: Phi movement: • Adjust to the middle of the extra wash position. Wash position Y-movement adj. value is used in Extra wash position. Resting position: • Dispenser arm is adjusted 1mm above the rubber . • Adjust the Phi-movement to the left side of washing station. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-51 2. Sample transfer line position: Note! This adjustment is done after connecting Konelab to Sample transfer line. Factory adjustment is over the left end cover. KUSTI dispenser sample transfer line position: Phi-movement: • Adjust KUSTI dispenser needle into the middle of the sample tube in the sample transfer line. Y-movement is not saved. This adjustment is made first to move dispenser over the sample transfer line without any danger of breaking the needle. KUSTI dispenser sample transfer line position: Phi-movement: • Adjust KUSTI dispenser needle into the middle of the sample tube in the sample transfer line. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the tube bottom. • Adjust as many steps up W ( Ý ) from the bottom as is reasonable. November 2, 2003 48953054-4081 Konelab Service Manual 2-52 Adjustments Version I 3. KUSTI segment positions: Note! Take sample cover off and insert KUSTI segments into the sample disk positions 1 and 2. Ring5 Cup 1 Ring4 Cup 17 Ring3 Cup 35 Ring2 Cup 53 Ring1 Cup 73 Phi-movement: • Adjust the KUSTI dispenser needle into the middle of the ring 1 cup position 73. Sample disk: • Adjust disk that the KUSTI dispenser needle is in the middle of the ring 1 cup position 73. Y-movement: • Adjust dispenser needle halfway to the cup. Ring2 /cup 53 , ring3 / cup35 , ring4 / cup17 and ring5 / cup1 are adjusted in a similar way. When all positions in the first segment has been adjusted the program asks if the user wants that all other segment positions are calculated: Calculate other segment positions before adjusting them y/n? Choose Yes. All other segments 2 - 6 are adjusted in a similar way. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-53 2.1.10 Syringe Zero Position Syringe zero position adjustment must be done when complete syringe unit, stepper motor or opto has been changed. The instrument adjusts the zero position automatically. Error message 5065 "Syringes should be adjusted (adjustment program)" informs the user when syringe zero position adjustment should be done. 2.1.11 Saving and Restoring Adjustment Values 2.1.11.1 Saving Adj. Values to Floppy Disk 1. Connect display and keyboard to the internal PC. 2. If instrument is on - quit Konelab software by pressing E. - If instrument is off - boot the instrument. Select item 2. Command prompt from boot up menu by pressing the arrow key down ( ß ) once and after that pressing enter. 3. Insert formatted floppy disk to the floppy drive. Note! The floppy drive is upside down. 4. When in the screen is displayed C://x60, copy adjustment files to the floppy disk with command save_adj. 5. Remove the floppy disk from the drive. 6. Reboot the instrument. 2.1.11.2 Restoring Adj. Values from Floppy Disk 1. Connect display and keyboard to the internal PC. 2. Instrument is on - quit Konelab software by pressing E. - Instrument is off - boot the instrument. Select item 2. Command prompt from boot up menu by pressing the arrow key down ( ß ) once and after that pressing enter. 3. Insert the floppy disk containing the adjustment values to the floppy drive. Note: Floppy drive is upside down. 4. When in the screen is displayed C://x60, load adjustment files from the floppy disk with command load_adj 5. Remove the floppy disk from the drive. 6. Reboot the instrument. November 2, 2003 48953054-4081 Konelab Service Manual 2-54 Konelab Service Manual Adjustments 48953054-4081 Version I November 2, 2003 Version I Adjustments 2.2 Adjustments of Konelab 30 2.2.1 General Keys in use 1-9 Y/N b ALT+89/ ALT+78 ALT+78 ALT+73 ALT+82 ALT+97 – ALT+115 A+65 – ALT+83 ALT+119 – ALT+122 ALT+87 – ALT+90 ALT+99 – ALT+118 ALT+67 – ALT+86 ALT+98 B ALT+66 T ALT+84 M ALT+77 Q ALT+81 N I R A <-> S Shift + A <-> S Note! Keep CapsLock OFF when adjusting Alternative keys W <-> Z Shift + W <-> Z C <-> V Shift + C <-> V 2-55 Function Module selection To save / cancel changes Next Initialisation To restore old adjustment 1. Motor, Left <-> Right movement Left - Right with a long movement 2. Motor, Up <-> Down movement Up-Down with a long movement 3. Motor, Forward <-> Backward Forward - Backward with a long movement To read barcode in the reagent disk / sample disk. (In the sample disk, the segment barcode is read.) In the sample disk, segment and tube barcodes are read. Automatic BCR reading position adjustment To rotate mixer when adjusting mixer cuvette positions Quit Note! During adjustment program, sample / reagent covers can be taken off. In that time the analyser is not responding to the opening of covers. Attach the covers back before quitting the adjustment program. Note! After each maintenance or adjustment procedure QC run is recommended ! November 2, 2003 48953054-4081 Konelab Service Manual 2-56 2.2.2 Adjustments Version I How to Start Adjusting ? • Open Konelab user interface: • Click Main -button • Press F8 -key (More) • Press F2 -key (Instr. Actions) • Press F8 (More) • Press F5 (Adjustment program) Recommended order to adjust • Incubator • Cuvette unit • Reagent disk • Sample disk • Measuring unit • Dispensing unit • ISE unit • KUSTI unit Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-57 Good to know • The instrument adjusts 'Syringe zero position' automatically. (refer section 2.2.9) • 'Fetch new cuvette to incubator position' is recommended to use when a cuvette has to be moved to the selected incubator position. (E.g. for adjustment of measuring positions in measuring unit (refer section 2.2.6.3)) Note! After each adjustment section program asks: "Save adjustments (y/n) ?" Press key Y (yes) to save adjustments automatically to internal PC hard disk. Dispenser needles / Mixer paddle • Before the adjustment of dispensers and mixer, the arms of them have to be adjusted mechanically so that dispenser needles go to their checking points. Refer to checking points under. Needle checking points are the following: Dispenser ISE dispenser KUSTI dispenser Mixer November 2, 2003 The right edge of the sample side's washing station. The left edge of the washing station. The right edge of the washing station. The left edge of the washing station. 48953054-4081 Konelab Service Manual 2-58 2.2.3 Adjustments Version I Incubator Adjustment tools needed: • a cuvette in every incubator position 1-6 • take plastic cover, incubator metal cover and black measuring channel cover off. Note! Cuvette arm is powerless during incubator adjustment. It can be moved manually. Incubator adjustment positions are: • Cuvette arm positions Cuvette arm position 1: • Fetch manually cuvette with arm from incubator and check that the cuvette is not touching guiding bearings. • Adjust incubator if needed . • Release cuvette back to incubator and fetch again. Other Cuvette arm positions 2-6 are adjusted in a similar way. • Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I 2.2.4 Adjustments 2-59 Cuvette Unit Cuvette unit adjustment positions are: • Pusher open position • Pusher position for cuvette fetch Note! Cuvette feeder must be empty! Pusher open position: • Pusher belt gear and the loader end belt gear nearly touch each other. • Adjust pusher if needed. • Press pusher with fingers to see more clearly adjustment movement. Note! Insert one (1) cuvette into the feeder when command is seen on the screen. Pusher position for cuvette fetch: • First the program will automatically adjust the distance to cuvette sensing opto. • For example: On the screen is seen text: "Adjusting pusher position for cuvette fetch, opto detected at 54947". Compare opto value to adjustment value and adjust 4-6 steps more from detection point. Adjustment value must be bigger. • Fetch a cuvette manually from feeder and check that cuvette aligns straight with cuvette arm. Readjust pusher if needed. • Press pusher down to see more clearly adjustment movement. • Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-60 2.2.5 Adjustments Version I Reagent Disk Adjustment tools needed: • Empty barcoded 20 ml reagent bottle. Reagent disk adjustment positions are: • Vial inserting position • Barcode reader position Vial inserting position: • Open vial / inserting cover and insert a reagent bottle to disk. • Adjust reagent disk if needed. Barcode reader position: • Press b to read the reagent bottle barcode. • If reading is OK, no beep is heard. By adjusting the disk, find the both ends of the reading area until beep sound is heard. Count the steps from side to side and set the adjustment to the middle. • Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I 2.2.6 Adjustments 2-61 Sample Disk Sample disk adjustments are: • • • • • Segment / vial inserting position, segments 1-6 Barcode reader position, segments 1-6 STAT sample inserting, positions 1-6 Barcode reader position, STAT samples 1-6 Segment loader positions Note! Segment loader is powerless during adjustment. It can be moved manually. Be sure that loader is not blocking sample disk movement when entering next position. Take sample cover off. Segment / vial inserting position segment position 1: • Move the segment loader to down position • Adjust the disk that segment is in correct position when loader lifts it out. • Check movement manually that segment loader´s 2 pins goes straight through segment´s bottom plate holes. Pins Pins November 2, 2003 48953054-4081 Konelab Service Manual 2-62 Adjustments Version I Barcode reader position segment position 1: • Insert a segment with barcoded sample tubes into the sample disk position 1. • Press b to read the segment barcode. If reading is OK, no beep is heard. By adjusting the disk, find the both ends of the reading area until beep sound is heard. Count the steps from side to side and set the adjustment to the middle. Note! Good quality barcode stickers are needed. Automatic BCR adjustment: • After the segment barcode reading position is adjusted, the analyser will adjust the barcode reading positions automatically for all sample tubes. Press T to start adjustment. • When the automatic adjustment has been made, new and old values are seen on the screen and asked: Save new values y/n? • You can check the segment and tube barcode readings. Press B (Shift + b). • When the first segment has been adjusted the program asks if the user wants that all other 5 segment positions are calculated: Calculate other segment positions before adjusting them? y/n Choose Yes. Note! All other positions (2-6) are adjusted in a similar way. • Save adjustments y/n? STAT sample inserting position: • With cover on, insert a sample tube into the STAT sample position 1. • Adjust disk if needed. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-63 Barcode reader position: • Insert barcoded sample tube into the STAT sample position 1. • Press b to read the sample tube barcode. If reading is OK, no beep is heard. By adjusting the disk, find the both ends of the reading area until beep sound is heard. Count the steps from side to side and set the adjustment to the middle. • When the STAT sample position 1 has been adjusted, the program asks if the user wants that all other 5 STAT sample positions are calculated: Calculate other STAT positions before adjusting them? y/n. Choose Yes. STAT sample inserting / barcode positions 2-6 are adjusted in a similar way. • Save adjustments y/n? Segment loader positions: Segment loader up position: • Segment must rest over the sample unit, not over the segment loader. Adjust about 1 mm space between the segment bottom and loader. 1 mm space between segment and loader Important! Sample disk position 1 must be empty. Close the segment loader cover before next (n) position. November 2, 2003 48953054-4081 Konelab Service Manual 2-64 Adjustments Version I Segment loader positions Segment loader down position: • Adjust the loader that the sample disk can rotate freely without touching the segment loader pins. • Distance between sample disk bottom and loader pins is 2-3mm. DO NOT adjust it lower because the loaders mechanical movement area ends. • Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-65 2.2.7 Measuring Unit Measuring unit adjustment positions are: • Cuvette arm • Filter disk/ beam alignment • Measuring positions • Lamp voltages and gains 2.2.7.1 Cuvette Arm Adjustment tools needed: • a cuvette without hook in loader, incubator pos. 1 and 6. • a feeler gauge (886650) 1. Cuvette arm adjustment positions: • Loader position • Incubator position • Cuvette exit position Cuvette loader position: • Insert a cuvette without hook to the loader. The adjustment is valid when you can hardly move the feeler gauge (0.1mm) from the space between the cuvette rear end and the loader wall. Incubator position: • The adjustment is valid when you can hardly move the feeler gauge (0.1 mm) from the space between the cuvette rear end and the incubator wall. November 2, 2003 48953054-4081 Konelab Service Manual 2-66 Adjustments Version I Cuvette exit position: • Adjust position 4 long steps ( Ý+S ) toward incubator and save adjustments. • Remove cuvettes without hook from loader incubator positions 1 and 6. • Insert cuvette to incubator position 1 and enter the Cuvette arm menu. In exit position, press the adjustment key ( A ) until you find the position where the cuvette will drop to the waste compartment. • Adjust 30 steps more ( key A ) or 3 long steps (shift Ý+A) from the dropping point. 2.2.7.2 Filter Disk / Beam Alignment • When filter disk / beam alignment is selected, the instrument first drives the filter wheel into its empty position (15). • Adjust the light spot over the fiber bundle. (refer to figure below). Adjustment is done by the adjustment screws in the lamp assembly. Light spot Fiber bundle Filter wheel filter position 1 • Adjust filter wheel that the lamp beam is in the middle of the 1 filter cover. Note! After filter wheel adjustment procedure QC run is recommended ! Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-67 2.2.7.3 Measuring Positions Quit to adjustment program main menu to fetch a new cuvette to incubator position 1 (refer section 2.2.2 ) Return back to measuring unit / Measuring positions. Measuring positions: • Instrument adjusts positions automatically. • Program finds cuvette cell walls starting from rear end of cuvette (=position 12) and sets the value to the middle of the cell one by one. (In software 5.0.X or lower). • Program finds cuvette cell walls starting from front end of cuvette (=position 1) and sets the value to the middle of the cell one by one. (In software 6.0.X). • After adjustment is seen old and new values and asked: Save new values YES/NO. If adjustment fails, it stops and gives an error message. 2.2.7.4 Lamp Voltages and Gains The lamp voltages and gains are adjusted automatically during Start up. Note! Results what are seen in this function are from the latest Start up. Gain values are: 0, 1, 2, 3, 4, 5. When gain is low the filter is good. With 340 and 380 the gain is usually 2 or 3. All the rest filter gains are usually 0, 1 or 2. If the gain is 5, filter or lamp is getting old or beam alignment is bad or blocked. Note! The lamp voltage is 0 when the filter position has a cover plate. November 2, 2003 48953054-4081 Konelab Service Manual 2-68 2.2.8 2.2.8.1 Adjustments Version I Dispensing Unit Dispenser Dispenser adjustment positions are: 1. General positions • Phi drive level position • Needle check position • Manual needle wash position • Wash position • Extra wash position • Resting position • Reagent wash position • Reagent extra wash position 2. Cuvette positions 3. Reagent positions 4. STAT positions, all 6 5. Standard / Control positions, all 40 6. Segment positions • Outer ring, position 10 for all 6 segments • Inner ring, position 3 for all 6 segments • Sample tube in position 11 for the segment position 1 7. KUSTI segment positions 8. Test wash 1. General positions Phi drive level position: • Adjust dispenser needle tip 2 - 3 mm above the cuvette loader / incubator cover, where the dispenser moves. Needle check position: • The needle check position is over the right edge of the sample side washing station. Adjust the needle tip to the washing station top surface level. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-69 Manual needle wash position: Phi-movement: • Adjust needle to the middle of the resting position. 'LYLGLQJSDUWLWLRQ :DVKSRVLWLRQ 5HVWLQJSRVLWLRQ ([WUDZDVK SRVLWLRQ Wash position: • Move the needle over the dividing partition. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the dividing partition. • Adjust 3 steps up W ( Ý ) from the partition. Phi-movement: • Adjust back to the middle of the wash position 'LYLGLQJSDUWLWLRQ :DVKSRVLWLRQ 5HVWLQJSRVLWLRQ ([WUDZDVK SRVLWLRQ Extra wash position: Phi movement: • Adjust to the middle of the extra wash position. Wash position Y-movement adj. value is used in Extra wash position. November 2, 2003 48953054-4081 Konelab Service Manual 2-70 Adjustments Version I Resting position: • Dispenser arm is adjusted about 1 mm above the stick. Adjust the Phi-movement to the middle of the resting position. Reagent wash positions: • Move the needle over the dividing partition. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the dividing partition. Adjust 3 steps up W ( Ý ) from the partition. Phi-movement: • Adjust back to the middle of the wash position. Reagent extra wash position: Phi movement: • Adjust to the middle of the extra wash position. • Wash position Y-movement adj. value is used in Extra wash position. • Save adjustments y/n? • Test washing positions by choosing the point 8 Test wash. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-71 2. Cuvette positions • Cuvette cell 1 upper position • Cuvette cell 1 position • Cuvette cell 12 position Adjustment tools needed: • cuvettes in incubator positions 1 and 6. (Use function 9: Fetch new cuvette to incubator instead of putting cuvettes manually into positions.) Note! Incubator is adjusted only in positions: cuvette cell 1 upper, cuvette cell 1 Cuvette cell 1 upper position (Incubator position 1) Phi-movement: • Adjust dispenser needle to the middle of the cuvette cell 1. Incubator: • Adjust incubator that needle is in the middle of the cuvette cell 1. Y-movement: • Adjust the needle tip 1 mm under the cuvette top surface. Cuvette cell 1 position (Incubator position 1) Phi-movement: • Adjust dispenser needle to the middle of the cuvette cell 1. Incubator: • Adjust incubator that needle is in the middle of the cuvette cell 1. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the bottom of the cuvette. • Adjust 3 steps up W ( Ý ) from the bottom. November 2, 2003 48953054-4081 Konelab Service Manual 2-72 Adjustments Version I Cuvette cell 12 position (Incubator position 1) Phi-movement: • Adjust dispenser needle to the middle of the cuvette cell 12. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the bottom of the cuvette. • Adjust 3 steps up W ( Ý ) from the bottom. When the cuvette cell positions 1 and 12 have been adjusted, the program asks if the user wants all other positions to be calculated before adjustment: Calculate middle cuvette positions before adjusting them? y/n Choose Yes. Positions 2 to 11 can be adjusted separately. Cuvette cell positions in incubator position 6 are adjusted in a similar way. Save adjustments y/n. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-73 3. Reagent positions Note! • Take reagent cover off. • Insert 20ml reagent bottles into the reagent plate positions 1, 12, 23 and 35. • Each reagent bottle position has an own bottom adjustment value. Reagent disk position cups Phi-movement: • Adjust dispenser needle to middle of the bottle neck. Reagent disk: • Adjust disk so that the needle is in middle of the bottle neck. Y-movement: • Press Z ( ß ) to find the position when the needle is touching the bottom of the bottle. • Adjust 4 steps up W ( Ý ) from the bottom. Positions 12, 23 and 35: • Check Y-movement 4 steps up from the bottom. Save adjustments y/n? Note! Sample disk has four (4) types of circles for samples: • STAT (1-6) • Cal/Ctrl (40) • Segment outer (7-14) • Segment inner (1-6) • (KUSTI segment rings 1 to 5) Dispenser has only one Y- and Phi- adjustment value for all positions in one circle. November 2, 2003 48953054-4081 Konelab Service Manual 2-74 Adjustments Version I 4. STAT positions Note! Take sample cover off and insert 0.5ml cups into the STAT positions. Phi-movement: • Adjust dispenser needle to the middle of sample cup. Sample disk: • Adjust disk so that the needle is in the middle of the sample cup. Y-movement: • Press Z ( ß ) to find the position when the needle is touching the sample cup bottom. • Adjust 2 steps up W ( Ý ) from the bottom. When the first STAT position has been adjusted the program asks if the user wants all other 5 STAT positions to be calculated: Calculate other STAT positions before adjusting them? y/n Choose Yes. Check all STAT positions one by one that the needle goes to the middle of the cup without touching the cup bottom. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-75 5. Standard / Control positions Note! Insert 0.5ml cups into the ISE PRIME, C10, S0 and S10 positions and place the sample disk cover and STD/CTRL plastic cover on. Phi-movement: • Adjust the dispenser needle to the middle of sample cup. Sample disk: • Adjust disk so that the needle is in the middle of the sample cup. Y-movement: • Press Z ( ß ) to find the position where the needle is touching the sample cup bottom. • Adjust 2 steps up W ( Ý ) from the bottom. When the ISE wash/prime position has been adjusted the program asks if the user wants all other Std / Ctrl positions to be calculated: Calculate other Std / Ctrl positions before adjusting them? y/n Choose Yes. Check in Std /Ctrl sample positions C10, S0 and S10 the needle goes into the middle of the cup without touching the cup bottom. Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-76 Adjustments Version I 6. Segment positions Note! • Take sample cover off. • Insert 0.5ml cups into the segment positions 3 and 10 and a sample tube into the position 11. • Insert segment to the sample disk position 1. • Insert second segment with cups in positions 3 and 10 to sample disk position 2. Cup position 10 adjustment: Phi-movement: • Adjust the dispenser needle into the middle of sample cup. Sample disk: • Adjust disk that the needle is in the middle of the sample cup. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the sample cup bottom. • Adjust 3 steps up W ( Ý ) from the bottom. Cup position 3 is adjusted in a similar way. Tube bottom level in the position 11: • Press Z ( ß ) and find the position when the needle is touching the tube bottom. • Adjust as many steps up W ( Ý ) from the bottom as is reasonable. When the first segment has been adjusted the program asks if the user wants that all other 5 segment positions are calculated: Calculate other segment positions before adjusting them? y/n Choose Yes. Check all segments positions 3 and 10 one by one that the needle goes into the middle of the cup without touching the cup bottom. Tube bottom level is adjusted only once in disk position 1. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-77 7. KUSTI segment positions Note! • Take sample cover off and insert KUSTI segments into the sample disk position 1 and 2 Ring5 Cup 1 Ring4 Cup 17 Ring3 Cup 35 Ring2 Cup 53 Ring1 Cup 73 Phi-movement: • Adjust the dispenser needle into the middle of the ring 1 cup position 73. Sample disk: • Adjust disk that the dispenser needle is in the middle of the ring 1 cup position 73. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the bottom. • Adjust 3 steps up W ( Ý ) from the bottom. Ring2 /cup 53 , ring3 / cup35 , ring4 / cup17 and ring5 / cup1 are adjusted in a similar way. When all positions in the first segment has been adjusted the program asks if the user wants that all other segment positions are calculated: Calculate other segment positions before adjusting them y/n? Choose Yes. All other segment positions 2 - 6 are adjusted in a similar way. Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-78 Adjustments Version I 2.2.8.2 Mixer Sample mixer adjustment positions are: • General positions • Cuvette positions • Test mixing in cuvette Wash position 1. General positions Phi drive level: • Adjust mixer paddle tip 4 - 5 mm above the measuring channel black plastic cover, where the mixer moves. Check position: • Adjust the mixer paddle tip in the left edge of the washing station and to the top surface level of the washing station. Manual needle wash position: Phi-movement: • Adjust mixer paddle over the measuring channel. Y-movement: • Adjust mixer paddle tip 20 long steps above the surface of washing station Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-79 Wash position: Phi-movement: • Adjust mixer paddle to the middle of the washing position. Y-movement: • Adjust straight part of the paddle above the washing station as shown in figure below: Resting position: Phi-movement: • Adjust paddle to the middle of the wash position. Y-movement: • Adjust the mixer arm 1 mm above the stick. Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-80 Adjustments Version I 2. Cuvette positions Adjustment tools needed: • Cuvettes in incubator positions 1 and 6. Cuvette cell 1position: Phi-movement: • Adjust the mixer paddle to the middle of the cuvette cell. Incubator: • Adjust incubator so that paddle is in the middle of the cuvette cell. Y-movement: • Press Z ( ß ) to find the position where the paddle is touching the bottom of the cuvette. • Adjust 3 steps up W ( Ý ) from the bottom. • Press m button to check the mixing. Cuvette cell 12 position: Phi-movement: • adjust the mixer paddle to the middle of the cuvette cell. Y-movement: • Press Z ( ß ) and find the position when the paddle is touching the bottom of the cuvette. • Adjust 3 steps up W ( Ý ) from the bottom. • Press m button to check the mixing. After adjustment program asks if the user wants other positions to be calculated: Calculate middle cuvette positions before adjusting them y/n? Choose Yes. Positions 2 to 11can be adjusted separately. Cuvette positions in incubator position 6 is adjusted in a similar way. Save adjustments y/n? 9. Test mixing in cuvette: • Test mixing in all 12 cell positions in incubator positions 1 and 6. • If mixing is noisy, readjust Phi-position. Konelab Service Manual 48953054-4081 November 2, 2003 Version I 2.2.9 Adjustments 2-81 ISE Unit ISE dispenser adjustment positions are: 1.General positions • Phi drive level position • Needle check position • Manual needle wash position • Wash position • Resting position 2.STAT positions, all 6 Wash position Dividing partition Waste/ resting position 3.Standard / Control positions, all 40 4.Segment positions, • outer ring, position 10 for all 6 segments • inner ring, position 3 for all 6 segments • sample tube position 11 for the segment 1 7. KUSTI segment positions 8. Test wash Note! Sample disk has four (4) circles for samples: • -STAT (1-6) • -Std /Ctrl (40) • -Segment outer (8-14) • -Segment inner (1-7) (KUSTI segment rings 1 to 5) ISE dispenser has only one Y- and Phi- adjustment value for all positions in one circle. November 2, 2003 48953054-4081 Konelab Service Manual 2-82 Adjustments Version I 1. General positions Phi drive level position: • Adjust dispenser needle tip 3 - 4 mm above the sample disk cover where the ISE dispenser moves. Needle check position: • ISE needle check position is in the left edge of the washing station. Adjust needle tip to washing station top surface level. Manual needle wash position: Phi-movement: • Adjust to middle of the washing station and and sample storage Wash position: • Move the needle over the dividing partition. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the dividing partition. • Adjust 3 steps up W ( Ý ) from the partition. Phi-movement: • Adjust to the middle of the wash position. Waste position: • Adjust the needle to the middle of the waste position. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-83 Resting position: • Adjust dispenser arm about 1 mm above the stick. • Adjust the dispenser needle to the middle of the resting position. Save adjustments y/n? 2. STAT positions Note! Take sample cover off and insert 0.5ml cups into the STAT positions. Phi-movement: • Adjust dispenser needle into the middle of sample cup. Sample disk: • Adjust disk that the needle is in the middle of the sample cup. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the sample cup bottom. • Adjust 2 steps up W ( Ý ) from the bottom. When the STAT position 1 has been adjusted the program asks if the user wants that all other 5 STAT positions are calculated: Calculate all STAT positions before adjusting them? y/n Choose Yes. Check all STAT sample positions one by one that the needle goes to the middle of the cup without touching the cup bottom. Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-84 Adjustments Version I 3. Standard / Control positions Note! Insert 0.5ml cups into the ISE PRIME, C10, S0 and S10 positions and place the sample disk cover and STD/CTRL plastic cover on. Phi-movement: • Adjust dispenser needle into the middle of sample cup. Sample disk: • Adjust disk that the needle is in the middle of the sample cup. -Y-movement: • Press Z ( ß ) and find the position when the needle is touching the sample cup bottom. • Adjust 2 steps up W ( Ý ) from the bottom. When the ISE PRIME position has been adjusted the program asks if the user wants that all other positions are calculated: Calculate all other positions before adjusting them? y/n Choose Yes. Check STD/CTRL sample positions C10, S0 and S10 that the needle goes to the middle of the cup without touching the cup bottom. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-85 4. Segment positions Note! • Take sample cover off. • Insert 0.5ml cups into the segment positions 3 and 10 and a sample tube into the position 11. • Insert segment to the sample disk position 1. • Insert second segment with cups in positions 3 and 10 to sample disk position 2. Cup position 10 adjustment: -Phi-movement: • Adjust the dispenser needle into the middle of sample cup. Sample disk: • Adjust disk that the needle is in the middle of the sample cup. Y-movement: • Press Z (ß) and find the position when the needle is touching the sample cup bottom. • Adjust 2 steps up W ( Ý ) from the bottom. Cup position 3 is adjusted in a similar way. Tube bottom level in the position 11: • Press Z ( ß ) and find the position when the needle is touching the tube bottom. • Adjust as many steps up W ( Ý ) from the bottom as is reasonable. When positions in the first segment has been adjusted, the program asks if the user wants that all other positions are calculated: Calculate all other positions before adjusting them? y/n Choose Yes. Check all segments positions 3 and 10 one by one that the needle goes into the middle of the cup without touching the cup bottom. Tube bottom level is adjusted only once in segment 1. Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-86 Adjustments Version I 7. KUSTI segment positions Note! Take sample cover off and insert KUSTI segments into the sample disk positions 1 and 2. Ring5 Cup 1 Ring4 Cup 17 Ring3 Cup 35 Ring2 Cup 53 Ring1 Cup 73 Phi-movement: • Adjust the ISE dispenser needle into the middle of the ring 1 cup position 73. Sample disk: • Adjust disk that the ISE dispenser needle is in the middle of the ring 1 cup position 73. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the bottom. • Adjust 3 steps up W( Ý ) from the bottom. Ring2 /cup 53 , ring3 / cup35 , ring4 / cup17 and ring5 / cup1 are adjusted in a similar way. When all positions in the first segment has been adjusted the program asks if the user wants that all other segment positions are calculated: Calculate other segment positions before adjusting them y/n? Choose Yes. All other segment positions 2 - 6 are adjusted in a similar way. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-87 2.2.10 KUSTI Unit KUSTI dispenser adjustment positions are: 1. General positions • Phi drive level position • Needle check position • Manual needle wash position • Wash position • Extra wash position • Resting position 2. Sample transfer line position 8. KUSTI segment positions 9. Test wash Dividing partition Wash position Resting position Extra wash position 1. General positions Phi drive level: • Adjust dispenser needle tip 2 - 3 mm above the sample disk cover where the KUSTI dispenser moves. Needle check position: • The needle check position is in the right edge of the washing station. • Adjust the needle tip to the washing station top surface level. Manual needle wash position: Phi-movement: • Adjust the needle over the bottle of washing solution. November 2, 2003 48953054-4081 Konelab Service Manual 2-88 Adjustments Version I F Wash position: • Move the needle over the dividing partition. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the dividing partition. • Adjust 3 steps up W ( Ý ) from the partition Phi-movement: • Adjust to the middle of the wash position. Extra wash position: Phi movement: • Adjust to the middle of the extra wash position. Wash position Y-movement adj. value is used in Extra wash position. Resting position: • Dispenser arm is adjusted 1mm above the rubber . • Adjust the Phi-movement to the left side of washing station. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-89 2. Sample transfer line position: Note! This adjustment is done after connecting Konelab to Sample transfer line. Factory adjustment is over the left end cover. KUSTI dispenser sample transfer line position: Phi-movement: • Adjust KUSTI dispenser needle into the middle of the sample tube in the sample transfer line. Y-movement is not saved. This adjustment is made first to move dispenser over the sample transfer line without any danger of braking the needle. KUSTI dispenser sample transfer line position: Phi-movement: • Adjust KUSTI dispenser needle into the middle of the sample tube in the sample transfer line. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the tube bottom. • Adjust as many steps up W ( Ý ) from the bottom as is reasonable. November 2, 2003 48953054-4081 Konelab Service Manual 2-90 Adjustments Version I 8. KUSTI segment positions: Note! Take sample cover off and insert KUSTI segments into the sample disk positions 1 and 2. Ring5 Cup 1 Ring4 Cup 17 Ring3 Cup 35 Ring2 Cup 53 Ring1 Cup 73 Phi-movement: • Adjust the KUSTI dispenser needle into the middle of the ring 1 cup position 73. Sample disk: • Adjust disk that the KUSTI dispenser needle is in the middle of the ring 1 cup position 73. Y-movement: • Adjust dispenser needle halfway to the cup. Ring2 /cup 53 , ring3 / cup35 , ring4 / cup17 and ring5 / cup1 are adjusted in a similar way. When all positions in the first segment has been adjusted the program asks if the user wants that all other segment positions are calculated: Calculate other segment positions before adjusting them y/n? Choose Yes. All other segments 2 - 6 are adjusted in a similar way. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-91 2.2.11 Syringe Zero Position Syringe zero position adjustment must be done when complete syringe unit, stepper motor or opto has been changed. The instrument adjusts the zero position automatically. Error message 5065 "Syringes should be adjusted (adjustment program)" informs the user when syringe zero position adjustment should be done. 2.2.12 Saving and Restoring Adjustment Values 2.2.12.1 Saving Adj. Values to Floppy Disk 1. Connect display and keyboard to the internal PC. 2. If instrument is on - quit Konelab software by pressing E. - If instrument is off - boot the instrument. Select item 2. Command prompt from boot up menu by pressing the arrow key down ( ß ) once and after that pressing enter. 3. Insert formatted floppy disk to the floppy drive. Note! The floppy drive is upside down. 4. When in the screen is displayed C://x30, copy adjustment files to the floppy disk with command save_adj. 5. Remove the floppy disk from the drive. 6. Reboot the instrument. 2.2.12.2 Restoring Adj. Values from Floppy Disk 1. Connect display and keyboard to the internal PC. 2. Instrument is on - quit Konelab software by pressing E. - 3. Instrument is off - boot the instrument. Select item 2. Command prompt from boot up menu by pressing the arrow key down ( ß ) once and after that pressing enter. Insert the floppy disk containing the adjustment values to the floppy drive. - Note! Floppy drive is upside down. 4. When in the screen is displayed C://x30, load adjustment files from the floppy disk with command load_adj 5. Remove the floppy disk from the drive. 6. Reboot the instrument. November 2, 2003 48953054-4081 Konelab Service Manual 2-92 Konelab Service Manual Adjustments 48953054-4081 Version I November 2, 2003 Version I Adjustments 2.3 Adjustments of Konelab 20 2.3.1 General Keys in use 1-9 Y/N N I R A <-> S Shift + A <-> S Note! Keep CapsLock OFF when adjusting W <-> Z Shift + W <-> Z C <-> V Shift + C <-> V b Alternative keys ALT+89/ ALT+78 ALT+78 ALT+73 ALT+82 ALT+97 – ALT+115 A+65 – ALT+83 ALT+119 – ALT+122 ALT+87 – ALT+90 ALT+99 – ALT+118 ALT+67 – ALT+86 ALT+98 B ALT+66 T m ALT+84 ALT+77 Q ALT+81 2-93 Function Module selection To save / cancel changes Next Initialisation To restore old adjustment 1. Motor, Left <-> Right movement Left - Right with a long movement 2. Motor, Up <-> Down movement Up-Down with a long movement 3. Motor, Forward <-> Backward Forward - Backward with a long movement To read barcode in the reagent disk / sample disk. (In the sample disk, the segment barcode is read.) In the sample disk, segment and tube barcodes are read. Automatic BCR reading position adjustment To test mixing when adjusting dispenser cuvette positions. Quit Note! During adjustment program reagent cover can be taken off. Attach the cover back before quitting the adjustment program. Note! After each maintenance or adjustment procedure QC run is recommended ! November 2, 2003 48953054-4081 Konelab Service Manual 2-94 2.3.2 Adjustments Version I How to Start Adjusting ? • Open Konelab user interface: • Click Main -button • Press F8 -key (More) • Press F2 -key (Instr. Actions) • Press F8 (More) • Press F5 (Adjustment program) Note! Konelab 20 and the workstation is a pair. Adjustments of the analyser are valid only with the analyser’s own workstation. If the workstation must be changed, the analyser must be readjusted or analysers adjustments restored from floppy disk. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-95 Recommended order to adjust • • • • • • • Incubator Cuvette unit Measuring unit Reagent disk Sample disk Dispensing unit ISE unit Good to know • The instrument adjusts 'Syringe zero position' automatically. (refer section 2.2.9) • 'Fetch new cuvette to incubator position' is recommended to use when a cuvette has to be moved to the selected incubator position. (E.g. for adjustment of measuring positions in measuring unit (refer section 2.3.3.3)) Note! After each adjustment section program asks: "Save adjustments (y / n) ?" Press key Y (yes) to save adjustments automatically to workstation hard disk. Dispenser needles • Before the adjustment of dispensers, check that the arms of them are mechanically adjusted correctly. November 2, 2003 48953054-4081 Konelab Service Manual 2-96 2.3.3 Adjustments Version I Incubator Adjustment tools needed: • Cuvettes in every incubator position • Take plastic cover, incubator metal cover and black measuring channel cover off. Note! Cuvette arm is powerless during incubator adjustment. However it can be moved manually. Incubator adjustment positions are: • Cuvette arm positions Cuvette arm position 1: • Fetch manually cuvette with arm from incubator and check that the cuvette is not touching to guiding bearings. • Adjust incubator if needed . • Adjust other cuvette arm positions 2-6 in a similar way. • Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I 2.3.4 Adjustments 2-97 Cuvette Unit Cuvette unit adjustment positions are: • Pusher open position • Pusher position for cuvette fetch Note! Cuvette feeder must be empty for “Pusher open position” adjustment! Pusher open position: • Adjust pusher belt gear and the loader end belt gear to nearly touch each other. • Press pusher with fingers to see more clearly adjustment movement. Note! After adjustment: “Put one cuvette in the feeder and press space bar to continue” Pusher position for cuvette fetch: • First the program will automatically adjust the distance to cuvette sensing opto. • For example: On the screen is displayed text: "Adjusting pusher position for cuvette fetch, opto detected at -54947". Compare opto value to adjustment value and adjust 4-6 steps more from detection point. Adjustment absolute value must be bigger. • Fetch a cuvette manually from feeder and check that cuvette aligns straight with cuvette arm. • Readjust pusher if needed. • Press pusher down to see more clearly adjustment movement. • Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-98 2.3.5 Adjustments Version I Measuring Unit Measuring unit adjustment positions are: • Cuvette arm • Filter disk/ beam alignment • Measuring positions • Lamp voltages and gains 2.3.5.1 Cuvette Arm Adjustment tools needed: • Loader position adjustment: Cuvette without hook in loader and feeler gauge (886650) • Incubator positions 1 and 6: Metal cuvette in incubator pos.1 and 6 • Cuvette exit position: Normal cuvette 1. Cuvette arm adjustment positions: • Loader position • Incubator positions 1 and 6 • Cuvette exit position Cuvette loader position: • The adjustment is correct when you can hardly move the feeler gauge (0.1mm) from the space between the cuvette rear end and the loader wall. Incubator positions 1 and 6: • The adjustment is correct when the cuvette arm is touching softly the metal cuvette end without any gap. Konelab Service Manual 48953054-4081 No gap November 2, 2003 Version I Adjustments 2-99 Cuvette exit position: • Adjust cuvette arm 4 long steps ( Ý+S ) toward incubator and save adjustments. • Remove metal cuvettes from incubator positions 1 and 6. • Insert normal cuvette into incubator position 6 and start to adjust cuvette arm again from menu . In exit position, press the adjustment key ( A ) until you find the position where the cuvette will drop to the waste compartment. • Adjust 30 steps more ( key A ) or 3 long steps (shift Ý+A) from the dropping point. • Save adjustments y/n ? 2.3.5.2 Filter Disk / Beam Alignment • When filter disk / beam alignment is selected, the instrument will first drive the filter wheel to its empty position (15). • Adjust the light spot over the fiber bundle with the adjustment screws (2 pcs) in the lamp assembly. light spot screw Light spot Fiber bundle screw Filter wheel filter position 1 • Adjust filter wheel to center lamp beam to filter 1 cover. Note! After filter wheel adjustment procedure QC run is recommended! November 2, 2003 48953054-4081 Konelab Service Manual 2-100 Adjustments Version I 2.3.5.3 Measuring Positions Quit to adjustment program main menu to fetch a new cuvette to incubator position 1. Return back to Measuring unit / Measuring positions. Measuring positions: • Instrument adjusts positions automatically. • Program finds cuvette cell walls starting from rear end of cuvette (=position 12) and sets the value to the middle of the cell one by one. (In software 5.0.X or lower). • Program finds cuvette cell walls starting from front end of cuvette (=position 1) and sets the value to the middle of the cell one by one. (In software 6.0.X). • After adjustment the old and new values are displayed and asked: Save new values YES/NO. If adjustment fails, it stops and gives an error message. 2.3.5.4 Lamp Voltages and Gains The lamp voltages and gains are adjusted automatically during Start up. Results seen in this function are from the latest Start up. Note! Results what are seen in this function are from the latest Start up. Gain values are: 0, 1, 2, 3, 4, 5. When the gain is low the filter is good. With 340 and 380 the gain is usually 2 or 3. All the rest filter gains are usually 0, 1 or 2. If the gain is 5, filter or lamp is getting old or beam alignment is bad or blocked. Note! The lamp voltage is 0 when the filter position has a cover plate. Konelab Service Manual 48953054-4081 November 2, 2003 Version I 2.3.6 Adjustments 2-101 Reagent Disk Adjustment tools needed: • Empty 20 ml reagent bottle (not obligatory) Reagent disk adjustment position is: • Reagent plate segment / vial inserting position Vial inserting position: • Open vial / inserting cover and insert a reagent bottle into the reagent plate position 1. • Adjust reagent plate to middle of the hole in reagent storage cover. November 2, 2003 48953054-4081 Konelab Service Manual 2-102 2.3.7 Adjustments Version I Sample Disk Sample disk adjustment positions are: • Segment / vial inserting position, segments 1-6 • Barcode reader position, segments 1-6 • STAT sample cup inserting positions, 1-5, ISE wash/prime • Barcode reader position, STAT samples 1-5, ISE wash/prime Segment / vial inserting position segment position 1: • Insert segment into the sample disk position 1. • Adjust sample disk to middle of the hole in sample storage front side. Barcode reader position segment position 1: • Insert a segment with barcoded sample tubes into the sample disk position 1. • Press b to read the segment barcode. If reading is OK, no beep is heard. By adjusting the disk, find the both ends of the reading area until beep sound is heard. Count the steps from side to side and set the adjustment to the middle. Note! Good quality barcode stickers are needed. Automatic BCR adjustment: • After the segment barcode reading position is adjusted, the analyser will adjust the barcode reading positions automatically for all sample tubes. Press t to start adjustment. • Accept new adjustments y/n • You can check the segment and tube barcode readings. Press B (Shift + b). • When the first segment has been adjusted the program asks if the user wants that all other 5 segment positions are calculated: Calculate other segment positions before adjusting them? y/n Choose Yes. All other positions (2-6) are adjusted in a similar way. • Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-103 STAT cup 1 inserting position: • Insert a sample tube into the STAT sample position 1. • Adjust disk if needed. STAT cup 1 barcode reader position: • Insert barcoded sample tube into the STAT sample position 1. Press b to read the sample tube barcode. If reading is OK, no beep is heard. By adjusting the disk, find the both ends of the reading area until beep sound is heard. • Count the steps from side to side and set the adjustment to the middle. • When the STAT sample position 1 has been adjusted, the program asks if the user wants all other 5 STAT sample positions are calculated before adjustment: Calculate other STAT positions before adjusting them? y/n. choose Yes STAT sample inserting / barcode positions 2-6 are adjusted similar way. Position 6 is ISE wash /prime. Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-104 2.3.8 2.3.8.1 Adjustments Version I Dispensing Unit of Konelab 20, 20i Dispenser Dispenser adjustment positions are: 1. General positions • Phi drive level position • Needle check position • Manual needle wash position • Sample wash position • Sample extra wash position • Resting position 2. Cuvette positions 3. Reagent positions 4. STAT positions 6. Segment positions • Outer ring, position 10 for all 6 segments • Inner ring, position 3 for all 6 segments • Sample tube in position 11 for the segment position 1 8. Test wash Dividing partition Wash position Resting position Extra wash position 1. General positions Phi drive level position: • Adjust dispenser needle tip 3 - 4 mm above the reagent cover, where the dispenser moves. Needle check position: • The needle check position is over the right edge of the washing station. • Adjust the needle tip to the washing station top surface level. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-105 Manual needle wash position: Phi-movement: • Adjust needle over the resting position. Dispenser wash position: • Move the needle over the dividing partition. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the dividing partition. • Adjust 3 steps up W ( Ý ) from the partition Phi-movement: • Adjust back to the middle of the wash position. Dispenser extra wash position: Phi movement: • Adjust to the middle of the extra wash position. Wash position Y-movement adj. value is used in Extra wash position. Resting position: • Dispenser arm is adjusted about 1 mm above the stick. Adjust the Phi-movement to the middle of the resting position. Save adjustments y/n. Check the wash positions with the point 8 - Test wash. November 2, 2003 48953054-4081 Konelab Service Manual 2-106 Adjustments Version I 2. Cuvette positions in incubator positions 1 and 6 • Cuvette cell 1 upper position • Cuvette cell 1 position • Cuvette cell 12 position Adjustment tools needed: • cuvettes in incubator positions 1 and 6. (Use function 9: Fetch new cuvette to incubator instead of putting cuvettes manually into positions.) Note! Incubator is adjusted only in positions: cuvette cell 1 upper, cuvette cell 1 Cuvette cell 1 upper position (Incubator position 1) Phi-movement: • Adjust dispenser needle to the middle of the cuvette cell 1. Incubator: • Adjust incubator that needle is in the middle of the cuvette cell 1. Y-movement: • Adjust the needle tip 1 mm under the cuvette top surface. Cuvette cell 1 position (Incubator position 1) Phi-movement: • Adjust dispenser needle to the middle of the cuvette cell 1. Incubator: • Adjust incubator that needle is in the middle of the cuvette cell 1. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the bottom of the cuvette. • Adjust 3 steps up W ( Ý ) from the bottom. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-107 Cuvette cell 12 position (Incubator position 1) Phi-movement: • Adjust dispenser needle to the middle of the cuvette cell 12. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the bottom of the cuvette. • Adjust 3 steps up W ( Ý ) from the bottom. • Press m button to check the mixing When the cuvette cell positions 1 and 12 have been adjusted, the program asks if the user wants all other positions to be calculated before adjustment: Calculate middle cuvette positions before adjusting them? y/n Choose Yes. Positions 2 to 11 can be adjusted separately. Cuvette cell positions in incubator position 6 are adjusted in a similar way. Save adjustments y/n. November 2, 2003 48953054-4081 Konelab Service Manual 2-108 Adjustments Version I 3. Reagent positions Note! • Insert 20 ml reagent bottles into the reagent disk positions 1, 11, 21 and 31. • Each reagent bottle position have an own bottom adjustment value. Reagent disk position cups 1, 11, 21 and 31: Phi-movement: • Adjust dispenser needle to middle of the bottle neck. Reagent disk: • Adjust disk so that the needle is in middle of the bottle neck. Y-movement: • Press Z ( ß ) to find the position when the needle is touching the bottom of the bottle. • Adjust 4 steps up W ( Ý ) from the bottom. Note! Sample disk has three (3) types of circles for samples: • STAT (1-6) • Segment outer (7-14) • Segment inner (1-6) Dispenser has only one (1) Y- and Phi- adjustment value for all positions in one circle. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-109 4. STAT positions Note! Insert 0.5 ml cups into the STAT positions. Phi-movement: • Adjust dispenser needle to the middle of sample cup. Sample disk: • Adjust disk so the needle is in the middle of the sample cup. Y-movement: • Press Z ( ß ) to find the position when the needle is touching the sample cup bottom. • Adjust 2 steps up W ( Ý ) from the bottom. When the first STAT position has been adjusted the program asks if the user wants all other 5 STAT positions to be calculated: Calculate other STAT positions before adjusting them? y/n Choose Yes. Check all STAT positions one by one the needle goes to the middle of the cup without touching the cup bottom. Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-110 Adjustments Version I 6. Segment positions Note! • Insert 0.5ml cups into the segment positions 3 and 10 and a sample tube into the position 11. • Insert segment to the sample disk position 1. • Insert second segment with cups in positions 3 and 10 to sample disk position 2. Cup position 10 adjustment: Phi-movement: • Adjust the dispenser needle to the middle of sample cup. Sample disk: • Adjust disk so that the needle is in the middle of the sample cup. Y-movement: • Press Z ( ß ) to find the position when the needle is touching the sample cup bottom. • Adjust 3 steps up W ( Ý ) from the bottom. Adjust Cup position 3 in a similar way. Tube bottom level in the position 11: • Press Z ( ß ) to find the position when the needle is touching the tube bottom. • Adjust as many steps up W ( Ý ) from the bottom as is reasonable. (This adjustment is carried out with customers’ typical tubes !) When the first segment has been adjusted the program asks if the user wants all other 5 segment positions to be calculated: Calculate other segment positions before adjusting them? y/n Choose Yes. Check all segments positions 3 and 10 one by one the needle goes into the middle of the cup without touching the cup bottom. Tube bottom level is adjusted only once in disk position 1. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-111 2.3.9 Dispensing Unit of Konelab 20XT, 20XTi 2.3.9.1 Dispenser Dispenser adjustment positions are: 1. General positions • Phi drive level position • Needle check position • Manual needle wash position • Dispenser wash position (no.1) • Dispenser extra wash position (no.3) • Resting position (no. 2) • Reagent wash position (no. 6) • Reagent extra wash position (no. 4) 2. Cuvette positions 3. Reagent positions 4. STAT positions 6. Segment positions • Outer ring, position 10 for all 6 segments • Inner ring, position 3 for all 6 segments • Sample tube in position 11 for the segment position 1 8. Test wash 1 2 3 4 5 6 Dividing partitions 1. General positions Phi drive level position: • Adjust dispenser needle tip 2 - 3 mm above the cuvette loader / incubator cover, where the dispenser moves. Needle check position: • The needle check position is over the right edge of the sample side washing station. Adjust the needle tip to the washing station top surface level. November 2, 2003 48953054-4081 Konelab Service Manual 2-112 Adjustments Version I Dispenser manual needle wash position: Phi-movement: • Adjust needle to the middle of the resting position on sample side. Dispenser wash position: • Move the needle over the dividing partition. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the dividing partition. • Adjust 3 steps up W ( Ý ) from the partition. Phi-movement: • Adjust back to the middle of the dispenser wash position Dispenser extra wash position: Phi movement: • Adjust to the middle of the dispenser extra wash position. Dispenser wash position Y-movement adjustment value is used in dispenser extra wash position. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-113 Resting position: • Adjust dispenser arm about 1 mm above the stick end. • Adjust the Phi-movement to the middle of the resting position on sample side. stick end Reagent wash positions: • Move the needle over the dividing partition. Y-movement: • Press Z ( ß ) and find the position when the needle is touching the dividing partition. Adjust 3 steps up W ( Ý ) from the partition. Phi-movement: • Adjust back to the middle of the wash position. Reagent extra wash position: Phi movement: • Adjust to the middle of the reagent extra wash position. • Reagent wash position Y-movement adjustment value is used in reagent extra wash position. • Save adjustments y/n? • Test washing positions by choosing the point 8 Test wash. November 2, 2003 48953054-4081 Konelab Service Manual 2-114 Adjustments Version I 2. Cuvette positions • Cuvette cell 1 upper position • Cuvette cell 1 position • Cuvette cell 12 position Adjustment tools needed: • cuvettes in incubator positions 1 and 6. (Use function 9: Fetch new cuvette to incubator instead of putting cuvettes manually into positions.) Note! Incubator is adjusted only in positions: cuvette cell 1 upper, cuvette cell 1 Cuvette cell 1 upper position (Incubator position 1) Phi-movement: • Adjust dispenser needle to the middle of the cuvette cell 1. Incubator: • Adjust incubator so that needle is in the middle of the cuvette cell 1. Y-movement: • Adjust the needle tip 1 mm under the cuvette top surface. Cuvette cell 1 position (Incubator position 1) Phi-movement: • Adjust dispenser needle to the middle of the cuvette cell 1. Incubator: • Adjust incubator so that needle is in the middle of the cuvette cell 1. Y-movement: • Press Z ( ß ) to find the position when the needle is touching the bottom of the cuvette. • Adjust 3 steps up W ( Ý ) from the bottom. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-115 Cuvette cell 12 position (Incubator position 1) Phi-movement: • Adjust dispenser needle to the middle of the cuvette cell 12. Y-movement: • Press Z ( ß ) to find the position when the needle is touching the bottom of the cuvette. • Adjust 3 steps up W ( Ý ) from the bottom. When the cuvette cell positions 1 and 12 have been adjusted, the program asks if the user wants all other positions to be calculated before adjustment: Calculate middle cuvette positions before adjusting them? y/n Choose Yes. Positions 2 to 11 can be adjusted separately. Cuvette cell positions in incubator position 6 are adjusted in a similar way. Save adjustments y/n. November 2, 2003 48953054-4081 Konelab Service Manual 2-116 Adjustments Version I 3. Reagent positions Note! • Insert 20 ml reagent bottles into the reagent disk positions 1, 11, 21 and 31. • Each reagent bottle position have an own bottom adjustment value. Reagent disk position cups 1, 11, 21 and 31: Phi-movement: • Adjust dispenser needle to middle of the bottle neck. Reagent disk: • Adjust disk so that the needle is in middle of the bottle neck. Y-movement: • Press Z ( ß ) to find the position when the needle is touching the bottom of the bottle. • Adjust 4 steps up W ( Ý ) from the bottom. Note! Sample disk has three (3) types of circles for samples: • STAT (1-6) • Segment outer (7-14) • Segment inner (1-6) Dispenser has only one (1) Y- and Phi- adjustment value for all positions in one circle. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-117 4. STAT positions Note! Insert 0.5 ml cups into the STAT positions. Phi-movement: • Adjust dispenser needle to the middle of sample cup. Sample disk: • Adjust disk so the needle is in the middle of the sample cup. Y-movement: • Press Z ( ß ) to find the position when the needle is touching the sample cup bottom. • Adjust 2 steps up W ( Ý ) from the bottom. When the first STAT position has been adjusted the program asks if the user wants all other 5 STAT positions to be calculated: Calculate other STAT positions before adjusting them? y/n Choose Yes. Check all STAT positions one by one the needle goes to the middle of the cup without touching the cup bottom. Save adjustments y/n? November 2, 2003 48953054-4081 Konelab Service Manual 2-118 Adjustments Version I 6. Segment positions Note! • Insert 0.5ml cups into the segment positions 3 and 10 and a sample tube into the position 11. • Insert segment to the sample disk position 1. • Insert second segment with cups in positions 3 and 10 to sample disk position 2. Cup position 10 adjustment: Phi-movement: • Adjust the dispenser needle to the middle of sample cup. Sample disk: • Adjust disk so that the needle is in the middle of the sample cup. Y-movement: • Press Z ( ß ) to find the position when the needle is touching the sample cup bottom. • Adjust 3 steps up W ( Ý ) from the bottom. Adjust Cup position 3 in a similar way. Tube bottom level in the position 11: • Press Z ( ß ) to find the position when the needle is touching the tube bottom. • Adjust as many steps up W ( Ý ) from the bottom as is reasonable. (This adjustment is carried out with customers’ typical tubes !) When the first segment has been adjusted the program asks if the user wants all other 5 segment positions to be calculated: Calculate other segment positions before adjusting them? y/n Choose Yes. Check all segments positions 3 and 10 one by one the needle goes into the middle of the cup without touching the cup bottom. Tube bottom level is adjusted only once in disk position 1. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-119 2.3.9.2 Mixer Sample mixer adjustment positions are: • General positions • Cuvette positions • Test mixing in cuvette Wash position 1. General positions Phi drive level: • Adjust mixer paddle tip 4 - 5 mm above the measuring channel black plastic cover, where the mixer moves. Check position: • Adjust the mixer paddle tip in the left edge of the washing station and to the top surface level of the washing station. Manual needle wash position: Phi-movement: • Adjust mixer paddle over the measuring channel. Y-movement: • Adjust mixer paddle tip 20 long steps above the surface of washing station November 2, 2003 48953054-4081 Konelab Service Manual 2-120 Adjustments Version I Wash position: Phi-movement: • Adjust mixer paddle to the middle of the washing position. Y-movement: • Adjust straight part of the paddle above the washing station as shown in figure below: Resting position: Phi-movement: • Adjust paddle to the middle of the wash position. Y-movement: • Adjust the mixer arm 1 mm above the stick. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-121 2. Cuvette positions Adjustment tools needed: • Cuvettes in incubator positions 1 and 6. Cuvette cell 1position: Phi-movement: • Adjust the mixer paddle to the middle of the cuvette cell. Incubator: • Adjust incubator so that paddle is in the middle of the cuvette cell. Y-movement: • Press Z ( ß ) to find the position where the paddle is touching the bottom of the cuvette. • Adjust 3 steps up W ( Ý ) from the bottom. • Press m button to check the mixing. Cuvette cell 12 position: Phi-movement: • adjust the mixer paddle to the middle of the cuvette cell. Y-movement: • Press Z ( ß ) and find the position when the paddle is touching the bottom of the cuvette. • Adjust 3 steps up W ( Ý ) from the bottom. • Press m button to check the mixing. After adjustment program asks if the user wants other positions to be calculated: Calculate middle cuvette positions before adjusting them y/n? Choose Yes. Positions 2 to 11can be adjusted separately. Cuvette positions in incubator position 6 is adjusted in a similar way. Save adjustments y/n? 9. Test mixing in cuvette: • Test mixing in all 12 cell positions in incubator positions 1 and 6. • If mixing is noisy, readjust Phi-position. November 2, 2003 48953054-4081 Konelab Service Manual 2-122 Adjustments Version I 2.3.10 ISE Unit ISE dispenser adjustment positions are: Wash position 1. General positions • Phi drive level position • Needle check position • Wash position • Resting position 4. STAT positions Dividing partition Waste/ resting position 6. Segment positions, • outer ring, position 10 for all 6 segments • inner ring, position 3 for all 6 segments • sample tube position 11 for the segment 1 Note! Sample disk has three (3) circles for samples: • STAT (1-6) • Segment outer (7-14) • Segment inner (1-6) Dispenser has only one Y- and Phi- adjustment value for all positions in one circle. 1. General positions Phi drive level position: • Adjust dispenser needle tip 2 - 3 mm above the reagent cover where the ISE dispenser moves. Needle ISE dispenser check position: • ISE needle check position is in the left edge of the washing station. • Adjust needle tip to washing station top surface level. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-123 ISE dispenser wash position: • Move needle over the dividing partition. Y-movement: • Press Z ( ß ) to find the position when the needle is touching the dividing partition. • Adjust 3 steps up W ( Ý ) from the partition. Phi-movement: • Adjust back to the middle of the wash position. ISE dispenser waste position: • Adjust the needle to the middle of the washing position. Resting position: • Adjust dispenser arm about 1 mm above the stick. • Adjust the dispenser needle to the middle of the resting position. November 2, 2003 48953054-4081 Konelab Service Manual 2-124 Adjustments Version I 4. STAT positions Note! Insert 0.5 ml cups into the STAT positions. Phi-movement: • Adjust dispenser needle to the middle of sample cup. Sample disk: • Adjust disk so that the needle is in the middle of the sample cup. Y-movement: • Press Z ( ß ) to find the position when the needle is touching the sample cup bottom. • Adjust 2 steps up W ( Ý ) from the bottom. Check in all STAT sample positions one by one the needle goes to the middle of the cup without touching the cup bottom. Save adjustments y/n? Konelab Service Manual 48953054-4081 November 2, 2003 Version I Adjustments 2-125 6. Segment positions Note! Note! • Insert 0.5 ml cups into the segment positions 3 and 10 and a sample tube into the position 11. • Insert segment to the sample disk position 1. • Insert second segment with cups in positions 3 and 10 to sample disk position 2. • Sample disk has three (3) circles for samples: • STAT (1-6) • Segment outer (7-14) • Segment inner (1-6) Dispenser has only one Y- and Phi -adjustment value for all positions in one circle. Cup position 10 adjustment: -Phi-movement: • Adjust the dispenser needle to the middle of sample cup. Sample disk: • Adjust disk so that the needle is in the middle of the sample cup. Y-movement: • Press Z (ß) to find the position where the needle is touching the sample cup bottom. • Adjust 3 steps up W ( Ý ) from the bottom. Cup position 3 is adjusted in a similar way. Tube bottom level in the position 11: • Press Z ( ß ) to find the position where the needle is touching the tube bottom. • Adjust as many steps up W ( Ý ) from the bottom as reasonable. This adjustment is carried out with customers’ typical tubes ! November 2, 2003 48953054-4081 Konelab Service Manual 2-126 Adjustments Version I When positions in the first segment has been adjusted, the program asks if the user wants all other segments to be calculated: Calculate all other positions before adjusting them? y/n Choose Yes. Check in all segments’ positions 3 and 10 one by one needle goes into the middle of the cup without touching the cup bottom. Tube bottom level is adjusted only once in segment 1. Save adjustments y/n ? 2.3.11 Saving and Restoring Adjustment Values 2.3.11.1 Saving Adj. Values to Floppy Disk 1. Exit Konelab software. 2. Insert formatted floppy disk to the workstation floppy drive. 3. Save adjustment files: Start Þ Programs Þ Konelab Instrument management Þ save adjustments 4. Remove the floppy disk from the drive. 2.3.11.2 Restoring Adj. Values from Floppy Disk 1. Exit Konelab software. 2. Insert floppy disk containing adjustment values to workstation floppy drive. 3. Restore adjustment files: Start Þ Programs Þ Konelab instrument management Þ restore adjustments 4. Remove the floppy disk from the drive Konelab Service Manual 48953054-4081 November 2, 2003 Version I 2.4 Adjustments 2-127 Konelab Dispenser Arms November 2, 2003 48953054-4081 Konelab Service Manual 2-128 Konelab Service Manual Adjustments 48953054-4081 Version I November 2, 2003 Version I November 2, 2003 Adjustments 48953054-4081 2-129 Konelab Service Manual Konelab Service Manual 48953054-4081 Attach Attach Thermo Clinical Labsystems Oy 1/1 Sample / Reagent Storage ISE Dispenser Name KONELAB 25 Opto Plate Positioning Konelab 25 Sample / Reagent Dispenser Sample / Reagent Mixer Scale Z Code Classif. Appr. Insp. Desig. P841995 4111 Rev. 07.06.2001 ARen 25.04.2002 SK 22.04.2002 JN 2-130 Adjustments Version I November 2, 2003 Version I Cable Charts 3-1 Section 3 Cable Charts Konelab 60, 60i 840800 J 840800 J 840800 J 840800 J 840800 J 840800 J 840800 J 840800 J 840800 J 840800 J 840800 J 840800 J 840800 J 840800 J 840800 J 840800 J 840800 J 840800 J 840800 J 840800 J Page Block diagram Racks Power, can and fan cables Connector panel and power unit Dispensers Mixers Syringes and pumps Cuvette unit Storages Incubator and dispensing units Lamp house and water detectors Batteries Internal pc (master) Motor Temp Photo INOUT ISE Powcan Cover leds page 3-5 page 3-6 page 3-7 page 3-8 page 3-9 page 3-10 page 3-11 page 3-12 page 3-13 page 3-14 page 3-15 page 3-16 page 3-17 page 3-18 page 3-19 page 3-20 page 3-21 page 3-22 page 3-23 page 3-24 Konelab 60, 60i with Kusti page 841499 F 841499 F 841499 F 841499 F 841499 F 841499 F 841499 F 841499 F 841499 F 841499 F 841499 F 841499 F 841499 F 841499 F 841499 F 841499 F 841499 F 841499 F 841499 F 841499 F 841499 F page 3-25 page 3-26 page 3-27 page 3-28 page 3-29 page 3-30 page 3-31 page 3-32 page 3-33 page 3-34 page 3-35 page 3-36 page 3-37 page 3-38 page 3-39 page 3-40 page 3-41 page 3-42 page 3-43 page 3-44 page 3-45 November 2, 2003 Block diagram Racks Power, can and fan cables Connector panel and power unit Dispensers Mixers Kusti Syringes and pumps Cuvette Unit Storages Incubator And Dispensing Units Lamp house and water detectors Batteries Internal PC (Master) Motor Temp Photo INOUT ISE Powcan Cover leds 48953054-4081 Konelab Service Manual 3-2 Cable Charts Konelab 30, 30i 840 837 C 840 837 C 840 837 C 840 837 C 840 837 C 840 837 C 840 837 C 840 837 C 840 837 C 840 837 C 840 837 C 840 837 C 840 837 C 840 837 C 840 837 C 840 837 C 840 837 C 840 837 C 840 837 C Version I Page Block diagram Racks Power, can and fan cables Connector panel power unit Dispensers Mixer Syringes and pumps Incubator and measuring channel Storages Lamp house and water detectors Batteries Internal PC (Master) Motor Temp Photo INOUT ISE Powcan Covers page 3-47 page 3-48 page 3-49 page 3-50 page 3-51 page 3-52 page 3-53 page 3-54 page 3-55 page 3-56 page 3-57 page 3-58 page 3-59 page 3-60 page 3-61 page 3-62 page 3-63 page 3-64 page 3-65 Konelab 30, 30i with Kusti page 841 498 841 498 841 498 841 498 841 498 841 498 841 498 841 498 841 498 841 498 841 498 841 498 841 498 841 498 841 498 841 498 841 498 841 498 841 498 841 498 page 3-67 page 3-68 page 3-69 page 3-70 page 3-71 page 3-72 page 3-73 page 3-74 page 3-75 page 3-76 page 3-77 page 3-78 page 3-79 page 3-80 page 3-81 page 3-82 page 3-83 page 3-84 page 3-85 page 3-86 Konelab Service Manual Block diagram Racks Power, can and fan cables Connector panel and power unit Dispensers Mixer Kusti Syringes and pumps Incubator and measuring channel Storages Lamp house and water detectors Batteries Internal PC (Master) Motor Temp Photo INOUT ISE Powcan Covers 48953054-4081 November 2, 2003 Version I Cable Charts 3-3 Konelab 30, (30i, Kusti) 981850, 981851, 981860, 981861 page 841 854 B 841 854 B 841 854 B 841 854 B 841 854 B 841 854 B 841 854 B 841 854 B 841 854 B 841 854 B 841 854 B 841 854 B 841 854 B 841 854 B 841 854 B 841 854 B 841 854 B 841 854 B 841 854 B 841 854 B page 3-87 page 3-88 page 3-89 page 3-90 page 3-91 page 3-92 page 3-93 page 3-94 page 3-95 page 3-96 page 3-97 page 3-98 page 3-99 page 3-100 page 3-101 page 3-102 page 3-103 page 3-104 page 3-105 page 3-106 Block Diagram Racks Power, can and fan cables Connector panel and power unit Dispensers Mixer Kusti Syringes and pumps Incubator and measuring channel Storages Lamp house and water detectors Batteries Internal PC (master) Motor Temp Photo INOUT ISE POWCAN Covers Konelab 20, 20i 841 490 B 841 490 B 841 490 B 841 490 B 841 490 B 841 490 B 841 490 B 841 490 B 841 490 B 841 490 B 841 490 B 841 490 B 841 490 B 841 490 B 841 490 B 841 490 B November 2, 2003 Page Block Diagram Racks Power, can and fan cables Connector panel power unit Dispensers Syringes and pumps Incubator and measuring channel Storages Lamp house and water detectors Motor Temp Photo INOUT ISE CANBIAS Covers 48953054-4081 page 3-107 page 3-108 page 3-109 page 3-110 page 3-111 page 3-112 page 3-113 page 3-114 page 3-115 page 3-116 page 3-117 page 3-118 page 3-119 page 3-120 page 3-121 page 3-122 Konelab Service Manual 3-4 Cable Charts Version I Konelab 20XT, 20XTi Page 841 993 A 841 993 A 841 993 A 841 993 A 841 993 A 841 993 A 841 993 A 841 993 A 841 993 A 841 993 A 841 993 A 841 993 A 841 993 A 841 993 A 841 993 A 841 993 A 841 993 A page 3-123 page 3-124 page 3-125 page 3-126 page 3-127 page 3-129 page 3-129 page 3-130 page 3-131 page 3-132 page 3-133 page 3-134 page 3-135 page 3-136 page 3-137 page 3-138 page 3-139 Konelab Service Manual Block Diagram Racks Power, can and fan cables Connector panel power unit Dispensers Mixer Syringes and pumps Incubator and measuring channel Storages Lamp house and water detectors Motor Temp Photo INOUT ISE CANBIAS Covers 48953054-4081 November 2, 2003 NIMI NAME CABLE CHART / BLOCK DIAGRAM KORVATTU REPLACED KORVAA REPLACES Konelab 60, 60i 840758 - 4152 1 / 20 LIITTYY ASSOCIATES position feedback LEHTI SHEET MOTOR * 28 (* 33 in 60i) j a limit switches 123Konelab CAN BUS MUUTOS REVISIONS Windows NT Termination LIITTYY ASSOCIATES WORKSTATION MERKKI MARK Sis„inen PC-lohko p„ivitetty. Block Internal PC updated. 60i :n kortit merkitty. 60i boards marked. ANALYZER SURF * 2 (*3 in 60i) 4101 J LAJI CLASSIF. 840800 KOODI CODE Z HYV. APPR. SUHDESCALE M-FILMI M-FILM HYV. APPR. TEKI DRAWN PVM DATE TARK. CHECKED ARen JHen 04.02.03 18.3.98 22.1.98 JHen 23.1.98 JHen 23.1.98 JN 3-5 ECO00384 JN Cable Charts PIIRT. DRAWN Version I +28V Ethernet PCCAN - CAN interface - termination thermistors TEMP * 2 (* 3 in 60i) - heatings - 2 channels +28V INTERNAL PC (MASTER) - ATA-module, floppy disk - controls all nodes via CAN BUS MAINS INPUT + 28V PHOTSIG *1 PHOTO * 1 - ADC - lamp control - chopper drive PHOTREF *1 POWCAN *1 - power supply monitoring - battery control - CAN-bus bias - coolings +28V POWER control status - mains switch - line filter - 100 - 240 VAC input - 28 VDC output MODULE +28V +28V Batteries ISEAMP * 1 ISE * 1 (only in 60i) - ADC - liquid detection limit switches INOUT * 2 - digital I/O - analog inputs - RS232 interfaces - LED, button etc. interfaces +28V LEDS +28V RS232 Bar code readers Figure 3-1 Konelab 60, 60i Cable chart / Block diagram (60,60i) November 2, 2003 48953054-4081 Konelab Service Manual RACK1 Konelab Service Manual JP7 JP5 JP3 JP1 TP1 JP8 JP6 JP4 JP2 XP1 16 INOUT 1 52 ROTATION UNIT 51 CUVETTE PUSHER 50 CUVETTE MOVER 49 FRONT LATCH 48 TEMP 2 48953054-4081 XP5 80 SAMPLE STORAGE XP7 81 SEGMENT FEEDER XP4 JP8 JP6 JP4 JP2 82 FILTER DISK XP6 TP1 54 S DISPENSER Y JP7 JP5 JP3 JP1 55 S MIXER WASH XP3 56 S DILUENT PUMP XP10 2 / 20 KORVAA REPLACES NIMI NAME CABLE CHART / RACKS LIITTYY ASSOCIATES MUUTOS REVISIONS Konelab 60, 60i 840758 - 4152 XP13 XP11 XP13 XP11 TEKI DRAWN JHen KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDESCALE PVM DATE 18.3.98 HYV. APPR. JN M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN Cable Charts KORVATTU REPLACED LEHTI SHEET LIITTYY ASSOCIATES 60i :n kortit merkitty. 60i boards marked. 123Konelab MERKKI MARK a 67 ISE WASH 5 XP12 XP9 XP8 XP7 XP6 68 ISE SYRINGE XP11 4 XP5 XP9 XP8 69 ISE DILUENT PUMP XP4 MB1-9 XP7 70 TEMP 3 XP2 XP13 JP8 JP6 JP4 JP2 XP1 64 S SYRINGE XP9 TP1 XP2 65 ISE Y XP8 JP7 JP5 JP3 JP1 XP3 66 ISE XP7 ONLY IN 60i 71 ISE MB1-3 XP6 53 S DISPENSER XP5 3 17 R DILUENT PUMP MB1-9 18 R MIXER WASH F XP4 22 R DISPENSER Y XP3 23 R MIXER F XP2 32 R MIXER Y XP10 XP12 JP8 JP6 JP4 JP2 33 R DISPENSER UNIT F XP1 XP13 TP1 34 MEAS CHANNEL XP11 JP7 JP5 JP3 JP1 XP6 XP4 35 INCUBATOR XP3 2 XP5 36 S MIXER XP2 MB1-9 37 S MIXER XP1 38 S MIXER Y 72 INOUT 2 XP10 JP8 JP6 JP4 JP2 XP8 39 S DISPENSER UNIT XP12 TP1 XP9 24 R MIXER XP7 40 TEMP 1 XP10 XP12 JP7 JP5 JP3 JP1 XP6 XP4 19 R SYRINGE XP3 1 XP5 20 R STORAGE XP2 MB1-9 21 R DISPENSER XP1 3-6 Version I F 126 PHOTO 124 POWCAN F RACK3 RACK2 Figure 3-2 Racks (60,60i) November 2, 2003 XP3 28V 48953054-4081 XP12 XP13 28V XP11 CAN 28V CAN 28V XP12 CAN XP10 GND MB 1-9 2 24V K39 K41 XP13 28V XP11 CAN K47 K32 HOLDER R1 GND + XP224V +28V + 28V XP1 CAN K30 CAN CAN XP7 XP6 K48 K33 PHOTO November 2, 2003 K43 28V XP12 CAN XP10 K34 K35 K31 K40 K42 K375 MB 1-9 3 28V FROM POWER 28V FROM POWER 28V 24V GND K147 POWCAN XP7 FANS IN BACK PANEL K44 K36 GND FROM POWER K146 POWCAN XP3 K38 K37 CAN K27 XP13 28V j KORVAA REPLACES KORVATTU REPLACED NIMI NAME LIITTYY ASSOCIATES LEHTI SHEET 3 / 20 LIITTYY ASSOCIATES 123Konelab CAN Konelab 60, 60i 840758 - 4152 CABLE CHART / POWER, CAN AND FAN CABLES CAN XP4 28V 28V KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN TEKI DRAWN ARen M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN HYV. APPR. ECO 00384 XP4 SUHDE SCALE PVM DATE 04.02.03 XP13 XP11 CAN XP6 5 XP7 K31 XP5 28V MB 1-3 MB 1-9 4 CAN K29 MUUTOS REVISIONS 28V XP12 CAN XP10 K31 K375 lis„tty, K375 added 28V CAN PC FAN K46 K45 STORAGE SAMPLE MERKKI MARK XP11 CAN CAN K28 POWCAN XP2 MB 1-9 1 CAN TERMINATION XP10 REAGENT STORAGE K145 28V XP8 Version I Cable Charts 3-7 Figure 3-3 Power, can and fan cables (60,60i) Konelab Service Manual 48953054-4081 K374 black black L 6 5 red K74 F1 yellow-green K72 N Brown 4 K213 red S1 3 Yellow yellow-green 2 1 red K70 1 2 K379 K73 red black TO INTERNAL PC black FILTER red K75 (ETHERNET) WORK STATION TO FRAME Green White Inhibit 6 L N PE POWER UNIT + K71 + + CONNECTOR PANEL + - Konelab Service Manual + 1 Mainsfail - 4 / 20 KORVAA REPLACES MUUTOS REVISIONS 4 HYV. APPR. KOODI CODE LAJI CLASSIF. SUHDE SCALE Z HYV. APPR. TARK. CHECKED M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN TEKI DRAWN PVM DATE PIIRT. DRAWN JN JN B™ JN ECO 00384 JN ARen JHen JHen ARen 9.8.02 13.02.02 2.3.01 18.3.98 23.01.03 POWCAN RE2/B BATTERY 4- BATTERY 2- CHASSIS CHASSIS XP1 (Holder) XP1 (Holder) POWCAN XP4 Brown Konelab 60, 60i 840758 - 4152 NIMI NAME CABLE CHART / CONNECTOR PANEL AND POWER UNIT LIITTYY ASSOCIATES 3 POWCAN XP5 Yellow FRONT SWITCH S2 Cable Charts KORVATTU REPLACED LEHTI SHEET 123Konelab LIITTYY ASSOCIATES K57 kytkent„ muutettu. K57 connection changed. K57 lis„tty. K57 added. f a MERKKI MARK Tehol„hde vaihdettu, K374 lis„tty, K68 -> K379,K361->K377, K362-->K378 Power Supply Unit changed, K374 added, K68 -> K379, K361-->K377, K362-->K378 K361, K362 kytkent„ muutettu / connection changed. K69-->K361, K57-->K362 j K54 K52 K51 K38 K37 K35 K34 K378 h g Mainsfail + White K377 3-8 Version I Figure 3-4 Connector panel and power unit (60,60i) November 2, 2003 November 2, 2003 XP3 SURF XP2 XP1 K89 f -OPTO 48953054-4081 DISP. f MB 1-9 (1) MOTOR ID 22 REAGENT DISP. Y K101 MOTOR ID 21 REAGENT K88 XP7 XP2 XP5 K115 Y-MOV HEDS f -MOV XP7 XP2 XP5 K102 Y -OPTO REAGENT DISPENSER OPTO K201 XP3 SURF XP2 XP1 K26 TO CHASSIS K104 K116 Y -OPTO DISP. f MOTOR ID 53 SAMPLE K103 MOTOR ID 54 SAMPLE DISP. Y XP7 XP2 XP5 K90 Y-MOV HEDS f -MOV MB 1-9 (3) XP7 XP2 XP5 K91 f -OPTO SAMPLE DISPENSER OPTO K11 K10 K183 K105 (only in 60i) MOTOR ID 65 ISE DISP. Y XP7 XP2 XP5 K92 Y -OPTO f -OPTO K26 TO CHASSIS K185 K106 f a KORVAA REPLACES 5 / 20 KORVATTU REPLACED LEHTI SHEET K183 (only in 60i) TEMP3 ID 70 ISE XP2 NIMI NAME XP3 MUUTOS REVISIONS Konelab 60, 60i 840758 - 4152 CABLE CHART / DISPENSERS LIITTYY ASSOCIATES LIITTYY ASSOCIATES 60i :n kortit merkitty. 60i boards marked. 123Konelab MERKKI MARK K117 MB 1-9 (4) (only in 60i) DISP. MOTOR ID 66 ISE XP7 XP2 XP5 K93 Y-MOV HEDS f -MOV K182 XP2 SURF K181 ISE DISPENSER XP1 ISEAMP K184 K190 JN HYV. APPR. KOODI CODE LAJI CLASSIF. SUHDESCALE Z HYV. APPR. TARK. CHECKED M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN JHen TEKI DRAWN PIIRT. DRAWN 18.3.98 XP4 PVM DATE (only in 60i) ISE ID 71 XP2 MOTOR ID 69 ISEDILP XP3 (only in 60i) OPTO Version I Cable Charts 3-9 Figure 3-5 Dispensers (60,60i) Konelab Service Manual Konelab Service Manual 48953054-4081 XP2 K108 Y -OPTO MIXER f MOTOR ID 24 REAGENT K95 XP7 MB 1-9 (1) MOTOR ID 23 REAGENT MIXER XP7 K126 f -OPTO REAGENT MIXER 7 Y-MOV f -MOV MOTOR ID 32 REAGENT MIXER Y K94 K126 XP7 XP2 XP3 K107 1 7 1 CONN 1-8 XP2 XP2 K127 K128 OPTO MB 1-9 (2) MOTOR ID 36 SAMPLE MIXER K14 XP7 Y -OPTO MIXER MOTOR ID 37 SAMPLE f K97 K110 XP7 XP2 f -OPTO SAMPLE MIXER Y-MOV XP2 XP2 KORVAA REPLACES 6 / 20 NIMI NAME MUUTOS REVISIONS Konelab 60, 60i 840758 - 4152 CABLE CHART / MIXERS LIITTYY ASSOCIATES LIITTYY ASSOCIATES OPTO JN HYV. APPR. KOODI CODE LAJI CLASSIF. SUHDESCALE Z HYV. APPR. TARK. CHECKED M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN JHen TEKI DRAWN PIIRT. DRAWN 18.3.98 PVM DATE Cable Charts KORVATTU REPLACED LEHTI SHEET K13 K15 CONN -kortit lis„tty. CONN boards added. 123Konelab MERKKI MARK a MOTOR ID 38 SAMPLE MIXER Y K14 K96 XP7 XP2 XP3 K109 CONN 1-8 f -MOV XP1 7 CONN1-6 XP1 1 7 1 CONN1-6 XP1 XP1 3-10 Version I Figure 3-6 Mixers (60,60i) November 2, 2003 November 2, 2003 48953054-4081 XP2 K248 MOTOR ID 17 REAGENT DILUENT PUMP XP6 K247 MOTOR ID 18 REAGENT MIXER WASH XP7 MB 1-9 (1) K119 REAGENT K85 K98 XP2 MOTOR ID 19 REAGENT SYRINGE XP7 OPTO K250 XP2 MOTOR ID 56 SAMPLE DILUENT PUMP XP6 K249 MB 1-9 (3) MOTOR ID 55 SAMPLE MIXER WASH XP7 K121 XP7 K99 XP2 OPTO MOTOR ID 64 SAMPLE SYRINGE K86 SAMPLE K100 7 / 20 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET (only in 60i) Konelab 60, 60i 840758 - 4152 MUUTOS REVISIONS CABLE CHART / SYRINGES AND PUMPS NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES XP3 TEKI DRAWN KOODI CODE LAJI CLASSIF. SUHDE SCALE Z HYV. APPR. TARK. CHECKED M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN JN JN HYV. APPR. JHen JHen PVM DATE PIIRT. DRAWN 16.10.98 18.3.98 ISE ID 71 XP4 MOTOR ID 69 ISE DILUENT PUMP XP7 K122 Diluenttipumput muutettu. Diluent pumps changed. 60i :n kortit merkitty. 60i boards marked. 123Konelab MERKKI MARK b a MB 1-9 (4) (only in 60i) XP2 (only in 60i) XP7 MOTOR ID 68 ISE SYRINGE K87 K123 (only in 60i) MOTOR ID 67 ISE WASH K123 XP7 OPTO ISE Version I Cable Charts 3-11 Figure 3-7 Syringes and pumps (60,60i) Konelab Service Manual XP 2 48953054-4081 NN CO 1-6 1 (600) 2 XP XP 1 K282 1 XP XP2 XP7 XP3 XP2 7 XP7 XP2 XP7 XP9 MB 1-9 (3) XP3 MOTOR ID 51 CUVETTE PUSHER 7 K344 (600) 1 MOTOR ID 52 ROTATION UNIT XP7 MOTOR ID 50 CUVETTE MOVER (600) K244 (600) K283 XP2 XP2 MB 1-9 (1) NN CO 1-8 MOTOR ID 49 FRONT LATCH (500) K136 1 INOUT ID 16 (1500) K144 XP XP2 K138 K137 NN CO 1-6 1 XP1 CO N N 1 -6 2 XP CONN K135 K134 1 XP 1-6 7 (600) K142 K130 7 XP1 K143 K141 7 CO NN NN CO 1-6 1-6 Konelab Service Manual 1 XP XP 2 K131 K140 KORVAA REPLACES KORVATTU REPLACED MUUTOS REVISIONS CABLE CHART / CUVETTE UNIT Konelab 60, 60i 840758 - 4152 HYV. APPR. KOODI CODE LAJI CLASSIF. SUHDESCALE Z HYV. APPR. TARK. CHECKED M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN TEKI DRAWN PVM DATE PIIRT. DRAWN JN JN JN JN JHen JHen JHen JHen 20.09.99 19.06.99 16.10.98 18.3.98 Cable Charts NIMI NAME LIITTYY ASSOCIATES 8 / 20 LIITTYY ASSOCIATES LEHTI SHEET CONN -kortit lis„tty, K133 poistettu. CONN boards added, K133 removed. K344 ja CONN1-6 lis„tty. K344 and CONN1-6 added. K282, K283 ja 2kpl CONN1-6 lis„tty. K282, K283 and 2 pcs CONN1-6 added. K244 ja CONN1-6 lis„tty. K244 and CONN1-6 added. K139 123Konelab MERKKI MARK e d b a K76 K132 3-12 Version I 7 1 2 XP 1 XP4 1 Figure 3-8 Cuvette unit (60,60i) November 2, 2003 November 2, 2003 K216 POWCAN XP9 XP1 CONN 7 XP1 (600) 1 7 48953054-4081 K206 (600) K229 K124 K125 K114 K67 XP3 XP2 XP7 XP2 XP7 XP10 XP9 XP8 XP7 XP6 XP5 MB 1-3 (5) MOTOR ID 81 SEGMENT FEEDER K169 CUVETTE LOADER OPTO XP 2 (600) 7 K65 1 XP 1 CON N 1-6 INOUT ID 16 K111 K64 K112 a KORVAA REPLACES 9 / 20 KORVATTU REPLACED LEHTI SHEET 123Konelab MERKKI MARK K113 K215 NIMI NAME MUUTOS REVISIONS Konelab 60, 60i 840758 - 4152 CABLE CHART / STORAGES LIITTYY ASSOCIATES LIITTYY ASSOCIATES JN HYV. APPR. KOODI CODE LAJI CLASSIF. SUHDESCALE Z HYV. APPR. TARK. CHECKED M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN JHen TEKI DRAWN PIIRT. DRAWN 18.3.98 PVM DATE K215 POWCAN XP8 XP3 REAGENT STORAGE XP5 CONN -kortit lis„tty. CONN boards added. MOTOR ID 20 REAGENT STORAGE MB 1-9 (1) XP10 XP9 XP8 XP7 XP6 MOTOR ID 80 SAMPLE STORAGE K129 K66 K207 K143 K144 CUVETTE IN STORAGE OPTO HEDS XP7 MB 1-9 (4) 7 HEDS K63 XP2 INOUT ID 72 (600) XP 2 1 CO N 1 -6 N XP 1 K205 7 K60 XP2 1-6 CONN 1 CONN 1-6 (600) XP2 1-6 K59 K228 XP1 K62 XP4 K61 SAMPLE STORAGE Version I Cable Charts 3-13 XP2 1 Figure 3-9 Storages (60,60i) Konelab Service Manual Konelab Service Manual NN CO 1-6 O NN CO 1-6 7 1 NN 7 XP 1 K20 K6 K1 NN CO 1-6 1 2 XP 48953054-4081 2 XP XP2 XP7 XP2 XP7 XP2 XP7 XP4 XP3 MOTOR ID 35 INCUB. K5 XP5 K3 K7 K2 MOTOR ID 33 REAGENT DISP. UNIT XP7 XP5 MB 1-9 (2) K9 K4 XP2 MOTOR ID 34 MEAS. CHANNEL (600) 1 K242 MEAS. CHANNEL K210 REF. FOLIO K212 TEMP1 ID 40 K16 XP2 MOTOR ID 39 SAMPLE DISP. UNIT K8 1 XP (1500) 7 XP 2 C HEDS INCUBATOR Jumper JP1-JP2 K21 1 XP K19 a TEMP2 ID 48 10 / 20 KORVAA REPLACES NIMI NAME MUUTOS REVISIONS Konelab 60, 60i 840758 - 4152 CABLE CHART / INCUBATOR AND DISPENSING UNITS LIITTYY ASSOCIATES LIITTYY ASSOCIATES XP1 JHen TEKI DRAWN PVM DATE KOODI CODE LAJI CLASSIF. SUHDESCALE Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN 18.3.98 PHOTO ID 126 XP2 HYV. APPR. JN M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN Cable Charts KORVATTU REPLACED LEHTI SHEET K22 CONN -kortit lis„tty. CONN boards added. 123Konelab MERKKI MARK K83 K84 MB 1-9 (3) K148 REAGENT DISPENSING UNIT XP2 INOUT ID 16 (1500) K24 1 XP 16 K23 K211 SIG. XP4 MB 1-9 (1) (1500) K18 K17 SAMPLE DISPENSING UNIT 3-14 Version I XP4 XP5 7 XP5 XP5 2 XP 1 Figure 3-10 Incubator and dispensing units (60,60i) November 2, 2003 November 2, 2003 PHOTO ID 126 48953054-4081 XP5 XP4 XP3 K81 K241 (600) K79 K82 LAMP HOUSE XP2 CONN 1-6 1 XP1 7 CHOPPER MOTOR K80 XP2 MB 1-3 (5) MOTOR ID 82 FILTER DISK XP7 K78 K77 XP4 MB 1-3 (5) INOUT ID 72 XP3 K204 K203 WASTE c a KORVAA REPLACES KORVATTU REPLACED NIMI NAME Konelab 60, 60i 840758 - 4152 CABLE CHART / LAMP HOUSE AND WATER DETECTORS LEHTI SHEET 11 / 20 LIITTYY ASSOCIATES 123Konelab MUUTOS REVISIONS Lampputalon kuvaa muutettu. Lamphouse redrawn. CONN -korttI ja K241 lis„tty. CONN board and K241 added. LIITTYY ASSOCIATES MERKKI MARK DILUENT HYV. APPR. TEKI DRAWN KOODI CODE LAJI CLASSIF. SUHDESCALE Z HYV. APPR. TARK. CHECKED M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN JN JN JHen JHen PVM DATE PIIRT. DRAWN 10.2.99 18.3.98 Version I Cable Charts 3-15 Figure 3-11 Lamp house and water detectors (60,60i) Konelab Service Manual - +28V Konelab Service Manual + - K52 + - K51 + - RE2 POWER UNIT 48953054-4081 CABLE CHART / BATTERIES K49 KORVAA REPLACES KORVATTU REPLACED MUUTOS REVISIONS + Konelab 60, 60i 840758 - 4152 TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDESCALE PVM DATE HYV. APPR. M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN Cable Charts NIMI NAME LIITTYY ASSOCIATES 12 / 20 LIITTYY ASSOCIATES K55 LEHTI SHEET MERKKI MARK BATTERY 1 123Konelab 3-16 Version I BATTERY 2 K50 BATTERY 3 + K56 BATTERY 4 F1 POWCAN B A K53 B RE1 A K54 Figure 3-12 Batteries (60,60i) November 2, 2003 48953054-4081 CAN BUS POWCAN XP1 K 376 PCCAN ETHERNET MOUSE K75 CONNECTOR PANEL KEYBOARD MICRO FLOPPY DISK DIMM 1 DIMM 2 MAIN BOARD M ICRO FLOPPY ATXPWR1 PWRBTN IDE 1 IDE 2 PRIMARY IDE PIN 1 FLOPPY November 2, 2003 PIN 1 ATA-MODULE Red Black KORVAA REPLACES KORVATTU REPLACED MUUTOS REVISIONS Konelab 60, 60i 840758 - 4152 CABLE CHART / INTERNAL PC (MASTER) NIMI NAME LIITTYY ASSOCIATES LEHTI SHEET 13 / 20 LIITTYY ASSOCIATES Red JN HYV. APPR. TEKI DRAWN KOODI CODE LAJI CLASSIF. SUHDESCALE Z HYV. APPR. TARK. CHECKED M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN ARen PVM DATE PIIRT. DRAWN 06.11.02 XP2 (Holder) GND Black K 375 POWER TO INTERNAL PC XP1 (Holder) +28 V K163 -->K376, K375 lis„tty. K163 -->K376, K375 added K46 FAN 123Konelab MERKKI MARK i K45 PE 0V +24 V Version I Cable Charts 3-17 Figure 3-13 Internal PC (master) (60,60i) Konelab Service Manual Konelab Service Manual red 1 white-yellow 3 black 5 white-orange 7 2 red-white 4 yellow 6 white-black 8 orange PACIFIC SCIENTIFIC 1.8ø M21NRXE 1,01A yellow 3 orange 5 4 red 6 brown ESCAP P110 - 064 - 015 4 red 6 green-white W red-white 3 green 5 4 red 6 green-white SONCEBOZ 6600 R.158 1.3A / Ph Molex 90142-0008 Dual Row C-Grid III Crimp Connector Housing 90119-2110 Female Crimp Terminal 90119-0110 Female Crimp Terminal) SONCEBOZ 1.4A / Ph 2.6 red-white 3 green 5 (Connector: Terminal: MOTOR CONNECTIONS TO XP7, VIEW FROM CABLE SIDE 48953054-4081 SURF/HEDS 1 TILT 2 SURF/CHA 3 SURFOSC 4 GND 5 VDD 6 LED 7 LED/CHB 8 -5V OPTO 1 LED 2 GND 3 VDD 4 GND 5 OPT 6 NC/+28VP MOTOR 1 OUTB2 2 OUTB1 3 OUTB2 4 OUTB1 5 OUTA2 6 OUTA1 7 OUTA2 8 OUTA1 red 1 white 3 green-white 5 orange 7 2 6 1 5 7 8 1 2 KORVAA REPLACES NIMI NAME MUUTOS REVISIONS Konelab 60, 60i 840758 - 4152 CABLE CHART / MOTOR LIITTYY ASSOCIATES 14 / 20 LIITTYY ASSOCIATES LEHTI SHEET Z SUHDESCALE PVM DATE TEKI DRAWN LAJI CLASSIF. KOODI CODE HYV. APPR. TARK. CHECKED PIIRT. DRAWN HYV. APPR. M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN Cable Charts KORVATTU REPLACED back ) SURF (liquid detector, needle tilt) / HEDS (feedback opto) OPTO3 51 Pusher ( OPTO2 50 Mover (tilt) 51 Pusher ( cuv. ready 81 Segment (in register) 69 ISE LIQ DET OPTO1 (zero point) PARAL. (motor windings) ), 4 yellow 6 red SERIAL (motor windings) 17, 56 Diluent pump white 3 green 5 SONCEBOZ LINEAR ACTUATOR W 7214 R005 8.8V 46 123Konelab MERKKI MARK 2 black 4 red-white 6 black-white 8 green SONCEBOZ 6500 R.497 1A / Ph 3-18 Version I Figure 3-14 Motor (60,60i) November 2, 2003 November 2, 2003 GND VDD1 4 5 6 4 5 6 XP2 1 MEASGND 2 RES13 RES1+ 4 CH1IN 5 RES16 RES1+ 1 2 3 1 2 3 48953054-4081 KORVAA REPLACES KORVATTU REPLACED Konelab 60, 60i 840758 - 4152 MUUTOS REVISIONS (THERM 4-6) RES2 40 SDispU 48 RDispU (THERM 1-3) Z SUHDESCALE PVM DATE (TEMP1) , (TEMP2) RES1 40 MeasCh (TEMP1), 48 Incub (TEMP2), 70 ISE block (TEMP3) CABLE CHART / TEMP LIITTYY ASSOCIATES NIMI NAME LIITTYY ASSOCIATES LEHTI SHEET 15 / 20 123Konelab MERKKI MARK XP4 1 MEASGND 2 RES23 RES2+ 4 CH4IN 5 RES26 RES2+ TEKI DRAWN LAJI CLASSIF. KOODI CODE HYV. APPR. TARK. CHECKED PIIRT. DRAWN HYV. APPR. M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN Version I Cable Charts 3-19 Figure 3-15 Temp (60,60i) Konelab Service Manual Konelab Service Manual 1 2 3 5 6 6 2 4 5 1 48953054-4081 XP8 1 +28V 2 GND 3 GND 4 GND 5 GND 6 GND XP6, 7 1 CANA 2 CANA 3 CANB 4 CANB XP4 1 GND 2 MOT+ 3 GND 4 +5VCH 5 +5VCH 6 NC XP5 1 NC 2 LAMP+ 3 GND 4 NC 5 +15VM 6 - 15VM XP3 1 CHOPLED 2 GND 3 +5VCH 4 GND 5 CHOPSYNC 6 AGND XP1, XP2 1 +12V 2 -12V 3 CH S / R 4 GNDSENS 5 PREGAIN 6 AGND 1 KORVAA REPLACES KORVATTU REPLACED MUUTOS REVISIONS CABLE CHART / PHOTO Konelab 60, 60i 840758 - 4152 Z SUHDESCALE PVM DATE TEKI DRAWN LAJI CLASSIF. KOODI CODE HYV. APPR. TARK. CHECKED PIIRT. DRAWN HYV. APPR. M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN Cable Charts NIMI NAME LIITTYY ASSOCIATES 16 / 20 LIITTYY ASSOCIATES LEHTI SHEET MERKKI MARK 123Konelab POWER CAN CAN LAMP POWER CHOPPER MOTOR SYNC OPTO PHOTREF (reference channel) PHOTSIG Jumper JP1-JP2 (signal channel) 3-20 Version I Figure 3-16 Photo (60,60i) November 2, 2003 November 2, 2003 VDD1 GND XP10 1 TXD 2 SUPPLYGND 3 TRIGGER 4 SIGNALGND 5 RXD 6 +5V 7 BCR_RESET 8 +12VRS 8 2 5 6 1 2 7 1 48953054-4081 Bar Code Reader XP6, 7, 8, 9 1A A 2 GND 3 +5V 4 GND 5 IN A_C 6 NC /+28VP XP3, 4, 5 1A B 2 GND 3 +5V 4 GND 5 IN B_C 6 NC /+28VP XP2 1 LED1A 2 GND 3 LED2A 4 GND 5 LED3A 6 GND 7 LED4A 8 GND KORVAA REPLACES KORVATTU REPLACED NIMI NAME MUUTOS REVISIONS Konelab 60, 60i 840758 - 4152 CABLE CHART / INOUT LIITTYY ASSOCIATES LEHTI SHEET 17 / 20 LIITTYY ASSOCIATES 123Konelab MERKKI MARK 1 / 16 Cuvettes in Storage Opto 2 / 72 Segment Loader Opto 1 / 16 Cuvette Loader Opto 2 / 72 Segment Cover Opto IN3A IN4A 1 / 16 Reagent Cover Opto 2 / 72 Stat Cover Opto 1 / 16 Reagent Storage Cover Opto 2 / 72 Sample Register Cover Opto IN2A IN1A 1 / 16 SDispUnit Reflective Object Sensor 1 / 16 RDispUnit Reflective Object Sensor 2 / 72 Water Detector IN2B IN3B 1 / 16 MeasCh Reflective Object Sensor 2 / 72 Waste Detector 2 / ID72 Segm. GLED Segm. RLED Stat GLED Stat RLED IN1B LEDS 1 / ID16 Cuv. GLED Cuv. RLED Reag. GLED Reag. RLED TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDESCALE PVM DATE HYV. APPR. M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN Version I Cable Charts 3-21 Figure 3-17 Inout (60,60i) Konelab Service Manual VDD1 A Konelab Service Manual GND (only in 60i) 5 6 1 2 1 48953054-4081 XP5 1 VDD1TEST 2 +15VTEST 3 - 15VTEST 4 +5VTEST 5 - 5VTEST 6 GND XP4 1 LIQEDETOUT 2 LIQEDETOUT 3 LIQEDETOUT 4 LIQEDETOUT 5 GND 6 GND XP3 1 BS1P 2 BS2P 3 BS3P 4 BS4P 5 +12VBS 6 A GND XP2 1 DETACK1KB 2 DETON 3 DETLED 4 DETOUT 5 MUX1P 6 MUX2P 7 MUX3P 8 MUX4P 9 AGND 10 SIGIN 11 GNDSENSE 12 VREF+ 13 VREF14 +12VP 15 -12VP a MERKKI MARK 18 / 20 KORVAA REPLACES NIMI NAME CABLE CHART / ISE LIITTYY ASSOCIATES MUUTOS REVISIONS Konelab 60, 60i 840758 - 4152 HYV. APPR. Z SUHDESCALE JN LAJI CLASSIF. KOODI CODE HYV. APPR. TARK. CHECKED M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN JHen TEKI DRAWN PIIRT. DRAWN 18.3.98 PVM DATE Cable Charts KORVATTU REPLACED LEHTI SHEET LIITTYY ASSOCIATES Lis„tty teksti: (only in 60i). Added text: (only in 60i). 123Konelab LIQ DET BLK SIM PREAMP (ISEAMP) 3-22 Version I Figure 3-18 ISE (60,60i) November 2, 2003 XP10 11 NC 1 NC 12 -12VM 2 NC 13 GND 3 GND 14 NC 4 +5VM 15 GND 5 GND 16 GND 6 +5VM 17 GND 7 GND 18 - 5VM 8 POWERGOOD 19 + 5VM 9 +5VM 20 +5VM 10 +12VM November 2, 2003 XP7 1 +28V 2 GND 3 GND 4 GND 5 GND 6 GND XP6 1 GND 2 +5V1TEST 3 VDD5V1TEST 4 +19VTEST 5 - 19VTEST 6 VDIFFTEST 7 VAVETEST 8 VADJTEST XP5 1 NC 2 NC 3 MAINSW+ 4 MAINSW5 NC 6 NC F2 XP4 1 NC 2 NC 3 POWFAIL+ 4 POWFAIL5 NC 6 NC j c F1: COOLING (STORAGES) F2: POWCAN, CAN BUS, 1 RE2 1 B A RE1 POWER UNIT +28V K54 48953054-4081 19 / 20 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET 1 NIMI NAME Konelab 60, 60i 840758 - 4152 CABLE CHART / POWCAN LIITTYY ASSOCIATES Z SUHDESCALE PVM DATE 04.02.03 10.2.99 2 123Konelab 4 MUUTOS REVISIONS 5 1 LIITTYY ASSOCIATES 2 7 Poistettu K-merkinn„t. K-markings removed Lis„tty tietoa sulakkeista F1-F3. Added information for F1-F3 XP1, 2 1 CANA 2 CANA 3 CANB 4 CANB 1 8 MERKKI MARK T6.3A XP3 1 +28V 2 GND 3 GND 4 GND 5 GND 6 GND 6 T3.15A XP8 1 GND 2 PELTIER23 PELTIER2+ 4 THERM2 5 PELTIER26 PELTIER2+ F1 3 F3 XP9 1 GND 2 PELTIER13 PELTIER1+ 4 THERM1 5 PELTIER16 PELTIER1+ TEKI DRAWN ARen JHen LAJI CLASSIF. KOODI CODE HYV. APPR. TARK. CHECKED PIIRT. DRAWN M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN HYV. APPR. ECO00384 JN Version I Cable Charts 3-23 1 1 T6.3A 1 B A 1 F1 K53 INTERNAL PC POWER F3: CHARGING (BATTERIES) Figure 3-19 Powcan (60,60i) Konelab Service Manual 48953054-4081 K170 XP2 XP1 K232 IO 16 XP8 XP2 XP1 XP3 A D3 XP3 LED1-1 XP2 TRI COLOR LED D3 K230 XP2 XP1 XP3 C B CUVETTE COVER OPTO K169 D2 D1 XP2 XP1 LED1-2 XP3 Cathode C D1 D2 XP1 XP2 D2 D1 C GREEN RED C XP3 a 20 / 20 KORVAA REPLACES NIMI NAME CABLE CHART / COVER LEDS LIITTYY ASSOCIATES MUUTOS REVISIONS XP1 Konelab 60, 60i 840758 - 4152 JN HYV. APPR. KOODI CODE LAJI CLASSIF. SUHDESCALE Z HYV. APPR. TARK. CHECKED M-FILMI M-FILM 4101 J 840800 22.1.98 JHen 23.1.98 JHen 23.1.98 JN JHen TEKI DRAWN PIIRT. DRAWN 18.3.98 PVM DATE LED1-1 TRI COLOR LED K231 IO72 XP2 Cable Charts KORVATTU REPLACED LEHTI SHEET D LIITTYY ASSOCIATES Uusi sivu. New page. 123Konelab MERKKI MARK K202 XP2 XP3 Konelab Service Manual D3 3-24 Version I Figure 3-20 Cover leds (60,60i) November 2, 2003 TEMP *2 (*3 in 60 with Kusti in 60i with Kusti - heatings - 2 channels +28V ) 4101 F LAJI CLASSIF. 48414999 KOODI CODE Z HYV. APPR. SUHDE SCALE CABLE CHART / BLOCK DIAGRAM NIMI NAME LIITTYY ASSOCIATES 1 /21 LEHTI SHEET KORVAA REPLACES TARK. CHECKED Ethernet PCCAN - CAN interface - termination thermistors HYV. APPR. MERKKI MARK f +28V KORVATTU REPLACED position feedback LIITTYY ASSOCIATES Sis„inen PC-lohko p„ivitetty. Block Internal PC updated. MOTOR *31 in 60 with Kusti (*36 in 60i with Kusti ) 123Konelab CAN BUS MUUTOS REVISIONS Windows NT Termination limit switches TEKI DRAWN WORKSTATION SURF *3 in 60 with Kusti (*4 in 60i with Kusti ) PIIRT. DRAWN ARen 04.02.03 ANALYZER PVM DATE ECO00384 M-FILMI M-FILM 3-25 16.09.99 JHen 22.09.99 JHen 23.09.99 JN Cable Charts Konelab 60, 60i with Kusti Version I INTERNAL PC (MASTER) - ATA-module, floppy disk - controls all nodes via CAN BUS + 28V MAINS INPUT PHOTSIG *1 PHOTO * 1 - ADC - lamp control - chopper drive PHOTREF *1 POWCAN *1 +28V - power supply monitoring - battery control - CAN-bus bias - coolings control status POWER MODULE - mains switch - line filter - 100 - 240 VAC input - 28 VDC output +28V +28V Batteries ISEAMP * 1 ISE * 1 (in 60i with Kusti) - ADC - liquid detection limit switches INOUT * 2 - digital I/O - analog inputs - RS232 interfaces - LED, button etc. interfaces LEDS +28V +28V RS232 Bar code readers Figure 3-21 Block diagram (60,60i Kusti) November 2, 2003 48953054-4081 Konelab Service Manual RACK1 Konelab Service Manual JP7 JP5 JP3 JP1 TP1 JP8 JP6 JP4 JP2 5 16 INOUT 1 50 CUVETTE MOVER 49 FRONT LATCH 48 TEMP 2 RACK2 48953054-4081 82 FILTER DISK 81 SEGMENT FEEDER 80 SAMPLE STORAGE XP5 F XP4 XP4 XP6 JP7 JP5 JP3 JP1 TP1 JP8 JP6 JP4 JP2 XP3 XP2 113 Kusti DISPENSER XP7 JP8 JP6 JP4 JP2 6 114 Kusti FMI PUMP XP6 TP1 51 CUVETTE PUSHER JP7 JP5 JP3 JP1 52 ROTATION UNIT MB1-3 54 S DISPENSER Y XP1 55 S MIXER WASH XP5 XP7 2 /21 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES CABLE CHART / RACKS Konelab 60, 60i with Kusti MUUTOS REVISIONS 124 POWCAN 126 PHOTO XP13 TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE XP11 XP13 XP11 HYV. APPR. M-FILMI M-FILM 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN Cable Charts KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab ONLY IN Kusti 60i F XP3 56 S DILUENT PUMP XP10 67 ISE WASH XP2 XP12 68 ISE SYRINGE XP11 XP9 XP8 XP7 XP6 4 XP5 MB1-9 69 ISE DILUENT PUMP XP4 XP9 XP8 70 TEMP 3 MB1-3 XP13 JP8 JP6 JP4 JP2 XP1 64 S SYRINGE XP9 TP1 XP2 65 ISE Y XP8 JP7 JP5 JP3 JP1 XP3 66 ISE XP7 XP7 71 ISE XP1 XP6 53 S DISPENSER XP5 3 17 R DILUENT PUMP MB1-9 18 R MIXER WASH F XP4 22 R DISPENSER Y XP3 23 R MIXER F XP2 32 R MIXER Y XP10 XP12 JP8 JP6 JP4 JP2 33 R DISPENSER UNIT F XP1 XP13 TP1 34 MEAS CHANNEL XP11 JP7 JP5 JP3 JP1 XP6 XP4 35 INCUBATOR XP3 2 XP5 36 S MIXER XP2 MB1-9 37 S MIXER XP1 38 S MIXER Y 72 INOUT 2 XP10 JP8 JP6 JP4 JP2 XP8 39 S DISPENSER UNIT XP12 TP1 XP9 24 R MIXER XP7 40 TEMP 1 XP10 XP12 JP7 JP5 JP3 JP1 XP6 XP4 19 R SYRINGE XP3 1 XP5 20 R STORAGE XP2 MB1-9 21 R DISPENSER XP1 3-26 Version I F 112 Kusti DISPENSER Y RACK4 RACK3 Figure 3-22 Racks (60,60i Kusti) November 2, 2003 XP3 28V 48953054-4081 XP13 28V 28V CAN 28V XP12 CAN XP10 MB 1-9 2 GND K41 XP13 XP11 28V CAN K375 K47 K32 K48 TO INTERNAL PC HOLDER R1 GND + 24V XP2 +28V + 28V XP1 K33 K43 BACK PANEL FANS IN K44 K36 28V XP12 CAN XP10 MB 1-9 3 24V GND 28V FROM POWER 28V 28V FROM POWER K147 POWCAN XP7 K40 K42 K375 K34 K35 K31 GND FROM POWER K146 POWCAN XP3 K38 K37 CAN 3 /21 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET K46 K45 NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES XP5 28V XP11 XP13 CABLE CHART / POWER, CAN AND FAN CABLES Konelab 60, 60i with Kusti MUUTOS REVISIONS K375 lis„tty. K375 added Kustin johdotus korjattu. Kusti wiring corrected. MB 1-9 4 a 28V XP12 CAN XP10 PC FAN PC FAN XP4 K259 K286 e 28V CAN K258 STORAGE SAMPLE 123Konelab 28V MERKKI MARK XP13 XP11 2 XP XP12 XP11 CAN 24V CAN K27 CAN K258 N CA K39 CAN K30 PHOTO CAN XP7 XP7 CAN 5 MB 1-3 CAN 28V CAN 28V 28V XP6 6 XP7 KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED M-FILMI M-FILM CAN K29 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN JN PIIRT. DRAWN TEKI DRAWN JN HYV. APPR. JHen ARen SUHDE SCALE PVM DATE 27.01.2000 08.11.2002 K286 CAN XP4 MB 1-3 K31 K259 XP5 28V K258 CAN XP4 XP6 CAN November 2, 2003 XP6 W PO MB 1-9 1 CAN TERMINATION XP10 REAGENT STORAGE K145 28V XP8 Version I Cable Charts 3-27 Figure 3-23 Power, can and fan cables (60,60i Kusti) Konelab Service Manual K374 black black L 6 5 red 48953054-4081 K74 F1 yellow-green K72 N Brown 4 K213 red S1 3 Yellow yellow-green 2 1 red K70 1 2 K379 K73 red K260 black TO INTERNAL PC TO INTERNAL PC black FILTER red White K75 (ETHERNET) WORK STATION TO LABORATORY AUTOMATION SYSTEM TO FRAME Green Inhibit 6 L N PE POWER UNIT + + K71 + + + Konelab Service Manual - CONNECTOR PANEL 4 /21 KORVAA REPLACES NIMI NAME CABLE CHART / CONNECTOR PANEL AND POWER UNIT LIITTYY ASSOCIATES MUUTOS REVISIONS Konelab 60, 60i with Kusti 3 4 M-FILMI M-FILM 48414999 4101 F KOODI CODE LAJI CLASSIF. 16.09.99 JHen 22.09.99 JHen 23.09.99 JN Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN B™ JN JN HYV. APPR. TEKI DRAWN ECO 00384 ARen JHen JN ARen SUHDE SCALE PVM DATE 18.01.02 5.3.01 9.8.02 04.02.03 POWCAN RE2/B BATTERY 4- BATTERY 2- CHASSIS CHASSIS XP1 (Holder) XP1 (Holder) POWCAN XP4 Brown POWCAN XP5 Yellow FRONT SWITCH S2 Cable Charts KORVATTU REPLACED LEHTI SHEET 123Konelab LIITTYY ASSOCIATES K361, K362 etukytkin lis„tty K361, K362 front switch added K57 kytkent„ muutettu. K57 connection changed. c b MERKKI MARK K361, K362 kytkent„ muutettu / connection changed. d K54 K52 K51 K38 K37 K35 K34 K378 Tehol„hde vaihdettu, K374 lis„tty, K68 -> K379,K361->K377, K362-->K378 Power Supply Unit changed, K374 added, K68 -> K379, K361-->K377, K362-->K378 Mainsfail + White f 1 Mainsfail - K377 3-28 Version I Figure 3-24 Connector panel and power unit (60,60i Kusti) November 2, 2003 November 2, 2003 XP3 SURF XP2 XP1 K89 f -OPTO 48953054-4081 DISP. f MB 1-9 (1) MOTOR ID 22 REAGENT DISP. Y K101 MOTOR ID 21 REAGENT K88 XP7 XP2 XP5 K115 Y-MOV HEDS f -MOV XP7 XP2 XP5 K102 Y -OPTO REAGENT DISPENSER OPTO K201 XP3 XP2 SURF XP1 K26 TO CHASSIS K104 K116 Y -OPTO DISP. f MOTOR ID 53 SAMPLE K103 MOTOR ID 54 SAMPLE DISP. Y XP7 XP2 XP5 K90 Y-MOV HEDS f -MOV MB 1-9 (3) XP7 XP2 XP5 K91 f -OPTO SAMPLE DISPENSER OPTO K11 K10 K183 K105 (only in 60i) MOTOR ID 65 ISE DISP. Y 5 /21 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK f NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES XP2 K182 SURF XP3 K181 K117 (only in 60i) TEMP3 ID 70 ISE XP2 K183 ISE DISPENSER XP1 ISEAMP CABLE CHART / DISPENSERS Konelab 60, 60i with Kusti MUUTOS REVISIONS MB 1-9 (4) (only in 60i) DISP. MOTOR ID 66 ISE XP7 XP2 XP5 K106 Y-MOV HEDS f -MOV K93 123Konelab XP7 XP2 XP5 K92 Y -OPTO f -OPTO K26 TO CHASSIS K185 K184 TEKI DRAWN KOODI CODE LAJI CLASSIF. HYV. APPR. Z K190 M-FILMI M-FILM 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN HYV. APPR. XP4 TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE (only in 60i) ISE ID 71 XP2 MOTOR ID 69 ISEDILP XP3 (only in 60i) OPTO Version I Cable Charts 3-29 Figure 3-25 Dispensers (60,60i Kusti) Konelab Service Manual Konelab Service Manual 48953054-4081 XP2 K108 Y -OPTO MIXER f MOTOR ID 24 REAGENT K95 XP7 MB 1-9 (1) MOTOR ID 23 REAGENT MIXER XP7 K126 f -OPTO REAGENT MIXER 7 Y-MOV f -MOV MOTOR ID 32 REAGENT MIXER Y K94 K126 XP7 XP2 XP3 K107 1 7 1 CONN 1-8 XP2 XP2 K127 K128 OPTO MB 1-9 (2) MOTOR ID 36 SAMPLE MIXER K14 XP7 Y -OPTO MIXER MOTOR ID 37 SAMPLE 6 /21 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MOTOR ID 38 SAMPLE MIXER Y MUUTOS REVISIONS OPTO CABLE CHART / MIXERS Konelab 60, 60i with Kusti K13 K15 TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN Cable Charts KORVATTU REPLACED LEHTI SHEET MERKKI MARK Y-MOV f -MOV CONN 1-8 XP2 XP2 K14 K96 XP7 XP2 XP3 K109 123Konelab f K97 K110 XP7 XP2 f -OPTO SAMPLE MIXER XP1 7 CONN1-6 XP1 1 7 1 CONN1-6 XP1 XP1 3-30 Version I Figure 3-26 Mixers (60,60i Kusti) November 2, 2003 November 2, 2003 48953054-4081 (600) K290 MB 1-3 (6) MOTOR ID 112 KUSTI DISP. Y K 347 MOTOR ID 114 KUSTI DILUENT PUMP K292 XP7 XP2 XP5 K294 1 XP6 XP2 K293 XP2 1-6 CONN 7 XP1 f -OPTO XP1 7 (600) 1 K 348 XP2 1-6 CONN DISP. f MOTOR ID 113 KUSTI Y-MOV HEDS f -MOV K287 XP7 XP2 XP5 K289 K288 K 291 Y -OPTO K26 TO CHASSIS XP1 XP2 XP3 SURF 7 /21 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab OPTO NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MUUTOS REVISIONS CABLE CHART / KUSTI Konelab 60, 60i with Kusti TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN Version I Cable Charts 3-31 Figure 3-27 Kusti (60,60i Kusti) Konelab Service Manual Konelab Service Manual 48953054-4081 XP2 K248 MOTOR ID 17 REAGENT DILUENT PUMP K247 XP6 MOTOR ID 18 REAGENT MIXER WASH XP7 MB 1-9 (1) K119 REAGENT K85 K98 XP2 MOTOR ID 19 REAGENT SYRINGE XP7 OPTO K250 XP2 MOTOR ID 56 SAMPLE DILUENT PUMP K249 XP6 MB 1-9 (3) MOTOR ID 55 SAMPLE MIXER WASH K121 XP7 XP7 K99 XP2 OPTO MOTOR ID 64 SAMPLE SYRINGE K86 SAMPLE K100 MERKKI MARK 8 /21 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES CABLE CHART / SYRINGES AND PUMPS TEKI DRAWN KOODI CODE LAJI CLASSIF. HYV. APPR. TARK. CHECKED PIIRT. DRAWN Z PVM DATE SUHDE SCALE (only in 60i) Konelab 60, 60i with Kusti MUUTOS REVISIONS XP3 MOTOR ID 69 ISE DILUENT PUMP K122 XP7 ISE ID 71 XP4 HYV. APPR. M-FILMI M-FILM 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN Cable Charts KORVATTU REPLACED LEHTI SHEET 123Konelab MB 1-9 (4) (only in 60i) XP2 (only in 60i) XP7 MOTOR ID 68 ISE SYRINGE K87 K123 (only in 60i) MOTOR ID 67 ISE WASH K123 XP7 OPTO ISE 3-32 Version I Figure 3-28 Syringes and pumps (60,60i Kusti) November 2, 2003 1 XP 2 48953054-4081 NN CO 1-6 1 (600) 2 XP XP 1 K282 1 XP XP2 XP7 XP3 XP2 7 XP7 XP2 XP7 XP9 MB 1-9 (3) XP3 MOTOR ID 51 CUVETTE PUSHER 7 (600) 1 K344 XP2 MOTOR ID 52 ROTATION UNIT XP7 MOTOR ID 50 CUVETTE MOVER (600) K244 (600) K283 XP2 MB 1-9 (1) NN CO 1-8 MOTOR ID 49 FRONT LATCH (500) K136 1 INOUT ID 16 (1500) K144 XP XP2 K138 X P1 CO NN 1-6 K137 NN CO 1 -6 1-6 7 K135 K134 2 XP 1 XP CONN (600) K142 K130 7 XP1 K143 K141 7 CO NN NN CO 1-6 1-6 November 2, 2003 1 XP XP 2 K131 9 /21 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES K76 K132 K140 CABLE CHART / CUVETTE UNIT Konelab 60, 60i with Kusti MUUTOS REVISIONS K139 TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN Version I Cable Charts 3-33 7 1 2 XP 1 XP4 1 Figure 3-29 Cuvette unit (60,60i Kusti) Konelab Service Manual Konelab Service Manual K216 POWCAN XP9 XP1 CONN 7 XP1 (600) 1 7 48953054-4081 K206 (600) K229 K124 K125 K114 K67 XP3 XP2 XP7 XP2 XP7 XP10 XP9 XP8 XP7 XP6 XP5 MB 1-3 (5) MOTOR ID 81 SEGMENT FEEDER K169 CUVETTE LOADER OPTO XP 2 (600) 7 K65 1 XP1 CO NN 1-6 MERKKI MARK 10 /21 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES CABLE CHART / STORAGES Konelab 60, 60i with Kusti MUUTOS REVISIONS MOTOR ID 20 REAGENT STORAGE K113 TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE M-FILMI M-FILM 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN HYV. APPR. K215 POWCAN XP8 Cable Charts KORVATTU REPLACED LEHTI SHEET K112 MB 1-9 (1) K111 K64 K215 XP3 REAGENT STORAGE XP5 123Konelab INOUT ID 16 XP10 XP9 XP8 XP7 XP6 MOTOR ID 80 SAMPLE STORAGE K129 K66 K207 K143 K144 CUVETTE IN STORAGE OPTO HEDS XP7 MB 1-9 (4) 7 HEDS K63 XP2 INOUT ID 72 (600) XP 2 1 CO N 1 -6 N XP 1 K205 7 K60 XP2 1-6 CONN 1 CONN 1-6 (600) XP2 1-6 K59 K228 XP1 K62 XP4 K61 SAMPLE STORAGE 3-34 Version I XP2 1 Figure 3-30 Storages (60,60i Kusti) November 2, 2003 November 2, 2003 O NN CO 1- 6 7 NN CO 1 -6 7 1 2 XP 48953054-4081 N 1 N 7 X P1 K20 K6 K1 CO NN 1-6 2 XP 1 K3 XP2 XP7 XP2 XP7 XP2 XP7 XP4 XP3 MOTOR ID 35 INCUB. K5 XP5 MB 1-9 (2) K9 K7 K2 MOTOR ID 33 REAGENT DISP. UNIT XP7 MOTOR ID 34 MEAS. CHANNEL (600) 1 K242 K4 XP2 MOTOR ID 39 SAMPLE DISP. UNIT K8 XP (1500) C Jumper JP1-JP2 K21 1 XP 1 -6 MEAS. CHANNEL K210 REF. FOLIO INCUBATOR HEDS K212 TEMP1 ID 40 K16 XP2 INOUT ID 16 (1500) K24 1 XP XP 2 K23 K211 SIG. K19 XP5 11 /21 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK XP4 123Konelab LIITTYY ASSOCIATES LIITTYY ASSOCIATES NIMI NAME K83 K84 TEMP2 ID 48 K22 XP4 CABLE CHART / INCUBATOR AND DISPENSING UNITS Konelab 60, 60i with Kusti MUUTOS REVISIONS MB 1-9 (3) K148 REAGENT DISPENSING UNIT XP2 MB 1-9 (1) (1500) K18 K17 SAMPLE DISPENSING UNIT TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE XP1 XP2 PHOTO ID 126 HYV. APPR. M-FILMI M-FILM 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN Version I Cable Charts 3-35 XP5 7 XP5 XP5 2 XP 1 Figure 3-31 Incubator and dispensing units (60,60i Kusti) Konelab Service Manual Konelab Service Manual PHOTO ID 126 48953054-4081 XP5 XP4 XP3 K81 K241 (600) K79 K82 LAMP HOUSE XP2 1-6 CONN 1 XP1 7 CHOPPER MOTOR XP2 K80 MB 1-3 (5) MOTOR ID 82 FILTER DISK XP7 K78 K77 XP4 K203 12 /21 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MUUTOS REVISIONS CABLE CHART / LAMP HOUSE AND WATER DETECTORS Konelab 60, 60i with Kusti DILUENT TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN Cable Charts KORVATTU REPLACED LEHTI SHEET 123Konelab MERKKI MARK MB 1-3 (5) INOUT ID 72 XP3 K204 WASTE 3-36 Version I Figure 3-32 Lamp house and water detectors (60,60i Kusti) November 2, 2003 +28V + - November 2, 2003 - K52 + - K51 MERKKI MARK BATTERY 2 RE2 POWER UNIT 48953054-4081 13 /21 KORVAA REPLACES KORVATTU REPLACED - + NIMI NAME LIITTYY ASSOCIATES + CABLE CHART / BATTERIES Konelab 60, 60i with Kusti MUUTOS REVISIONS K55 LIITTYY ASSOCIATES BATTERY 1 LEHTI SHEET 123Konelab TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN Version I Cable Charts 3-37 K49 K50 BATTERY 3 + K56 BATTERY 4 F1 POWCAN B A K53 B RE1 A K54 Figure 3-33 Batteries (60,60i Kusti) Konelab Service Manual 48953054-4081 CAN BUS POWCAN XP1 K376 PCCAN ETHERNET CONNECTOR PANEL K260 MOUSE K75 CONNECTOR PANEL KEYBOARD MICRO FLOPPY DISK DIMM 1 DIMM 2 MAIN BOARD MICRO FLOPPY ATXPWR1 PWRBTN IDE 1 IDE 2 PRIMARY IDE PIN 1 FLOPPY Konelab Service Manual PIN 1 MERKKI MARK 14 /21 KORVAA REPLACES e a K46 Red NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES CABLE CHART / INTERNAL PC (MASTER) Red KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN TEKI DRAWN ARen SUHDE SCALE PVM DATE 08.11.02 M-FILMI M-FILM 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN HYV. APPR. JN XP2 (Holder) GND Black K 375 POWER TO INTERNAL PC XP1 (Holder) +28 V Konelab 60, 60i with Kusti MUUTOS REVISIONS K260 lis„tty. K260 added K163 -->K376, K375 lis„tty. K163 -->K376, K375 added K45 FAN +24 V Black Cable Charts KORVATTU REPLACED LEHTI SHEET 123Konelab ATA-MODULE PE 0V 3-38 Version I Figure 3-34 Internal PC (master) (60,60i Kusti) November 2, 2003 November 2, 2003 red 1 white-yellow 3 black 5 white-orange 7 2 red-white 4 yellow 6 white-black 8 orange PACIFIC SCIENTIFIC 1.8ø M21NRXE 1,01A yellow 3 orange 5 4 red 6 brown ESCAP P110 - 064 - 015 4 red 6 green-white W red-white 3 green 5 4 red 6 green-white SONCEBOZ 6600 R.158 1.3A / Ph Molex 90142-0008 Dual Row C-Grid III Crimp Connector Housing 90119-2110 Female Crimp Terminal 90119-0110 Female Crimp Terminal) SONCEBOZ 1.4A / Ph 2.6 red-white 3 green 5 (Connector: Terminal: MOTOR CONNECTIONS TO XP7, VIEW FROM CABLE SIDE 48953054-4081 2 6 1 5 7 8 1 2 15 /21 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES 2 black 4 red-white 6 black-white 8 green 123Konelab MERKKI MARK SURF/HEDS 1 TILT 2 SURF/CHA 3 SURFOSC 4 GND 5 VDD 6 LED 7 LED/CHB 8 -5V OPTO 1 LED 2 GND 3 VDD 4 GND 5 OPT 6 NC/+28VP MOTOR 1 OUTB2 2 OUTB1 3 OUTB2 4 OUTB1 5 OUTA2 6 OUTA1 7 OUTA2 8 OUTA1 red 1 white 3 green-white 5 orange 7 SONCEBOZ 6500 R.497 1A / Ph back ) CABLE CHART / MOTOR Konelab 60, 60i with Kusti MUUTOS REVISIONS TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE SURF (liquid detector, needle tilt) / HEDS (feedback opto) OPTO3 51 Pusher ( OPTO2 50 Mover (tilt) 51 Pusher ( cuv. ready 81 Segment (in register) 69 ISE LIQ DET OPTO1 (zero point) PARAL. (motor windings) ), 4 yellow 6 red SERIAL (motor windings) 17, 56, 114 Diluent pump white 3 green 5 SONCEBOZ LINEAR ACTUATOR W 7214 R005 8.8V 46 HYV. APPR. M-FILMI M-FILM 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN Version I Cable Charts 3-39 Figure 3-35 Motor (60,60i Kusti) Konelab Service Manual Konelab Service Manual GND VDD1 48953054-4081 16 /21 KORVAA REPLACES 1 2 3 1 2 3 NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES XP4 1 MEASGND 2 RES23 RES2+ 4 CH4IN 5 RES26 RES2+ MUUTOS REVISIONS CABLE CHART / TEMP Konelab 60, 60i with Kusti (THERM 4-6) RES2 40 SDispU 48 RDispU (THERM 1-3) TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE (TEMP1) (TEMP2) RES1 40 MeasCh (TEMP1) 48 Incub (TEMP2) 70 ISE block (TEMP3) HYV. APPR. M-FILMI M-FILM 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN Cable Charts KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab 4 5 6 4 5 6 XP2 1 MEASGND 2 RES13 RES1+ 4 CH1IN 5 RES16 RES1+ 3-40 Version I Figure 3-36 Temp (60,60i Kusti) November 2, 2003 November 2, 2003 1 2 3 5 6 6 2 4 5 1 48953054-4081 17 /21 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK 1 123Konelab XP8 1 +28V 2 GND 3 GND 4 GND 5 GND 6 GND XP6, 7 1 CANA 2 CANA 3 CANB 4 CANB XP4 1 GND 2 MOT+ 3 GND 4 +5VCH 5 +5VCH 6 NC XP5 1 NC 2 LAMP+ 3 GND 4 NC 5 +15VM 6 - 15VM XP3 1 CHOPLED 2 GND 3 +5VCH 4 GND 5 CHOPSYNC 6 AGND XP1, XP2 1 +12V 2 -12V 3 CH S / R 4 GNDSENS 5 PREGAIN 6 AGND NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MUUTOS REVISIONS CABLE CHART / PHOTO Konelab 60, 60i with Kusti POWER CAN CAN LAMP POWER CHOPPER MOTOR SYNC OPTO PHOTREF (reference channel) TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE PHOTSIG Jumper JP1-JP2 (signal channel) HYV. APPR. M-FILMI M-FILM 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN Version I Cable Charts 3-41 Figure 3-37 Photo (60,60i Kusti) Konelab Service Manual Konelab Service Manual VDD1 GND XP10 1 TXD 2 SUPPLYGND 3 TRIGGER 4 SIGNALGND 5 RXD 6 +5V 7 BCR_RESET 8 +12VRS 8 2 5 6 1 2 7 1 48953054-4081 Bar Code Reader XP6, 7, 8, 9 1A A 2 GND 3 +5V 4 GND 5 IN A_C 6 NC/+28VP XP3, 4, 5 1A B 2 GND 3 +5V 4 GND 5 IN B_C 6 NC/+28VP XP2 1 LED1A 2 GND 3 LED2A 4 GND 5 LED3A 6 GND 7 LED4A 8 GND MERKKI MARK 18 /21 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MUUTOS REVISIONS CABLE CHART / INOUT Konelab 60, 60i with Kusti TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN Cable Charts KORVATTU REPLACED LEHTI SHEET 123Konelab 1 / 16 Cuvettes in Storage Opto 2 / 72 Segment Loader Opto 1 / 16 Cuvette Loader Opto 2 / 72 Segment Cover Opto IN3A IN4A 1 / 16 Reagent Cover Opto 2 / 72 Stat Cover Opto 1 / 16 Reagent Storage Cover Opto 2 / 72 Sample Register Cover Opto IN2A IN1A 1 / 16 SDispUnit Reflective Object Sensor 1 / 16 RDispUnit Reflective Object Sensor 2 / 72 Water Detector IN2B IN3B 1 / 16 MeasCh Reflective Object Sensor 2 / 72 Waste Detector 2 / ID72 Segm. GLED Segm. RLED Stat GLED Stat RLED IN1B LEDS 1 / ID16 Cuv. GLED Cuv. RLED Reag. GLED Reag. RLED 3-42 Version I Figure 3-38 INOUT (60,60i Kusti) November 2, 2003 November 2, 2003 VDD1 A GND (only in 60i) 2 6 1 5 1 48953054-4081 19 /21 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab XP5 1 VDD1TEST 2 +15VTEST 3 - 15VTEST 4 +5VTEST 5 - 5VTEST 6 GND XP4 1 LIQEDETOUT 2 LIQEDETOUT 3 LIQEDETOUT 4 LIQEDETOUT 5 GND 6 GND XP3 1 BS1P 2 BS2P 3 BS3P 4 BS4P 5 +12VBS 6 A GND XP2 1 DETACK1KB 2 DETON 3 DETLED 4 DETOUT 5 MUX1P 6 MUX2P 7 MUX3P 8 MUX4P 9 AGND 10 SIGIN 11 GNDSENSE 12 VREF+ 13 VREF14 +12VP 15 -12VP NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MUUTOS REVISIONS CABLE CHART / ISE Konelab 60, 60i with Kusti TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE LIQ DET BLK SIM PREAMP (ISEAMP) HYV. APPR. M-FILMI M-FILM 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN Version I Cable Charts 3-43 Figure 3-39 ISE (60,60i Kusti) Konelab Service Manual XP10 11 NC 1 NC 12 -12VM 2 NC 13 GND 3 GND 14 NC 4 +5VM 15 GND 5 GND 16 GND 6 +5VM 17 GND 7 GND 18 - 5VM 8 POWERGOOD 19 + 5VM 9 + 5VM 20 + 5VM 10 +12VM Konelab Service Manual XP7 1 +28V 2 GND 3 GND 4 GND 5 GND 6 GND XP6 1 GND 2 +5V1TEST 3 VDD5V1TEST 4 +19VTEST 5 - 19VTEST 6 VDIFFTEST 7 VAVETEST 8 VADJTEST XP5 1 NC 2 NC 3 MAINSW+ 4 MAINSW5 NC 6 NC F1: COOLING (STORAGES) F2: POWCAN, CAN BUS, 1 1 RE2 1 B RE1 A POWER UNIT +28V K54 48953054-4081 20 /21 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES CABLE CHART / POWCAN TEKI DRAWN ARen KOODI CODE LAJI CLASSIF. SUHDE SCALE Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN HYV. APPR. ECO00384 M-FILMI M-FILM 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN Cable Charts KORVATTU REPLACED LEHTI SHEET Konelab 60, 60i with Kusti PVM DATE 04.02.03 1 MUUTOS REVISIONS 2 LIITTYY ASSOCIATES 4 Poistettu K-merkinn„t. K-markings removed XP1, 2 1 CANA 2 CANA 3 CANB 4 CANB 1 123Konelab f T6.3A XP3 1 +28V 2 GND 3 GND 4 GND 5 GND 6 GND 5 1 MERKKI MARK F2 XP4 1 NC 2 NC 3 POWFAIL+ 4 POWFAIL5 NC 6 NC 6 2 7 T3.15A XP8 1 GND 2 PELTIER23 PELTIER2+ 4 THERM2 5 PELTIER26 PELTIER2+ F1 3 8 F3 XP9 1 GND 2 PELTIER13 PELTIER1+ 4 THERM1 5 PELTIER16 PELTIER1+ 3-44 Version I 1 T6.3A 1 B A 1 F1 K53 INTERNAL PC POWER F3: CHARGING (BATTERIES) Figure 3-40 Powcan (60,60i Kusti) November 2, 2003 48953054-4081 K170 XP2 XP1 K232 IO 16 XP8 XP2 XP1 XP3 A D3 XP3 LED1-1 XP2 TRI COLOR LED D3 K230 XP2 XP1 XP3 C B CUVETTE COVER OPTO K169 D2 D1 XP2 XP1 LED1-2 XP3 Cathode C D1 D2 XP1 XP2 D2 D1 C GREEN RED XP3 C 21 /21 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES D CABLE CHART / COVER LEDS TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE LED1-1 TRI COLOR LED K231 IO72 XP2 XP1 Konelab 60, 60i with Kusti MUUTOS REVISIONS K202 XP2 XP3 November 2, 2003 D3 HYV. APPR. M-FILMI M-FILM 4101 F 48414999 16.09.99 JHen 22.09.99 JHen 23.09.99 JN Version I Cable Charts 3-45 Figure 3-41 Cover leds (60,60i Kusti) Konelab Service Manual 3-46 Konelab Service Manual Cable Charts 48953054-4081 Version I November 2, 2003 123Konelab MERKKI MARK +28V 4101 C LAJI CLASSIF. 48408374 KOODI CODE Z HYV. APPR. SUHDE SCALE CABLE CHART / BLOCK DIAGRAM MUUTOS REVISIONS in 30i) position feedback NIMI NAME MOTOR * 15 (* 20 LIITTYY ASSOCIATES limit switches LIITTYY ASSOCIATES CAN BUS 1 / 19 Windows NT Termination LEHTI SHEET SURF * 1 (* 2 in 30i) Konelab 30, 30i 48407597 - 4152 WORKSTATION KORVAA REPLACES ANALYZER KORVATTU REPLACED PVM DATE PIIRT. DRAWN TEKI DRAWN HYV. APPR. M-FILMI M-FILM 3-47 6.3.98 JHen 17.3.98 JHen 18.3.98 JN Cable Charts TARK. CHECKED Version I Ethernet PCCAN - CAN interface - termination thermistors TEMP * 1 (* 2 in 30i) - heatings - 2 channels +28V INTERNAL PC (MASTER) - hard disk, floppy disk - controls all nodes via CAN BUS MAINS INPUT + 5V - 5V +12V -12V PHOTSIG *1 PHOTO * 1 - ADC - lamp control - chopper drive PHOTREF *1 POWCAN *1 - power supply monitoring - battery control - CAN-bus bias - coolings +28V POWER control status - mains switch - line filter - 100 - 230 VAC input - 28 VDC output MODULE +28V +28V Batteries ISEAMP * 1 ISE * 1 (only in 30i) - ADC - liquid detection limit switches INOUT * 2 - digital I/O - analog inputs - RS232 interfaces - LED, button etc. interfaces +28V LEDS +28V RS232 Bar code readers Figure 3-42 Block diagram (30,30i) November 2, 2003 48953054-4081 Konelab Service Manual J P 7 J P 5 J P 3 J P 1 T P 1 J P 8 J P 6 J P 4 J P 2 X P 2 19 M IXER W ASH 18 D ILU EN T PU M P 16 SYR IN G E Konelab Service Manual 48953054-4081 J P 7 J P 5 J P 3 J P 1 T P 1 J P 8 J P 6 J P 4 J P 2 X P 3 X P 7 T P 1 J P 8 J P 6 J P 4 J P 2 65 ISESYR 64 ISE . 50 ISE Y 49 TEM P 2 48 ISE X P 4 X P 6 J P 7 J P 5 J P 3 J P 1 X P 3 66 ISED ILP X P 2 M B1-3 4 X P 7 O N LY IN 30i K O R V A A 2 / 1 9 R E P L A C E S R E P L A C E D A S S O C IA T E S N IM I N A M E L IIT T Y Y A S S O C IA T E S M U U T O S T P 1 J P 8 J P 6 J P 4 J P 2 C A B L E C H A R T / R A C K S K o n e la b 3 0 , 3 0 i 4 8 4 0 7 5 9 7 - 4 1 5 2 R E V IS IO N S X P 4 J P 7 J P 5 J P 3 J P 1 D A T E Z S U H D E S C A L E P V M X P 3 X P 2 M B1-3 5 X P 5 X P 7 T E K I D R A W N L A J I C L A S S IF . K O O D I C O D E H Y V . A P P R . T A R K . C H E C K E D P IIR T . D R A W N X P 1 1 X P 1 3 M -F IL M I M -F IL M 4 1 0 1 C 4 8 4 0 8 3 7 4 H Y V . A P P R . 6 .3 .9 8 J H e n 1 7 .3 .9 8 J H e n 1 8 .3 .9 8 J N Cable Charts K O R V A T T U L IIT T Y Y R AC K5 L E H T I S H E E T M E R K K I M A R K X P 6 X P 1 X P 9 X P 8 X P 7 X P 6 80 FILTER D ISK 1 2 3 K o n e la b X P 5 36 M IXER . X P 1 X P 5 M B1-9 2 81 SAM PLE STO R AG E X P 5 23 C U VETTE LO AD ER X P 2 32 IN O U T 1 X P 1 0 X P 1 2 J P 8 J P 6 J P 4 J P 2 33 R STO R AG E X P 1 1 X P 1 3 T P 1 X P 3 34 IN O U T 2 X P 2 J P 7 J P 5 J P 3 J P 1 X P 4 35 M IXER Y X P 1 37 M IXER X P 1 X P 9 24 IN C U BATO R X P 8 38 D ISPEN SER Y 82 SEG M EN T FEED ER X P 4 X P 6 X P 7 39 D ISPEN SER . M B1-3 3 X P 6 X P 5 20 ISE W ASH X P 4 M B1-9 1 21 M EAS C H AN N EL X P 3 40 TEM P 1 X P 1 0 X P 1 2 X P 1 3-48 Version I R AC K2 R AC K4 R AC K3 126 PH O TO 124 PO W C AN R AC K1 Figure 3-43 Racks (30,30i) November 2, 2003 XP3 K173 November 2, 2003 48953054-4081 28V XP12 XP10 28V XP12 CAN XP10 MB 1-9 1 CAN TERMINATION K171 28V MB 1-9 2 XP13 XP11 CAN XP13 XP11 K154 REAGENT STORAGE 28V CAN R1 K157 K156 K158 K180 K179 XP1 +28V + 28V K189 K214 K186 K155 PHOTO K153 K162 K149 CAN XP7 XP6 CAN GND + 24V XP2 K161 K188 XP8 28V K176 K152 K150 XP7 3 / 19 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET 123Konelab MERKKI MARK BACK PANEL FANS IN K175 3 28V XP6 XP5 CAN XP4 MB 1-3 28V 28V 28V K151 CAN XP4 XP6 CABLE CHART / POWER, CAN AND FAN CABLES Konelab 30, 30i 48407597 - 4152 30i) HOUSE LAMP XP4 4 (only in XP7 XP6 5 XP7 MUUTOS REVISIONS 28V MB 1-3 XP5 CAN K160 CAN XP4 LIITTYY ASSOCIATES NIMI NAME CAN XP5 MB 1-3 LIITTYY ASSOCIATES K159 28V CAN (only in 30i) STORAGE SAMPLE K178 TO PC FAN K177 TEKI DRAWN KOODI CODE LAJI CLASSIF. HYV. APPR. TARK. CHECKED PIIRT. DRAWN Z PVM DATE SUHDE SCALE K174 K172 M-FILMI M-FILM 4101 C 48408374 6.3.98 JHen 17.3.98 JHen 18.3.98 JN HYV. APPR. Version I Cable Charts 3-49 POWCAN XP2 Figure 3-44 Power, can and fan cables (30,30i) Konelab Service Manual Konelab Service Manual black black K199 2 1 48953054-4081 N black 4 K200 red S1 3 red K196 shield red black red MERKKI MARK KORVAA REPLACES 4 / 19 LIITTYY ASSOCIATES NIMI NAME MUUTOS REVISIONS TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE POWCAN XP4 POWCAN RE2/B XP1 XP1 FRAME BATTERY 2 - Konelab 30, 30i 48407597 - 4152 CABLE CHART / CONNECTOR PANEL AND POWER UNIT LIITTYY ASSOCIATES K58 K186 K194 K155 K192 K162 POWCAN XP5 (mainsw) HYV. APPR. M-FILMI M-FILM 4101 C 48408374 6.3.98 JHen 17.3.98 JHen 18.3.98 JN Cable Charts KORVATTU REPLACED LEHTI SHEET 123Konelab 0V 28V N L black POWER UNIT 4 Powfail3 Powfail+ K75 (ETHERNET) WORK STATION K197 1 L 6 5 red K198 CONNECTOR PANEL 3-50 Version I Figure 3-45 Connector panel power unit (30,30i) November 2, 2003 O P T O November 2, 2003 X P 3 S U R F X P 2 K 1 0 4 48953054-4081 XP1 CO N N 1-8 XP1 K (6 0 0 ) 2 4 3 CO NN 1-8 XP2 M B 1 -9 (2 ) M O T O R ID 3 8 D IS P . Y (1 5 0 ) 2 K 2 3 7 XP XP1 K 8 8 Y -M O V H E D S M O T O R ID 3 9 D IS P . B K 1 1 6 1 7 NN CO 1 1-6 XP K 8 9 B -M O V X P 7 X P 2 X P 5 (6 0 0 ) K 2 8 1 XP2 XP2 7 CO NN 1-6 1 Y -O P T O K 1 0 3 X P 1 X P 7 X P 2 X P 5 (1 5 0 ) K 2 3 6 B -O P T O D IS P E N S E R K 1 1 K 1 0 K 1 2 T O C H A S S IS X P 2 X P 4 K 1 8 7 T O R 6 6 D IL P 3 IS E ID 4 8 ( o n ly in 3 0 i) K 1 8 4 M O ID IS E X P K 1 8 5 T O C H A S S IS M B 1 -3 (3 ) T E M P 2 ID 4 9 IS E ( o n ly in 3 0 i) X P 2 K 1 8 3 B -O P T O Y -O P T O K O R V A A X P 3 K 1 0 6 K 1 1 7 5 / 1 9 R E P L A C E S K o n e la b 3 0 , 3 0 i 4 8 4 0 7 5 9 7 - 4 1 5 2 C A B L E C H A R T / D IS P E N S E R S A S S O C IA T E S A S S O C IA T E S N IM I N A M E L IIT T Y Y L IIT T Y Y R E V IS IO N S D A T E Z S U H D E S C A L E P V M 15.10.98 M U U T O S 14.06.99 M B 1 -3 (4 ) M O T O R ID 6 4 IS E D IS P . B ( o n ly in 3 0 i) X P 7 X P 2 X P 5 K 9 3 K243 ja C O N N 1-6 lisätty.K243 and C O N N 1-6 added. R E P L A C E D L E H T I S H E E T K 1 8 2 S U R F O P T O K281 ja C O N N 1-6 lisätty.K281 and C O N N 1-6 added. 1 2 3 K o n e la b K O R V A T T U K 1 8 3 M O T O R ID 5 0 IS E D IS P . Y ( o n ly in 3 0 i) M E R K K I M A R K a c K 1 0 5 X P 7 X P 2 X P 5 K 9 2 Y -M O V H E D S B -M O V X P 2 K 1 8 1 IS E D IS P E N S E R (O N LY IN 30i) X P 1 IS E A M P L A J I C L A S S IF . K O O D I C O D E H Y V . A P P R . T A R K . C H E C K E D M -F IL M I M -F IL M 4 1 0 1 C 4 8 4 0 8 3 7 4 6 .3 .9 8 J H e n 1 7 .3 .9 8 J H e n 1 8 .3 .9 8 J N JN P IIR T . D R A W N T E K I D R A W N JN H Y V . A P P R . JH en JH en Version I Cable Charts 3-51 Figure 3-46 Dispensers (30,30i) Konelab Service Manual Konelab Service Manual 48953054-4081 M O T O R ID 3 7 M IX E R K 1 4 X P 7 B M B 1 -9 (2 ) M O T O R ID 3 6 M IX E R K 9 7 K 1 1 0 X P 7 X P 2 B -O P T O Y -O P T O M IX E R 7 Y -M O V XP2 XP2 M O T O R ID 3 5 M IX E R Y K 9 6 K 1 4 X P 7 X P 2 X P 3 K 1 0 9 1 7 1 B -M O V XP1 XP1 K 1 3 K 1 5 O P T O K O R V A A 6 / 1 9 R E P L A C E S R E P L A C E D A S S O C IA T E S A S S O C IA T E S N IM I N A M E L IIT T Y Y L IIT T Y Y M U U T O S R E V IS IO N S C A B L E C H A R T / M IX E R K o n e la b 3 0 , 3 0 i 4 8 4 0 7 5 9 7 - 4 1 5 2 D A T E Z S U H D E S C A L E P V M T E K I D R A W N P IIR T . D R A W N L A J I C L A S S IF . K O O D I C O D E H Y V . A P P R . T A R K . C H E C K E D M -F IL M I M -F IL M 4 1 0 1 C 4 8 4 0 8 3 7 4 H Y V . A P P R . 6 .3 .9 8 J H e n 1 7 .3 .9 8 J H e n 1 8 .3 .9 8 J N Cable Charts K O R V A T T U L E H T I S H E E T M E R K K I M A R K 1 2 3 K o n e la b 3-52 Version I Figure 3-47 Mixer (30,30i) November 2, 2003 K99 November 2, 2003 K246 48953054-4081 MB 1-9 (1) MOTOR ID 19 MIXER WASH (700) K238 XP7 (700) K239 K119 MOTOR ID 20 ISE WASH (only in 30i) XP7 2 XP2 XP MOTOR ID 18 DILUENT PUMP K245 XP6 NN CO 1-8 XP2 1 XP MOTOR ID 16 SYRINGE K86 XP7 OPTO a LEHTI SHEET 7 / 19 KORVAA REPLACES KORVATTU REPLACED MUUTOS REVISIONS Konelab 30, 30i 48407597 - 4152 CABLE CHART / SYRINGES AND PUMPS NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES K122 XP3 MOTOR ID 66 ISE DILUENT PUMP (only in 30i) XP7 K123 MB 1-9 (4) Diluenttipumppu vaihdettu. Diluent pump changed. 123Konelab MERKKI MARK K100 XP2 MOTOR ID 65 ISE SYRINGE (only in 30i) XP7 K87 OPTO ISE (ONLY IN 30i) TEKI DRAWN JHen KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE 15.10.98 K187 ISE ID 48 XP4 M-FILMI M-FILM 4101 C 48408374 6.3.98 JHen 17.3.98 JHen 18.3.98 JN HYV. APPR. JN Version I Cable Charts 3-53 X P1 CONN 1-8 XP2 Figure 3-48 Syringes and pumps (30,30i) Konelab Service Manual 48953054-4081 (600) 7 XP 1 7 1 (600) K166 2 XP XP2 1 XP2 XP7 XP2 XP7 XP9 MOTOR ID 23 CUVETTE LOADER K164 XP3 XP3 c KORVAA REPLACES 8 / 19 NIMI NAME MUUTOS REVISIONS Konelab 30, 30i 48407597 - 4152 CABLE CHART / INCUBATOR AND MEASURING CHANNEL LIITTYY ASSOCIATES LIITTYY ASSOCIATES TEMP1 ID 40 K223 MB 1-9 (2) K226 TEKI DRAWN JHen KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE 16.06.99 M-FILMI M-FILM 4101 C 48408374 6.3.98 JHen 17.3.98 JHen 18.3.98 JN HYV. APPR. JN Cable Charts KORVATTU REPLACED LEHTI SHEET 123Konelab MERKKI MARK REF. K225 K18 muutettu ---> K284. K18 changed ---> K284. (600) K235 K219 MOTOR ID 24 INCUB. XP7 MB 1-9 (1) K217 NN CO 1-6 CONN XP2 MOTOR ID 21 MEASCH. (600) K222 K220 XP2 1 XP1 CO NN 1-6 K224 K17 K221 XP2 INOUT ID 32 (700) K240 1-8 XP2 7 (600) K165 XP1 CONN XP1 K284 1 7 K83 K218 XP4 MB 1-9 (2) K168 XP2 CO NN 1- 6 XP 1 K167 XP1 K84 7 XP2 XP 1 PHOTO ID 126 1 Konelab Service Manual CO NN 1-6 1-6 Jumper JP1-JP2 XP 2 3-54 Version I SIG. Figure 3-49 Incubator and measuring channel (30,30i) November 2, 2003 November 2, 2003 K216 POWCAN XP9 XP2 1-6 CONN XP1 7 XP1 7 1 (1500) K251 XP2 1-6 CONN 1 K59 K124 K125 K114 HEDS 48953054-4081 K129 K67 XP3 XP2 XP7 XP2 XP7 XP10 XP9 XP8 XP7 XP6 XP5 MB 1-3 (5) MOTOR ID 82 SEGMENT FEEDER K234 CUVETTE LOADER OPTO (600) K65 XP2 1 XP1 CONN 1-6 7 MB 1-9 (2) 9 / 19 KORVATTU REPLACED KORVAA REPLACES MOTOR ID 33 REAGENT STORAGE NIMI NAME MUUTOS REVISIONS Konelab 30, 30i 48407597 - 4152 CABLE CHART / STORAGES LIITTYY ASSOCIATES LIITTYY ASSOCIATES K113 K215 Z SUHDE SCALE PVM DATE 10.2.99 LAJI CLASSIF. KOODI CODE HYV. APPR. TARK. CHECKED PIIRT. DRAWN TEKI DRAWN JHen M-FILMI M-FILM 4101 C 48408374 6.3.98 JHen 17.3.98 JHen 18.3.98 JN HYV. APPR. K215 POWCAN XP8 XP3 REAGENT STORAGE XP5 LEHTI SHEET K112 K206 muutettu ---> K253. K206 changed ---> K253. 123Konelab MERKKI MARK b INOUT ID 32 K111 K64 HEDS XP10 XP9 XP8 XP7 XP6 MOTOR ID 81 SAMPLE STORAGE K66 K207 K167 K168 CUVETTES IN STORAGE OPTO K63 XP7 INOUT ID 34 (600) 7 XP 1 NN CO 1-6 K229 (1500) 1 CO NN K253 XP 2 1-6 K205 K228 XP1 XP2 MB 1-9 (2) (1500) K252 XP4 K61 SAMPLE STORAGE Version I Cable Charts 3-55 7 XP 2 1 Figure 3-50 Storages (30,30i) Konelab Service Manual Konelab Service Manual 48953054-4081 K80 XP2 MB 1-3 (5) MOTOR ID 80 FILTER DISK XP7 K78 1-6 7 XP2 CONN XP1 1 K77 CHOPPER MOTOR (600) K79 XP3 K81 XP5 K241 XP4 K82 LAMP HOUSE PHOTO ID 126 XP4 10 / 19 KORVAA REPLACES NIMI NAME CABLE CHART / LAMP HOUSE AND WATER DETECTORS LIITTYY ASSOCIATES MUUTOS REVISIONS Konelab 30, 30i 48407597 - 4152 DILUENT TEKI DRAWN JHen KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE 10.2.99 HYV. APPR. M-FILMI M-FILM 4101 C 48408374 6.3.98 JHen 17.3.98 JHen 18.3.98 JN Cable Charts KORVATTU REPLACED LEHTI SHEET LIITTYY ASSOCIATES Lampputalon kuvaa muutettu. Lamphouse redrawn. K204 123Konelab MERKKI MARK b MB 1-9 (2) INOUT ID 34 XP3 K203 WASTE 3-56 Version I Figure 3-51 Lamp house and water detectors (30,30i) November 2, 2003 +28V + - November 2, 2003 - K192 RE2 POWER UNIT 48953054-4081 11 / 19 + NIMI NAME CABLE CHART / BATTERIES LIITTYY ASSOCIATES MUUTOS REVISIONS Konelab 30, 30i 48407597 - 4152 + K191 KORVAA REPLACES KORVATTU REPLACED K195 LIITTYY ASSOCIATES BATTERY 1 LEHTI SHEET MERKKI MARK BATTERY 2 123Konelab Z SUHDE SCALE PVM DATE TEKI DRAWN LAJI CLASSIF. KOODI CODE HYV. APPR. TARK. CHECKED PIIRT. DRAWN M-FILMI M-FILM 4101 C 48408374 6.3.98 JHen 17.3.98 JHen 18.3.98 JN HYV. APPR. Version I Cable Charts 3-57 F1 POWCAN B A K193 B RE1 A K194 Figure 3-52 Batteries (30,30i) Konelab Service Manual Konelab Service Manual 48953054-4081 CAN BUS POWCAN XP1 K163 ETHERNET PCCAN K75 CONNECTOR PANEL CAN 1 1 red red red blue black black black black brown yellow red white 1 1 MICRO FLOPPY DISK HARD DISK MAIN BOARD PROCESSOR FAN MICRO FLOPPY HARD DISK POWCAN - PC -cable FAN 12 / 19 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES MUUTOS REVISIONS Konelab 30, 30i 48407597 - 4152 CABLE CHART / INTERNAL PC (MASTER) LIITTYY ASSOCIATES K178 TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE POWCAN XP10 HYV. APPR. M-FILMI M-FILM 4101 C 48408374 6.3.98 JHen 17.3.98 JHen 18.3.98 JN POWER TO DRIVE UNIT AND INTERNAL PC Cable Charts KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab K177 FAN FILTERS 3-58 Version I Figure 3-53 Internal PC (master) (30,30i) November 2, 2003 November 2, 2003 red 1 w hite-yellow 3 black 5 w hite-orange 7 2 red-w hite 4 yellow 6 w hite-black 8 orange PAC IFIC SC IEN TIFIC 1.8° M 21N R XE 1,01A yellow 3 orange 5 4 red 6 brow n ESC AP P110 -064 -015 red-w hite 3 green 5 4 red 6 green-w hite red-w hite 3 green 5 4 red 6 green-w hite SO N C EBO Z 6600 R .158 1.3A /Ph 48953054-4081 5 6 1 2 7 8 1 2 K O R V A A K O R V A T T U 1 3 / 1 9 R E P L A C E S R E P L A C E D L E H T I S H E E T A S S O C IA T E S A S S O C IA T E S N IM I N A M E L IIT T Y Y L IIT T Y Y 2 black 4 red-w hite 6 black-w hite 8 green 1 2 3 K o n e la b M E R K K I M A R K SU R F/H ED S 1 TILT 2 SU R F/C H A 3 SU R FO SC 4 G ND 5 VD D 6 LED 7 LED /C H B 8 -5V O PTO 1 LED 2 G ND 3 VD D 4 G ND 5 O PT 6 N C /+28V M O TO R 1 O U TB2 2 O U TB1 3 O U TB2 4 O U TB1 5 O U TA2 6 O U TA1 7 O U TA2 8 O U TA1 red 1 w hite 3 green-w hite 5 orange 7 SO N C EBO Z 6500 R .497 1A /Ph M olex 90142-0008 D ualR ow C -G rid IIIC rim p C onnectorH ousing 90119-2110 Fem ale C rim p Term inal 90119-0110 Fem ale C rim p Term inal) SO N C EBO Z 1.4A /Ph 2.6 9 (C onnector: Term inal: M O TO R C O N N EC TIO N S TO XP7,VIEW FR O M C A B LE SID E 4 yellow 6 red R E V IS IO N S C A B L E C H A R T / M O T O R K o n e la b 3 0 , 3 0 i 4 8 4 0 7 5 9 7 - 4 1 5 2 M U U T O S D A T E Z S U H D E S C A L E P V M L A J I C L A S S IF . K O O D I C O D E H Y V . A P P R . T A R K . C H E C K E D P IIR T . D R A W N T E K I D R A W N H Y V . A P P R . M -F IL M I M -F IL M 6 .3 .9 8 J H e n 1 7 .3 .9 8 J H e n 1 8 .3 .9 8 J N 4 1 0 1 C 4 8 4 0 8 3 7 4 SU R F (liquid detector,needle tilt)/ H ED S (feedback opto) O PTO 2 23 cuvette loader(back) 82 Segm ent(in storage) 66 ISE LIQ D ET O PTO 1 (zero point) 23 C uvette loader(m iddle) PAR AL.(m otorw indings) SER IAL (m otorw indings) 18 D iluentpum p w hite 3 green 5 SO N C EBO Z LIN EAR AC TU ATO R 7214 R 005 8.8V 46 9 Version I Cable Charts 3-59 Figure 3-54 Motor (30,30i) Konelab Service Manual Konelab Service Manual GND VDD1 48953054-4081 14 / 19 KORVAA REPLACES 1 2 3 1 2 3 NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES XP4 1 MEASGND 2 RES23 RES2+ 4 CH4IN 5 RES26 RES2+ MUUTOS REVISIONS CABLE CHART / TEMP Konelab 30, 30i 48407597 - 4152 (THERM 4-6) RES2 40 MeasCh (THERM 1-3) TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE (TEMP1) RES1 40 Incub (TEMP1), 49 ISE block (TEMP2) HYV. APPR. M-FILMI M-FILM 4101 C 48408374 6.3.98 JHen 17.3.98 JHen 18.3.98 JN Cable Charts KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab 4 5 6 4 5 6 XP2 1 MEASGND 2 RES13 RES1+ 4 CH1IN 5 RES16 RES1+ 3-60 Version I Figure 3-55 Temp (30,30i) November 2, 2003 November 2, 2003 1 2 3 5 6 6 2 4 5 1 48953054-4081 15 / 19 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK 1 123Konelab XP8 1 +28V 2 GND 3 GND 4 GND 5 GND 6 GND XP6, 7 1 CANA 2 CANA 3 CANB 4 CANB XP4 1 GND 2 MOT+ 3 GND 4 +5VCH 5 +5VCH 6 NC XP5 1 NC 2 LAMP+ 3 GND 4 NC 5 +15VM 6 - 15VM XP3 1 CHOPLED 2 GND 3 +5VCH 4 GND 5 CHOPSYNC 6 AGND XP1, XP2 1 +12V 2 -12V 3 CH S / R 4 GNDSENS 5 PREGAIN 6 AGND NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MUUTOS REVISIONS CABLE CHART / PHOTO Konelab 30, 30i 48407597 - 4152 POWER CAN CAN LAMP POWER CHOPPER MOTOR SYNC OPTO PHOTREF (reference channel) TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE PHOTSIG Jumper JP1-JP2 (signal channel) M-FILMI M-FILM 4101 C 48408374 6.3.98 JHen 17.3.98 JHen 18.3.98 JN HYV. APPR. Version I Cable Charts 3-61 Figure 3-56 Photo (30,30i) Konelab Service Manual Konelab Service Manual VDD1 GND XP10 1 TXD 2 SUPPLYGND 3 TRIGGER 4 SIGNALGND 5 RXD 6 +5V 7 BCR_RESET 8 +12VRS 8 2 6 1 5 2 7 1 48953054-4081 Bar Code Reader XP6, 7, 8, 9 1AA 2 GND 3 +5V 4 GND 5 IN A_C 6 NC /+28VP XP3, 4, 5 1AB 2 GND 3 +5V 4 GND 5 IN B_C 6 NC /+28VP XP2 1 LED1A 2 GND 3 LED2A 4 GND 5 LED3A 6 GND 7 LED4A 8 GND 2 / ID34 Segm. GLED Segm. RLED Stat GLED Stat RLED 16 / 19 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MUUTOS REVISIONS CABLE CHART / INOUT Konelab 30, 30i 48407597 - 4152 TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM 4101 C 48408374 6.3.98 JHen 17.3.98 JHen 18.3.98 JN Cable Charts KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab 1 / 32 Cuvettes in Storage Opto 2 / 34 Segment Loader Opto 1 / 32 Cuvette Loader Opto 2 / 34 Segment Cover Opto IN3A IN4A 1 / 32 Reagent Cover Opto 2 / 34 Stat Cover Opto 1 / 32 Reagent Storage Cover Opto 2 / 34 Sample Storage Cover Opto 2 / 34 Water (Diluent) Detector 1 / 32 MeasCh Reflective Object Sensor 2 / 34 Waste Detector 1 / ID32 Cuv. GLED Cuv. RLED Reag. GLED Reag. RLED IN2A IN1A IN3B IN2B IN1B LEDS 3-62 Version I Figure 3-57 INOUT (30,30i) November 2, 2003 November 2, 2003 VDD1 GND A (only in 30i) 2 6 1 5 1 48953054-4081 17 / 19 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab XP5 1 VDD1TEST 2 +15VTEST 3 - 15VTEST 4 +5VTEST 5 - 5VTEST 6 GND XP4 1 LIQEDETOUT 2 LIQEDETOUT 3 LIQEDETOUT 4 LIQEDETOUT 5 GND 6 GND XP3 1 BS1P 2 BS2P 3 BS3P 4 BS4P 5 +12VBS 6 A GND XP2 1 DETACK1KB 2 DETON 3 DETLED 4 DETOUT 5 MUX1P 6 MUX2P 7 MUX3P 8 MUX4P 9 AGND 10 SIGIN 11 GNDSENSE 12 VREF+ 13 VREF14 +12VP 15 -12VP NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MUUTOS REVISIONS CABLE CHART / ISE Konelab 30, 30i 48407597 - 4152 TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE LIQ DET BLK SIM PREAMP (ISEAMP) M-FILMI M-FILM 4101 C 48408374 6.3.98 JHen 17.3.98 JHen 18.3.98 JN HYV. APPR. Version I Cable Charts 3-63 Figure 3-58 ISE Konelab Service Manual XP10 11 NC 1 NC 12 -12VM 2 NC 13 GND 3 GND 14 NC 4 +5VM 15 GND 5 GND 16 GND 6 +5VM 17 GND 7 GND 18 - 5VM 8 POWERGOOD 19 + 5VM 9 +5VM 20 +5VM 10 +12VM Konelab Service Manual K214 XP7 1 +28V 2 GND 3 GND 4 GND 5 GND 6 GND XP6 1 GND 2 +5V1TEST 3 VDD5V1TEST 4 +19VTEST 5 - 19VTEST 6 VDIFFTEST 7 VAVETEST 8 VADJTEST K197 XP5 1 NC 2 NC 3 MAINSW+ 4 MAINSW5 NC 6 NC b 1 RE2 1 B A F1: COOLING (STORAGES) RE1 POWER UNIT +28V K194 48953054-4081 18 / 19 NIMI NAME CABLE CHART / POWCAN 2 1 KORVAA REPLACES MUUTOS REVISIONS Konelab 30, 30i 48407597 - 4152 TEKI DRAWN JHen KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE 10.2.99 HYV. APPR. M-FILMI M-FILM 4101 C 48408374 6.3.98 JHen 17.3.98 JHen 18.3.98 JN Cable Charts KORVATTU REPLACED LIITTYY ASSOCIATES LIITTYY ASSOCIATES 4 123Konelab 1 LEHTI SHEET K149 K163 5 1 Lis„tty tietoa sulakkeista F1-F3. Added information for F1-F3. XP1, 2 1 CANA 2 CANA 3 CANB 4 CANB 8 7 MERKKI MARK T6.3A K189 K58 F2 XP3 1 +28V 2 GND 3 GND 4 GND 5 GND 6 GND XP4 1 NC 2 NC 3 POWFAIL+ 4 POWFAIL5 NC 6 NC 6 2 T3.15A K215 XP8 1 GND 2 PELTIER23 PELTIER2+ 4 THERM2 5 PELTIER26 PELTIER2+ F1 3 F3 K216 XP9 1 GND 2 PELTIER13 PELTIER1+ 4 THERM1 5 PELTIER16 PELTIER1+ 3-64 Version I 1 1 T6.3A 1 B A 1 F1 F2: POWCAN, CAN BUS, K193 INTERNAL PC POWER F3: CHARGING (BATTERIES) Figure 3-59 Powcan (30,30i) November 2, 2003 48953054-4081 K209 K234 IO 32 XP8, XP2 IO 34 XP2 XP2 XP1 XP1 XP3 A D3 XP3 LED1-1 XP2 TRI COLOR LED D3 XP1 XP2 D2 XP3 C D1 B XP2 XP1 LED1-2 XP3 Cathode CUVETTE COVER OPTO K208 XP1 C XP2 D2 XP3 C D1 C D1 D2 K233 GREEN RED 19 / 19 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK XP1 123Konelab D XP2 XP3 November 2, 2003 D3 NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES CABLE CHART / COVERS Konelab 30, 30i 48407597 - 4152 MUUTOS REVISIONS LED1-1 TRI COLOR LED TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE M-FILMI M-FILM 4101 C 48408374 6.3.98 JHen 17.3.98 JHen 18.3.98 JN HYV. APPR. Version I Cable Charts 3-65 Figure 3-60 Covers (30,30i) Konelab Service Manual 3-66 Konelab Service Manual Cable Charts 48953054-4081 Version I November 2, 2003 123Konelab thermistors TEMP *1 in 30 with Kusti (*2 in 30i with Kusti) - heatings - 2 channels +28V MERKKI MARK +28V LAJI CLASSIF. 4101 48414988 KOODI CODE Z HYV. APPR. SUHDE SCALE CABLE CHART / BLOCK DIAGRAM NIMI NAME position feedback KORVAA REPLACES MUUTOS REVISIONS MOTOR *18 in 30 with Kusti (*23 in 30i with Kusti) LIITTYY ASSOCIATES limit switches LIITTYY ASSOCIATES CAN BUS 1 /20 Windows NT Termination LEHTI SHEET WORKSTATION SURF *2 in 30 with Kusti (*3 in 30i with Kusti) Konelab 30, 30i with Kusti ANALYZER KORVATTU REPLACED PVM DATE PIIRT. DRAWN TEKI DRAWN HYV. APPR. M-FILMI M-FILM 3-67 20.09.99 JHen Cable Charts TARK. CHECKED Version I Ethernet PCCAN - CAN interface - termination INTERNAL PC (MASTER) - hard disk, floppy disk - controls all nodes via CAN BUS MAINS INPUT + 5V - 5V +12V -12V PHOTSIG *1 PHOTO *1 - ADC - lamp control - chopper drive PHOTREF *1 POWCAN *1 +28V - power supply monitoring - battery control - CAN-bus bias - coolings control status POWER MODULE - mains switch - line filter - 100 - 230 VAC input - 28 VDC output +28V +28V Batteries ISEAMP * 1 limit switches INOUT * 2 ISE * 1 (in 30i with Kusti) - ADC - liquid detection - digital I/O - analog inputs - RS232 interfaces - LED, button etc. interfaces +28V LEDS +28V RS232 Bar code readers Figure 3-61 Block diagram (30, 30i Kusti) November 2, 2003 48953054-4081 Konelab Service Manual J P 7 J P 5 J P 3 J P 1 T P 1 J P 8 J P 6 J P 4 J P 2 X P 2 X P 5 21 M EAS C H AN N EL 19 M IXER W ASH 18 D ILU EN T PU M P Konelab Service Manual 48953054-4081 T P 1 J P 8 J P 6 J P 4 J P 2 X P 7 65 ISESYR 64 ISE . 50 ISE Y 49 TEM P 2 48 ISE X P 4 K O R V A A 2 /2 0 R E P L A C E S R E P L A C E D A S S O C IA T E S N IM I N A M E L IIT T Y Y M U U T O S T P 1 R E V IS IO N S J P 7 J P 5 J P 3 J P 1 J P 8 J P 6 J P 4 J P 2 X P 3 X P 2 M B1-3 5 C A B L E C H A R T / R A C K S K o n e la b 3 0 , 3 0 i w ith K u s ti 37 M IXER A S S O C IA T E S X P 4 X P 6 X P 8 X P 9 D A T E Z S U H D E S C A L E P V M X P 5 X P 7 T E K I D R A W N H Y V . A P P R . L A J I C L A S S IF . K O O D I C O D E M -F IL M I M -F IL M 4 1 0 1 4 8 4 1 4 9 8 8 H Y V . A P P R . 2 0 .0 9 .9 9 J H e n T A R K . C H E C K E D P IIR T . D R A W N X P 1 1 X P 1 3 Cable Charts K O R V A T T U L IIT T Y Y X P 5 X P 7 X P 1 80 FILTER D ISK L E H T I S H E E T M E R K K I M A R K J P 8 J P 6 J P 4 J P 2 1 2 3 K o n e la b T P 1 113 KustiD ISPEN SER . X P 5 X P 6 J P 7 J P 5 J P 3 J P 1 X P 3 114 KustiFM IPU M P X P 2 M B1-3 6 X P 7 81 SAM PLE STO R AG E X P 4 X P 6 X P 1 X P 6 82 SEG M EN T FEED ER X P 5 X P 7 J P 8 J P 6 J P 4 J P 2 X P 2 T P 1 X P 3 66 ISED ILP X P 1 J P 7 J P 5 J P 3 J P 1 M B1-3 4 R AC K2 X P 3 36 M IXER . X P 2 X P 5 M B1-9 2 38 D ISPEN SER Y J P 7 J P 5 J P 3 J P 1 23 C U VETTE LO AD ER X P 1 0 X P 1 2 J P 8 J P 6 J P 4 J P 2 32 IN O U T 1 X P 1 1 X P 1 3 T P 1 X P 1 J P 7 J P 5 J P 3 J P 1 X P 4 X P 3 X P 2 33 R STO R AG E O N LY IN 30i X P 9 24 IN C U BATO R X P 8 34 IN O U T 2 M B1-3 3 X P 7 40 TEM P 1 X P 4 X P 6 X P 6 39 D ISPEN SER . X P 1 M B1-9 1 X P 4 126 PH O TO 20 ISE W ASH X P 3 35 M IXER Y X P 1 0 X P 1 2 X P 1 3-68 Version I 112 KustiD ISPEN SER Y R AC K4 R AC K3 124 PO W C AN 16 SYR IN G E R AC K1 Figure 3-62 Racks (30, 30i Kusti) November 2, 2003 XP3 K173 November 2, 2003 48953054-4081 28V XP12 XP10 28V XP12 CAN XP10 MB 1-9 1 CAN TERMINATION K171 28V MB 1-9 2 XP13 XP11 CAN XP13 XP11 K154 REAGENT STORAGE 28V CAN R1 K157 K156 XP1 +28V + 28V K186 K189 K214 K155 PHOTO K153 K149 K162 POWCAN XP2 K180 K179 K158 28V CAN XP7 XP6 GND + 24V XP2 K161 K188 XP8 CAN K176 K152 XP5 XP7 28V 3 3 /20 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET 123Konelab MERKKI MARK FANS IN BACK PANEL K175 XP6 MB 1-3 CAN XP4 (Only in 30i) K151 STORAGE SAMPLE NIMI NAME 28V 28V 28V 28V 28V 5 XP6 4 XP7 XP6 6 XP7 XP6 XP4 Konelab 30, 30i with Kusti MUUTOS REVISIONS CAN XP4 MB 1-3 XP5 CAN CAN XP4 MB 1-3 XP5 CAN CAN XP4 XP7 CABLE CHART / POWER, CAN AND FAN CABLES LIITTYY ASSOCIATES LIITTYY ASSOCIATES K159 28V CAN 28V MB 1-3 XP5 CAN TO PC FAN K177 K178 HOUSE LAMP K174 TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE K172 HYV. APPR. M-FILMI M-FILM 4101 48414988 20.09.99 JHen Version I Cable Charts 3-69 Figure 3-63 Power, can and fan cables (30, 30i Kusti) Konelab Service Manual Konelab Service Manual black black K199 2 6 48953054-4081 N black 4 K200 red S1 3 red K196 black red N L KORVAA REPLACES 4 /20 KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab 0V 28V NIMI NAME MUUTOS REVISIONS Konelab 30, 30i with Kusti TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE POWCAN XP4 POWCAN RE2/B XP1 XP1 FRAME BATTERY 2 - CABLE CHART / CONNECTOR PANEL AND POWER UNIT LIITTYY ASSOCIATES LIITTYY ASSOCIATES K58 K186 K194 K155 K192 K162 POWCAN XP5 (mainsw) HYV. APPR. M-FILMI M-FILM 4101 48414988 20.09.99 JHen Cable Charts TO INTERNAL PC TO INTERNAL PC shield red black POWER UNIT 4 Powfail3 Powfail+ K75 (ETHERNET) WORK STATION TO LABORATORY AUTOMATION SYSTEM K197 1 L 1 5 red K198 CONNECTOR PANEL 3-70 Version I Figure 3-64 Connector panel and power unit (30, 30i Kusti) November 2, 2003 O P T O November 2, 2003 X P 3 S U R F X P 2 K 1 0 4 48953054-4081 XP1 CO N N 1-8 XP1 K (6 0 0 ) 2 4 3 CO NN 1-8 XP2 M B 1 -9 (2 ) M O T O R ID 3 8 D IS P . Y (1 5 0 ) 2 K 2 3 7 XP XP1 K 8 8 Y -M O V H E D S M O T O R ID 3 9 D IS P . B K 1 1 6 1 7 NN CO 1 1-6 XP K 8 9 B -M O V X P 7 X P 2 X P 5 (6 0 0 ) K 2 8 1 XP2 XP2 7 CO NN 1-6 1 Y -O P T O K 1 0 3 X P 1 X P 7 X P 2 X P 5 (1 5 0 ) K 2 3 6 B -O P T O D IS P E N S E R K 1 1 K 1 0 K 1 2 T O C H A S S IS X P 2 X P 4 K 1 8 7 T O R 6 6 D IL P 3 IS E ID 4 8 ( o n ly in 3 0 i) K 1 8 4 M O ID IS E X P K 1 8 5 T O C H A S S IS M B 1 -3 (3 ) T E M P 2 ID 4 9 IS E ( o n ly in 3 0 i) X P 2 K 1 8 3 B -O P T O Y -O P T O K 1 0 5 K O R V A A K O R V A T T U 5 /2 0 R E P L A C E S R E P L A C E D L E H T I S H E E T M E R K K I M A R K 1 2 3 K o n e la b K 1 8 2 S U R F X P 3 K 1 1 7 R E V IS IO N S M B 1 -3 (4 ) M O T O R ID 6 4 IS E D IS P . B ( o n ly in 3 0 i) K o n e la b 3 0 , 3 0 i w ith K u s ti M U U T O S K 1 0 6 X P 7 X P 2 X P 5 K 9 3 C A B L E C H A R T / D IS P E N S E R S A S S O C IA T E S N IM I N A M E L IIT T Y Y L IIT T Y Y M O T O R ID 5 0 IS E D IS P . Y ( o n ly in 3 0 i) A S S O C IA T E S K 1 8 3 X P 7 X P 2 X P 5 K 9 2 Y -M O V H E D S B -M O V X P 2 K 1 8 1 IS E D IS P E N S E R (O N LY IN 30i) X P 1 IS E A M P D A T E Z S U H D E S C A L E P V M O P T O T E K I D R A W N P IIR T . D R A W N H Y V . A P P R . L A J I C L A S S IF . K O O D I C O D E M -F IL M I M -F IL M 4 1 0 1 4 8 4 1 4 9 8 8 H Y V . A P P R . 2 0 .0 9 .9 9 J H e n T A R K . C H E C K E D Version I Cable Charts 3-71 Figure 3-65 Dispensers (30, 30i Kusti) Konelab Service Manual Konelab Service Manual 48953054-4081 M O T O R ID 3 7 M IX E R K 1 4 X P 7 Y -O P T O B M B 1 -9 (2 ) M O T O R ID 3 6 M IX E R K 9 7 K 1 1 0 X P 7 X P 2 B -O P T O M IX E R 7 Y -M O V XP2 XP2 M O T O R ID 3 5 M IX E R Y K 9 6 K 1 4 X P 7 X P 2 X P 3 K 1 0 9 1 7 1 B -M O V XP1 XP1 K 1 3 K 1 5 O P T O K O R V A A 6 /2 0 R E P L A C E S R E P L A C E D A S S O C IA T E S A S S O C IA T E S N IM I N A M E L IIT T Y Y L IIT T Y Y M U U T O S R E V IS IO N S C A B L E C H A R T / M IX E R K o n e la b 3 0 , 3 0 i w ith K u s ti D A T E Z S U H D E S C A L E P V M T E K I D R A W N P IIR T . D R A W N H Y V . A P P R . L A J I C L A S S IF . K O O D I C O D E M -F IL M I M -F IL M 4 1 0 1 4 8 4 1 4 9 8 8 H Y V . A P P R . 2 0 .0 9 .9 9 J H e n T A R K . C H E C K E D Cable Charts K O R V A T T U L E H T I S H E E T M E R K K I M A R K 1 2 3 K o n e la b 3-72 Version I Figure 3-66 Mixer (30, 30i Kusti) November 2, 2003 November 2, 2003 48953054-4081 K 2 9 0 M B 1 -3 (6 ) M O T O R ID 1 1 2 K U S T I D IS P . Y K 2 9 1 M O T O R ID 1 1 4 K U S T I D IL U E N T P U M P K 2 9 2 X P 7 X P 2 X P 5 K 2 9 4 X P 6 X P 2 K 2 9 3 B -O P T O T O K 2 8 8 M O T O R ID 1 1 3 K U S T I D IS P . B Y -M O V H E D S B -M O V K 2 8 7 X P 7 X P 2 X P 5 K 2 8 9 Y -O P T O K 2 6 C H A S S IS X P 1 X P 2 X P 3 S U R F M E R K K I M A R K K O R V A A K O R V A T T U 7 /2 0 R E P L A C E S R E P L A C E D L E H T I S H E E T 1 2 3 K o n e la b O P T O A S S O C IA T E S A S S O C IA T E S N IM I N A M E L IIT T Y Y L IIT T Y Y M U U T O S R E V IS IO N S C A B L E C H A R T / K U S T I K o n e la b 3 0 , 3 0 i w ith K u s ti D A T E Z S U H D E S C A L E P V M T E K I D R A W N P IIR T . D R A W N H Y V . A P P R . L A J I C L A S S IF . K O O D I C O D E M -F IL M I M -F IL M 4 1 0 1 4 8 4 1 4 9 8 8 H Y V . A P P R . 2 0 .0 9 .9 9 J H e n T A R K . C H E C K E D Version I Cable Charts 3-73 Figure 3-67 Kusti (30, 30i Kusti) Konelab Service Manual Konelab Service Manual 48953054-4081 MB 1-9 (1) MOTOR ID 19 MIXER WASH XP7 (700) K238 (700) K239 K119 MOTOR ID 20 ISE WASH (only in 30i) XP7 2 XP2 K246 XP MOTOR ID 18 DILUENT PUMP K245 XP6 NN CO 1-8 XP2 K99 1 XP MOTOR ID 16 SYRINGE K86 XP7 OPTO KORVAA REPLACES 8 /20 Konelab 30, 30i with Kusti MUUTOS REVISIONS MB 1-9 (4) CABLE CHART / SYRINGES AND PUMPS NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES K122 XP3 MOTOR ID 66 ISE DILUENT PUMP (only in 30i) XP7 K123 TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE K187 ISE ID 48 XP4 HYV. APPR. M-FILMI M-FILM 4101 48414988 20.09.99 JHen Cable Charts KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab K100 XP2 MOTOR ID 65 ISE SYRINGE (only in 30i) XP7 K87 OPTO ISE (ONLY IN 30i) 3-74 Version I XP1 CONN 1-8 XP 2 Figure 3-68 Syringes and pumps (30, 30i Kusti) November 2, 2003 48953054-4081 (600) 7 1 XP 1 (600) K166 2 XP XP2 1 XP2 XP7 XP2 XP7 XP9 MOTOR ID 23 CUVETTE LOADER K164 (600) K235 K219 XP3 XP3 9 /20 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK REF. K225 123Konelab MOTOR ID 24 INCUB. XP7 MB 1-9 (1) K217 7 NN CO 1-6 CONN XP2 MOTOR ID 21 MEASCH. (600) K222 K220 XP2 1 XP1 CO NN 1-6 K224 K17 K221 NIMI NAME MUUTOS REVISIONS Konelab 30, 30i with Kusti CABLE CHART / INCUBATOR AND MEASURING CHANNEL LIITTYY ASSOCIATES LIITTYY ASSOCIATES TEMP1 ID 40 K223 MB 1-9 (2) K226 XP2 INOUT ID 32 (700) K240 1-8 XP2 7 (600) K165 XP1 CONN XP1 K284 1 7 K83 K218 XP4 MB 1-9 (2) K168 XP 2 CON N 1-6 XP1 K167 XP1 K84 7 XP2 XP 1 PHOTO ID 126 1 November 2, 2003 CO NN 1-6 1-6 Jumper JP1-JP2 XP 2 TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM 4101 48414988 20.09.99 JHen Version I Cable Charts 3-75 SIG. Figure 3-69 Incubator and measuring channel (30, 30i Kusti) Konelab Service Manual Konelab Service Manual K216 POWCAN XP9 CONN XP1 7 XP1 XP2 1-6 7 1 (1500) K251 CONN 1 K59 K124 K125 K114 HEDS 48953054-4081 K129 K67 XP3 XP2 XP7 XP2 XP7 XP10 XP9 XP8 XP7 XP6 XP5 MB 1-3 (5) MOTOR ID 82 SEGMENT FEEDER K234 CUVETTE LOADER OPTO (600) K65 XP2 1 XP 1 CONN 1-6 7 KORVAA REPLACES 10 /20 NIMI NAME MUUTOS REVISIONS CABLE CHART / STORAGES Konelab 30, 30i with Kusti Z SUHDE SCALE PVM DATE LAJI CLASSIF. KOODI CODE HYV. APPR. TARK. CHECKED PIIRT. DRAWN TEKI DRAWN M-FILMI M-FILM 4101 48414988 20.09.99 JHen HYV. APPR. K215 POWCAN XP8 Cable Charts KORVATTU REPLACED LIITTYY ASSOCIATES LIITTYY ASSOCIATES K113 K215 XP3 REAGENT STORAGE XP5 LEHTI SHEET K112 MOTOR ID 33 REAGENT STORAGE MB 1-9 (2) 123Konelab MERKKI MARK INOUT ID 32 K111 K64 HEDS XP10 XP9 XP8 XP7 XP6 MOTOR ID 81 SAMPLE STORAGE K66 K207 K167 K168 CUVETTES IN STORAGE OPTO K63 XP7 INOUT ID 34 (600) 7 XP 1 N CON 1-6 K229 (1500) 1 CO NN K253 XP 2 1-6 K205 K228 XP 1 XP2 MB 1-9 (2) (1500) XP2 1-6 K252 XP4 K61 SAMPLE STORAGE 3-76 Version I 7 XP 2 1 Figure 3-70 Storages (30, 30i Kusti) November 2, 2003 November 2, 2003 48953054-4081 7 (600) K279 1 XP2 XP2 MB 1-3 (5) MOTOR ID 80 FILTER DISK XP7 K78 XP1 CONN 1-6 K80 1-6 7 XP2 CONN XP1 1 K77 CHOPPER MOTOR 1-6 XP2 CONN XP1 1 7 K79 (600) XP3 K81 XP5 K241 XP4 (600) K280 K82 LAMP HOUSE PHOTO ID 126 XP4 K204 11 /20 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET 123Konelab MERKKI MARK MB 1-9 (2) INOUT ID 34 XP3 K203 WASTE NIMI NAME MUUTOS REVISIONS Konelab 30, 30i with Kusti CABLE CHART / LAMP HOUSE AND WATER DETECTORS LIITTYY ASSOCIATES LIITTYY ASSOCIATES DILUENT TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM 4101 48414988 20.09.99 JHen Version I Cable Charts 3-77 Figure 3-71 Lamp house and water detectors (30, 30i Kusti) Konelab Service Manual - +28V Konelab Service Manual + - K192 RE2 POWER UNIT 48953054-4081 12 /20 KORVAA REPLACES + NIMI NAME CABLE CHART / BATTERIES Konelab 30, 30i with Kusti MUUTOS REVISIONS BATTERY 1 LIITTYY ASSOCIATES Z SUHDE SCALE PVM DATE TEKI DRAWN LAJI CLASSIF. KOODI CODE HYV. APPR. TARK. CHECKED PIIRT. DRAWN HYV. APPR. M-FILMI M-FILM 4101 48414988 20.09.99 JHen Cable Charts KORVATTU REPLACED K195 LIITTYY ASSOCIATES + K191 LEHTI SHEET MERKKI MARK BATTERY 2 123Konelab 3-78 Version I F1 POWCAN B A K193 B RE1 A K194 Figure 3-72 Batteries (30, 30i Kusti) November 2, 2003 November 2, 2003 48953054-4081 CAN BUS POWCAN XP1 K163 ETHERNET PCCAN K75 CONNECTOR PANEL CAN 1 1 red red red blue black black black black brown yellow red white 1 1 MICRO FLOPPY DISK HARD DISK MAIN BOARD PROCESSOR FAN MICRO FLOPPY HARD DISK POWCAN - PC -cable FAN 13 /20 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab NIMI NAME Konelab 30, 30i with Kusti MUUTOS REVISIONS K178 CABLE CHART / INTERNAL PC (MASTER) LIITTYY ASSOCIATES LIITTYY ASSOCIATES K177 FAN FILTERS TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE POWCAN XP10 HYV. APPR. M-FILMI M-FILM 4101 48414988 20.09.99 JHen POWER TO DRIVE UNIT AND INTERNAL PC Version I Cable Charts 3-79 Figure 3-73 Internal PC (master) (30, 30i Kusti) Konelab Service Manual Konelab Service Manual red 1 w hite-yellow 3 black 5 w hite-orange 7 2 red-w hite 4 yellow 6 w hite-black 8 orange PAC IFIC SC IEN TIFIC 1.8° M 21N R XE 1,01A yellow 3 orange 5 4 red 6 brow n ESC AP P110 -064 -015 red-w hite 3 green 5 4 red 6 green-w hite red-w hite 3 green 5 4 red 6 green-w hite SO N C EBO Z 6600 R .158 1.3A /Ph 48953054-4081 7 8 1 2 5 6 1 2 K O R V A A 1 4 /2 0 R E P L A C E S R E P L A C E D A S S O C IA T E S A S S O C IA T E S N IM I N A M E L IIT T Y Y L IIT T Y Y 4 yellow 6 red R E V IS IO N S C A B L E C H A R T / M O T O R K o n e la b 3 0 , 3 0 i w ith K u s ti M U U T O S D A T E Z S U H D E S C A L E P V M H Y V . A P P R . L A J I C L A S S IF . K O O D I C O D E H Y V . A P P R . M -F IL M I M -F IL M 4 1 0 1 4 8 4 1 4 9 8 8 2 0 .0 9 .9 9 J H e n T A R K . C H E C K E D P IIR T . D R A W N T E K I D R A W N SU R F (liquid detector,needle tilt)/ H ED S (feedback opto) O PTO 2 23 cuvette loader (back) 82 Segm ent(in storage) O PTO 1 (zero point) 23 C uvette loader(m iddle) PAR AL.(m otorw indings) SER IAL (m otorw indings) 18,114 D iluentpum p w hite 3 green 5 SO N C EBO Z LIN EAR AC TU ATO R 7214 R 005 8.8V 46 9 Cable Charts K O R V A T T U L E H T I S H E E T M E R K K I M A R K 2 black 4 red-w hite 6 black-w hite 8 green 1 2 3 K o n e la b SU R F/H ED S 1 TILT 2 SU R F/C H A 3 SU R FO SC 4 G ND 5 VD D 6 LED 7 LED /C H B 8 -5V O PTO 1 LED 2 G ND 3 VD D 4 G ND 5 O PT 6 N C /+28VP M O TO R 1 O U TB2 2 O U TB1 3 O U TB2 4 O U TB1 5 O U TA2 6 O U TA1 7 O U TA2 8 O U TA1 red 1 w hite 3 green-w hite 5 orange 7 SO N C EBO Z 6500 R .497 1A /Ph M olex 90142-0008 D ualR ow C -G rid IIIC rim p C onnectorH ousing 90119-2110 Fem ale C rim p Term inal 90119-0110 Fem ale C rim p Term inal) SO N C EBO Z 1.4A /Ph 2.6 9 (C onnector: Term inal: M O TO R C O N N EC TIO N S TO XP7,VIEW FR O M C A B LE SID E 3-80 Version I Figure 3-74 Motor (30, 30i Kusti) November 2, 2003 November 2, 2003 GND VDD1 48953054-4081 15 /20 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab 4 5 6 4 5 6 XP2 1 MEASGND 2 RES13 RES1+ 4 CH1IN 5 RES16 RES1+ 1 2 3 1 2 3 NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES XP4 1 MEASGND 2 RES23 RES2+ 4 CH4IN 5 RES26 RES2+ MUUTOS REVISIONS CABLE CHART / TEMP Konelab 30, 30i with Kusti (THERM 4-6) RES2 40 MeasCh (THERM 1-3) TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE (TEMP1) RES1 40 Incub (TEMP1), 49 ISE block (TEMP2) HYV. APPR. M-FILMI M-FILM 4101 48414988 20.09.99 JHen Version I Cable Charts 3-81 Figure 3-75 Temp (30, 30i Kusti) Konelab Service Manual Konelab Service Manual 1 2 3 5 6 6 2 4 5 1 48953054-4081 16 /20 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MUUTOS REVISIONS CABLE CHART / PHOTO Konelab 30, 30i with Kusti POWER CAN CAN LAMP POWER CHOPPER MOTOR SYNC OPTO PHOTREF (reference channel) TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE PHOTSIG Jumper JP1-JP2 (signal channel) HYV. APPR. M-FILMI M-FILM 4101 48414988 20.09.99 JHen Cable Charts KORVATTU REPLACED LEHTI SHEET MERKKI MARK 1 123Konelab XP8 1 +28V 2 GND 3 GND 4 GND 5 GND 6 GND XP6, 7 1 CANA 2 CANA 3 CANB 4 CANB XP4 1 GND 2 MOT+ 3 GND 4 +5VCH 5 +5VCH 6 NC XP5 1 NC 2 LAMP+ 3 GND 4 NC 5 +15VM 6 - 15VM XP3 1 CHOPLED 2 GND 3 +5VCH 4 GND 5 CHOPSYNC 6 AGND XP1, XP2 1 +12V 2 -12V 3 CH S / R 4 GNDSENS 5 PREGAIN 6 AGND 3-82 Version I Figure 3-76 Photo (30, 30i Kusti) November 2, 2003 November 2, 2003 VDD1 GND XP10 1 TXD 2 SUPPLYGND 3 TRIGGER 4 SIGNALGND 5 RXD 6 +5V 7 BCR_RESET 8 +12VRS 8 2 6 1 5 2 7 1 48953054-4081 Bar Code Reader XP6, 7, 8, 9 1AA 2 GND 3 +5V 4 GND 5 IN A_C 6 NC/+28VP XP3, 4, 5 1AB 2 GND 3 +5V 4 GND 5 IN B_C 6 NC/+28VP XP2 1 LED1A 2 GND 3 LED2A 4 GND 5 LED3A 6 GND 7 LED4A 8 GND 17 /20 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES CABLE CHART / INOUT Konelab 30, 30i with Kusti MUUTOS REVISIONS 1 / 32 Cuvettes in Storage Opto 2 / 34 Segment Loader Opto 1 / 32 Cuvette Loader Opto 2 / 34 Segment Cover Opto IN3A IN4A 1 / 32 Reagent Cover Opto 2 / 34 Stat Cover Opto 1 / 32 Reagent Storage Cover Opto 2 / 34 Sample Storage Cover Opto 2 / 34 Water (Diluent) Detector 1 / 32 MeasCh Reflective Object Sensor 2 / 34 Waste Detector 2 / ID34 Segm. GLED Segm. RLED Stat GLED Stat RLED IN2A IN1A IN3B IN2B IN1B LEDS 1 / ID32 Cuv. GLED Cuv. RLED Reag. GLED Reag. RLED TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM 4101 48414988 20.09.99 JHen Version I Cable Charts 3-83 Figure 3-77 INOUT (30, 30i Kusti) Konelab Service Manual Konelab Service Manual VDD1 GND A (only in 30i) 2 6 1 5 1 48953054-4081 18 /20 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MUUTOS REVISIONS CABLE CHART / ISE Konelab 30, 30i with Kusti TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE LIQ DET BLK SIM PREAMP (ISEAMP) HYV. APPR. M-FILMI M-FILM 4101 48414988 20.09.99 JHen Cable Charts KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab XP5 1 VDD1TEST 2 +15VTEST 3 - 15VTEST 4 +5VTEST 5 - 5VTEST 6 GND XP4 1 LIQEDETOUT 2 LIQEDETOUT 3 LIQEDETOUT 4 LIQEDETOUT 5 GND 6 GND XP3 1 BS1P 2 BS2P 3 BS3P 4 BS4P 5 +12VBS 6 A GND XP2 1 DETACK1KB 2 DETON 3 DETLED 4 DETOUT 5 MUX1P 6 MUX2P 7 MUX3P 8 MUX4P 9 AGND 10 SIGIN 11 GNDSENSE 12 VREF+ 13 VREF14 +12VP 15 -12VP 3-84 Version I Figure 3-78 ISE (30, 30i Kusti) November 2, 2003 XP10 11 NC 1 NC 12 -12VM 2 NC 13 GND 3 GND 14 NC 4 +5VM 15 GND 5 GND 16 GND 6 +5VM 17 GND 7 GND 18 - 5VM 8 POWERGOOD 19 + 5VM 9 +5VM 20 +5VM 10 +12VM November 2, 2003 K214 XP7 1 +28V 2 GND 3 GND 4 GND 5 GND 6 GND XP6 1 GND 2 +5V1TEST 3 VDD5V1TEST 4 +19VTEST 5 - 19VTEST 6 VDIFFTEST 7 VAVETEST 8 VADJTEST K197 XP5 1 NC 2 NC 3 MAINSW+ 4 MAINSW5 NC 6 NC F1: COOLING (STORAGES) 1 RE2 1 B A RE1 POWER UNIT +28V K194 48953054-4081 19 /20 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES 1 CABLE CHART / POWCAN TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE 2 KORVATTU REPLACED 4 Konelab 30, 30i with Kusti MUUTOS REVISIONS 1 LEHTI SHEET LIITTYY ASSOCIATES K149 K163 5 1 7 MERKKI MARK XP1, 2 1 CANA 2 CANA 3 CANB 4 CANB 2 8 123Konelab T6.3A K189 K58 F2 XP3 1 +28V 2 GND 3 GND 4 GND 5 GND 6 GND XP4 1 NC 2 NC 3 POWFAIL+ 4 POWFAIL5 NC 6 NC 6 T3.15A K215 XP8 1 GND 2 PELTIER23 PELTIER2+ 4 THERM2 5 PELTIER26 PELTIER2+ F1 3 F3 K216 XP9 1 GND 2 PELTIER13 PELTIER1+ 4 THERM1 5 PELTIER16 PELTIER1+ HYV. APPR. M-FILMI M-FILM 4101 48414988 20.09.99 JHen Version I Cable Charts 3-85 1 1 T6.3A 1 B A 1 F1 F2: POWCAN, CAN BUS, K193 INTERNAL PC POWER F3: CHARGING (BATTERIES) Figure 3-79 Powcan (30, 30i Kusti) Konelab Service Manual 48953054-4081 K209 K234 IO 32 XP8, XP2 IO 34 XP2 XP2 XP1 XP3 A D3 XP3 LED1-1 XP2 XP1 TRI COLOR LED D3 XP1 XP2 D2 XP3 C D1 B XP2 XP1 LED1-2 XP3 Cathode CUVETTE COVER OPTO K208 C XP2 XP1 D2 XP3 C D1 C D1 D2 K233 GREEN RED 20 /20 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES CABLE CHART / COVERS Konelab 30, 30i with Kusti MUUTOS REVISIONS LED1-1 TRI COLOR LED TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM 4101 48414988 20.09.99 JHen Cable Charts KORVATTU REPLACED LEHTI SHEET MERKKI MARK XP1 123Konelab D XP2 XP3 Konelab Service Manual D3 3-86 Version I Figure 3-80 Covers (30, 30i Kusti) November 2, 2003 TEMP *1 in 30 with Kusti (*2 in 30i with Kusti) - heatings - 2 channels thermistors +28V 4101 B LAJI CLASSIF. Z 841854 KOODI CODE SUHDE SCALE 05.04.2001 JN 841776 CABLE CHART/ BLOCK DIAGRAM HYV. APPR. MERKKI MARK +28V KORVAA REPLACES 123Konelab position feedback LIITTYY ASSOCIATES MUUTOS REVISIONS MOTOR *18 in 30 with Kusti (*23 in 30i with Kusti) 1 /20 limit switches LIITTYY ASSOCIATES CAN BUS LEHTI SHEET Windows NT Termination Konelab 30 (30i, Kusti) WORKSTATION SURF *2 in 30 with Kusti (*3 in 30i with Kusti) NIMI NAME ANALYZER KORVATTU REPLACED HYV. APPR. TEKI DRAWN PVM DATE PIIRT. DRAWN TARK. CHECKED 3-87 M-FILMI M-FILM Cable Charts 27.03.2001 JHen 04.04.2001 JHen Version I Ethernet PCCAN - CAN interface - termination INTERNAL PC (MASTER) - hard disk, floppy disk - controls all nodes via CAN BUS MAINS INPUT + 5V - 5V +12V -12V PHOTSIG *1 PHOTO *1 - ADC - lamp control - chopper drive PHOTREF *1 POWCAN *1 +28V - power supply monitoring - battery control - CAN-bus bias - coolings control status +28V POWER MODULE - mains switch - standby switch - line filter - 100 - 230 VAC input - 28 VDC output +28V Batteries ISEAMP * 1 limit switches INOUT * 2 ISE * 1 (in 30i with Kusti) - ADC - liquid detection - digital I/O - analog inputs - RS232 interfaces - LED, button etc. interfaces +28V LEDS +28V RS232 Bar code readers Figure 3-81 Block diagram (30, 30i, Kusti, (981850,981851, 981860, 981861)) November 2, 2003 48953054-4081 Konelab Service Manual Konelab Service Manual 48953054-4081 JP7 JP5 JP3 JP1 TP1 JP8 JP6 JP4 JP2 JP7 JP5 JP3 JP1 TP1 JP8 JP6 JP4 JP2 XP3 3 50 ISE Y XP2 MB1-3 XP7 49 TEMP 2 114 Kusti FMI PUMP 113 Kusti DISPENSER 16 SYRINGE XP4 XP6 JP8 JP6 JP4 JP2 64 ISE XP5 TP1 XP3 4 XP2 JP7 JP5 JP3 JP1 MB1-3 65 ISESYR XP1 RACK2 66 ISEDILP XP4 XP6 XP1 XP5 XP7 XP4 XP6 XP1 JP7 JP5 JP3 JP1 TP1 JP8 JP6 JP4 JP2 XP5 XP7 2 /20 NIMI NAME 841776 CABLE CHART/ RACKS TEKI DRAWN 841854 4101 B KOODI CODE LAJI CLASSIF. 05.04.2001 JN M-FILMI M-FILM HYV. APPR. HYV. APPR. 27.03.2001 JHen 04.04.2001 JHen TARK. CHECKED PIIRT. DRAWN Z PVM DATE XP11 XP13 SUHDE SCALE 126 PHOTO KORVAA REPLACES LIITTYY ASSOCIATES MUUTOS REVISIONS 124 POWCAN Konelab 30 (30i, Kusti) XP9 Cable Charts KORVATTU REPLACED F LIITTYY ASSOCIATES XP8 XP7 40 TEMP 1 LEHTI SHEET 123Konelab MERKKI MARK XP3 5 XP6 2 XP5 MB1-9 XP2 MB1-3 XP4 81 SAMPLE STORAGE XP5 XP7 18 DILUENT PUMP XP3 21 MEAS CHANNEL 82 SEGMENT FEEDER XP4 19 MIXER WASH 6 23 CUVETTE LOADER XP10 XP12 JP8 JP6 JP4 JP2 32 INOUT 1 XP11 XP13 TP1 XP1 JP7 JP5 JP3 JP1 XP3 XP2 33 R STORAGE Only in 30i XP9 24 INCUBATOR XP8 35 MIXER Y XP2 XP7 34 INOUT 2 MB1-3 XP6 36 MIXER Konelab 30 with Kusti JP8 JP6 JP4 JP2 1 38 DISPENSER Y XP1 TP1 XP5 XP4 MB1-9 20 ISE WASH XP3 37 MIXER XP6 JP7 JP5 JP3 JP1 XP2 39 DISPENSER XP10 XP12 XP1 3-88 Version I F 80 FILTER DISK F 48 ISE RACK4 F 112 Kusti DISPENSER Y RACK3 RACK1 Figure 3-82 Racks (30, 30i, Kusti, (981850,981851, 981860, 981861)) November 2, 2003 XP3 K173 November 2, 2003 48953054-4081 28V XP12 XP10 28V XP12 CAN XP10 MB 1-9 1 CAN TERMINATION K171 28V MB 1-9 2 XP13 XP11 CAN XP13 XP11 K154 REAGENT STORAGE 28V CAN R1 K157 K156 TO INTERNAL PC K180 XP1 +28V K189 K214 K186 K155 K149 K162 POWCAN XP2 K375 K179 + 28V PHOTO K153 K158 28V CAN XP7 XP6 GND + 24V R2 FANS IN BACK PANEL K175 K176 XP2 K161 K188 XP8 CAN K175 XP5 XP7 (Kusti) 28V XP6 6 MB 1-3 CAN XP4 K159 28V K151 CAN CAN b LEHTI SHEET 3 /20 KORVAA REPLACES KORVATTU REPLACED NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES K375 lis„tty K375 added 123Konelab MERKKI MARK 28V 28V 28V (Ise) CAN XP4 XP6 XP4 CABLE CHART / POWER, CAN AND FAN CABLES 841776 Konelab 30 (30i, Kusti) MUUTOS REVISIONS 28V MB 1-3 3 XP7 XP5 XP6 4 CAN 28V 28V XP7 XP6 5 XP7 CAN XP4 MB 1-3 (Ise) XP5 CAN CAN XP4 MB 1-3 XP5 R2 kiinnitet„„n tiukasti v„lirunkopeltiin XP2 :n vieress„ olevan ruuvin alle. Fix R2 firmly to the middle frame plate next to XP2. K152 K150 STORAGE SAMPLE TO PC FAN K177 K178 HOUSE LAMP JN HYV. APPR. TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED SUHDE SCALE M-FILMI M-FILM 4101 B 841854 05.04.2001 JN 27.03.2001 JHen 04.04.2001 JHen ARen PVM DATE PIIRT. DRAWN 06.11.02 K172 K174 Version I Cable Charts 3-89 Figure 3-83 Power, can and fan cables (30, 30i, Kusti, (981850,981851, 981860, 981861)) Konelab Service Manual Konelab Service Manual S1 2 48953054-4081 N black 4 3 K200 red (main switch) 1 red K196 K260 K352 black red a KORVAA REPLACES 4 /20 KORVATTU REPLACED LEHTI SHEET K58 NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES 841776 CABLE CHART/ CONNECTOR PANEL AND POWER UNIT Z SUHDE SCALE PVM DATE 23.10.2001 POWCAN XP4 S2 LAJI CLASSIF. KOODI CODE 4101 B 841854 05.04.2001 JN M-FILMI M-FILM HYV. APPR. HYV. APPR. 27.03.2001 JHen 04.04.2001 JHen TARK. CHECKED PIIRT. DRAWN TEKI DRAWN ARen STANDBY SWITCH POWCAN RE2/B XP1 XP1 FRAME BATTERY 2 - POWCAN XP5 Konelab 30 (30i, Kusti) MUUTOS REVISIONS K260-merkint„ lis„tty. K260 marking added. 123Konelab MERKKI MARK 0V 28V N L black K186 K194 K155 K192 K162 K352 K352 Cable Charts TO INTERNAL PC TO INTERNAL PC shield red 4 Powfail3 Powfail+ K75 (ETHERNET) WORK STATION TO LABORATORY AUTOMATION SYSTEM POWER UNIT 1 L 6 5 red K198 K352 1 Inhibit black black K199 CONNECTOR PANEL 3-90 Version I Figure 3-84 Connector panel and power unit (30, 30i, Kusti, (981850,981851, 981860, 981861)) November 2, 2003 November 2, 2003 K11 XP3 SURF K 104 48953054-4081 XP1 CONN 7 XP1 (150) XP2 1 K237 7 (600) K88 K 243 XP2 1-8 CONN XP1 MB 1-9 (2) MOTOR ID 38 DISP. Y K116 N CON 1-6 XP1 Y-MOV HEDS MOTOR ID 39 DISP. f K 281 (600) 1-8 CONN XP2 1 K89 f -MOV XP7 XP2 XP5 XP2 1-6 XP1 Y -OPTO K103 XP2 XP7 XP2 XP5 (150) K236 f -OPTO DISPENSER OPTO K10 K12 TO CHASSIS XP2 XP4 K187 ISE ID 48 (only in 30i) K184 MOTOR ID 66 ISEDILP XP3 K185 TO CHASSIS MB 1-3 (3) TEMP2 ID 49 ISE (only in 30i) XP2 K183 f -OPTO Y -OPTO K105 K183 5 /20 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab K182 SURF XP3 NIMI NAME LIITTYY ASSOCIATES K106 K117 CABLE CHART/ DISPENSERS 841776 Konelab 30 (30i, Kusti) MUUTOS REVISIONS MB 1-3 (4) MOTOR ID 64 ISE DISP. f (only in 30i) XP7 XP2 XP5 K93 (ONLY IN 30i) LIITTYY ASSOCIATES MOTOR ID 50 ISE DISP. Y (only in 30i) XP7 XP2 XP5 K92 Y-MOV HEDS f -MOV XP2 K181 ISE DISPENSER XP1 ISEAMP TEKI DRAWN KOODI CODE LAJI CLASSIF. Z 4101 B 841854 05.04.2001 JN M-FILMI M-FILM HYV. APPR. HYV. APPR. 27.03.2001 JHen 04.04.2001 JHen TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE OPTO Version I Cable Charts 3-91 Figure 3-85 Dispensers (30, 30i, Kusti, (981850,981851, 981860, 981861)) Konelab Service Manual Konelab Service Manual 48953054-4081 MOTOR ID 37 MIXER XP7 K14 K110 Y -OPTO MB 1-9 (2) MOTOR ID 36 MIXER f XP7 XP2 K97 f -OPTO MIXER 7 Y-MOV K14 XP2 XP2 MOTOR ID 35 MIXER Y XP7 XP2 XP3 K96 K109 1 7 1 f -MOV XP1 XP1 K13 K15 OPTO KORVAA REPLACES 6 /20 NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MUUTOS REVISIONS CABLE CHART / MIXER 841776 Konelab 30 (30i, Kusti) TEKI DRAWN 841854 4101 B KOODI CODE LAJI CLASSIF. Z 05.04.2001 JN M-FILMI M-FILM HYV. APPR. HYV. APPR. 27.03.2001 JHen 04.04.2001 JHen TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE Cable Charts KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab 3-92 Version I Figure 3-86 Mixer (30, 30i, Kusti, (981850,981851, 981860, 981861)) November 2, 2003 November 2, 2003 48953054-4081 (700) XP (600) K 354 K290 MB 1-3 (6) MOTOR ID 112 KUSTI DISP. Y 2 MOTOR ID 114 KUSTI DILUENT PUMP NN CO 1-8 XP7 XP2 XP5 K357 1 (600) 7 2 XP K353 1 K293 1 7 XP1 XP2 1 7 (600) K 355 DISP. f MOTOR ID 113 KUSTI K292 Y-MOV HEDS f -MOV K287 XP7 XP2 XP5 K358 (700) 1-6 XP2 CONN 1-8 XP 1 K289 K291 Y -OPTO CONN 1 XP XP6 XP2 (700) K356 XP2 XP 1-6 K294 XP2 1-6 CONN XP1 K288 NN CO 1-8 CONN XP1 f -OPTO K26 TO CHASSIS XP1 SURF XP2 XP3 MERKKI MARK 7 /20 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET 123Konelab OPTO NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MUUTOS REVISIONS CABLE CHART / KUSTI 841776 Konelab 30 (30i, Kusti) Z SUHDE SCALE PVM DATE TEKI DRAWN 4101 B 841854 05.04.2001 JN LAJI CLASSIF. KOODI CODE HYV. APPR. M-FILMI M-FILM TARK. CHECKED HYV. APPR. 27.03.2001 JHen 04.04.2001 JHen PIIRT. DRAWN Version I Cable Charts 3-93 Figure 3-87 Kusti (30, 30i, Kusti, (981850,981851, 981860, 981861)) Konelab Service Manual XP7 Konelab Service Manual 48953054-4081 MB 1-9 (1) MOTOR ID 18 DILUENT PUMP XP2 K246 MOTOR ID 19 MIXER WASH XP7 (700) K238 (700) K239 MOTOR ID 20 ISE WASH (only in 30i) XP7 2 XP XP6 K245 NN CO 1 -8 XP2 K99 1 XP MOTOR ID 16 SYRINGE K86 OPTO K119 a MB 1-9 (4) CABLE CHART/ SYRINGES AND 841776 Konelab 30 (30i, Kusti) MUUTOS REVISIONS XP3 PUMPS TEKI DRAWN ARen 841854 4101 B KOODI CODE LAJI CLASSIF. Z 05.04.2001 JN M-FILMI M-FILM HYV. APPR. HYV. APPR. 27.03.2001 JHen 04.04.2001 JHen TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE 23.01.02 K190 ISE ID 48 XP4 Cable Charts KORVAA REPLACES KORVATTU REPLACED NIMI NAME LIITTYY ASSOCIATES LEHTI SHEET 8 /20 LIITTYY ASSOCIATES K122 MOTOR ID 66 ISE DILUENT PUMP (only in 30i) XP7 K123 K187 vaihdettu K190. K187 changed K190 123Konelab MERKKI MARK K100 XP2 MOTOR ID 65 ISE SYRINGE (only in 30i) XP7 K87 OPTO ISE (ONLY IN 30i) 3-94 Version I XP1 CONN 1-8 XP 2 Figure 3-88 Syringes and pumps (30, 30i, Kusti, (981850,981851, 981860, 981861)) November 2, 2003 48953054-4081 (600) (600) K 222 7 7 NN CO 1-6 1 (600) K166 2 XP 1 XP2 XP7 XP2 XP7 XP9 XP3 XP3 MB 1-9 (1) (600) K235 K219 9 /20 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK REF. K225 123Konelab MOTOR ID 24 INCUB. XP7 MOTOR ID 23 CUVETTE LOADER K164 7 K217 K351 1 XP CONN XP2 MOTOR ID 21 MEASCH. K220 XP2 1 XP1 CON N 1-6 K224 K17 K221 NIMI NAME MUUTOS REVISIONS 841776 Konelab 30 (30i, Kusti) CABLE CHART / INCUBATOR AND MEASURING CHANNEL LIITTYY ASSOCIATES LIITTYY ASSOCIATES TEMP1 ID 40 K223 MB 1-9 (2) K226 K351 XP2 INOUT ID 32 (700) K240 XP1 XP2 (600) K165 XP2 1-8 CONN XP1 K284 1 7 K83 K84 K218 XP4 MB 1-9 (2) K168 XP2 CO NN 1- 6 XP 1 K167 XP1 XP2 7 PHOTO ID 126 XP 1 November 2, 2003 1 1-6 CO NN Jumper JP1-JP2 1-6 HEDS XP 2 TEKI DRAWN 4101 B 841854 05.04.2001 JN KOODI CODE LAJI CLASSIF. Z HYV. APPR. M-FILMI M-FILM TARK. CHECKED HYV. APPR. 27.03.2001 JHen 04.04.2001 JHen PIIRT. DRAWN SUHDE SCALE PVM DATE Version I Cable Charts 3-95 SIG. XP5 Figure 3-89 Incubator and measuring channel (30, 30i, Kusti, (981850,981851, 981860, 981861)) Konelab Service Manual K216 POWCAN XP9 Konelab Service Manual CONN XP1 7 XP1 7 1 (1500) (600) 7 N CON 1-6 48953054-4081 K229 (1500) 2 XP K253 1 CO NN K124 K125 K114 HEDS K129 K67 XP3 XP2 XP7 XP2 XP7 XP10 XP9 XP8 XP7 XP6 XP5 MB 1-3 (5) MOTOR ID 82 SEGMENT FEEDER K234 CUVETTE LOADER OPTO (600) K65 XP2 1 XP 1 CONN 1-6 7 10 /20 KORVAA REPLACES 841776 CABLE CHART/ STORAGES NIMI NAME TEKI DRAWN 841854 4101 B KOODI CODE LAJI CLASSIF. Z 05.04.2001 JN M-FILMI M-FILM HYV. APPR. HYV. APPR. 27.03.2001 JHen 04.04.2001 JHen TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE K215 POWCAN XP8 Cable Charts KORVATTU REPLACED MUUTOS REVISIONS Konelab 30 (30i, Kusti) LIITTYY ASSOCIATES LIITTYY ASSOCIATES K113 K215 XP3 REAGENT STORAGE XP5 LEHTI SHEET K112 MOTOR ID 33 REAGENT STORAGE MB 1-9 (2) 123Konelab MERKKI MARK INOUT ID 32 K111 K64 HEDS XP10 XP9 XP8 XP7 XP6 MOTOR ID 81 SAMPLE STORAGE K66 K207 K167 K168 CUVETTES IN STORAGE OPTO K63 XP7 INOUT ID 34 1-6 K205 1 XP K251 XP2 1-6 CONN 1 K59 K228 XP1 XP2 MB 1-9 (2) (1500) XP2 1-6 K252 XP4 K61 SAMPLE STORAGE 3-96 Version I 7 XP 2 1 Figure 3-90 Storages (30, 30i, Kusti, (981850,981851, 981860, 981861)) November 2, 2003 November 2, 2003 48953054-4081 (600) K279 XP2 XP2 7 1 MB 1-3 (5) MOTOR ID 80 FILTER DISK XP7 K78 XP1 CONN 1-6 K80 1-6 7 XP2 CONN XP1 1 K77 CHOPPER MOTOR 1-6 XP2 CONN XP1 1 7 K360 (1500) K79 (600) K359 K280 K82 LAMP HOUSE XP5 XP4 XP3 PHOTO ID 126 XP4 LEHTI SHEET 11 /20 KORVAA REPLACES KORVATTU REPLACED NIMI NAME MUUTOS REVISIONS 841776 Konelab 30 (30i, Kusti) DILUENT CABLE CHART / LAMP HOUSE AND WATER DETECTORS LIITTYY ASSOCIATES LIITTYY ASSOCIATES K81--> K359 ja K241-->K360. K81 -->K359.and K241-->K360 K204 123Konelab MERKKI MARK a MB 1-9 (2) INOUT ID 34 XP3 K203 WASTE TEKI DRAWN ARen 4101 B 841854 05.04.2001 JN KOODI CODE LAJI CLASSIF. Z HYV. APPR. M-FILMI M-FILM TARK. CHECKED HYV. APPR. 27.03.2001 JHen 04.04.2001 JHen PIIRT. DRAWN SUHDE SCALE PVM DATE 23.10.2001 Version I Cable Charts 3-97 Figure 3-91 Lamp house and water detectors (30, 30i, Kusti, (981850,981851, 981860, 981861)) Konelab Service Manual - +28V Konelab Service Manual + - K192 RE2 POWER UNIT 48953054-4081 12 /20 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES MUUTOS REVISIONS + CABLE CHART/ BATTERIES 841776 Konelab 30 (30i, Kusti) TEKI DRAWN 841854 4101 B KOODI CODE LAJI CLASSIF. Z 05.04.2001 JN M-FILMI M-FILM HYV. APPR. HYV. APPR. 27.03.2001 JHen 04.04.2001 JHen TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE Cable Charts KORVATTU REPLACED + K195 LIITTYY ASSOCIATES BATTERY 1 LEHTI SHEET MERKKI MARK BATTERY 2 123Konelab 3-98 Version I K191 F1 POWCAN B K193 A B RE1 A K194 Figure 3-92 Batteries (30, 30i, Kusti, (981850,981851, 981860, 981861)) November 2, 2003 48953054-4081 CONNECTOR PANEL K75 PCCAN ETHERNET K260 CONNECTOR PANEL KEYBOARD CAN BUS POWCAN XP1 K376 MOUSE MICRO FLOPPY DISK DIMM 1 DIMM 2 MAIN BOARD A7N266 - VM M ICRO MICRO FLOPPY ATXPWR1 PWRBTN IDE 2 PRIMARY IDE PIN 1 FLOPPY November 2, 2003 PIN 1 13 /20 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES red black CABLE CHART/ INTERNAL PC 841776 Konelab 30 (30i, Kusti) MUUTOS REVISIONS K260 lis„tty. K260 added 123Konelab K163 --> K376 , K375 lis„tty. K163 --> K376, K375 added b K178 FAN a K177 ATA-MODULE PE 0V +24 V red +28 V PVM DATE 4101 B 841854 05.04.2001 JN Z HYV. APPR. KOODI CODE LAJI CLASSIF. SUHDE SCALE TARK. CHECKED M-FILMI M-FILM 27.03.2001 JHen 04.04.2001 JHen PIIRT. DRAWN HYV. APPR. TEKI DRAWN JN JN ARen ARen black GND 23.10.2001 06.11.02 (Holder) XP1 K 375 POWER TO INTERNAL PC Version I Cable Charts 3-99 Figure 3-93 Internal PC (master) (30, 30i, Kusti, (981850,981851, 981860, 981861)) Konelab Service Manual Konelab Service Manual red 1 white-yellow 3 black 5 white-orange 7 2 red-white 4 yellow 6 white-black 8 orange PACIFIC SCIENTIFIC 1.8ø M21NRXE 1,01A yellow 3 orange 5 4 red 6 brown ESCAP P110 - 064 - 015 4 red 6 green-white W red-white 3 green 5 4 red 6 green-white SONCEBOZ 6600 R.158 1.3A / Ph Molex 90142-0008 Dual Row C-Grid III Crimp Connector Housing 90119-2110 Female Crimp Terminal 90119-0110 Female Crimp Terminal) SONCEBOZ 1.4A / Ph 2.6 red-white 3 green 5 (Connector: Terminal: MOTOR CONNECTIONS TO XP7, VIEW FROM CABLE SIDE 48953054-4081 6 5 14 /20 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES 4 yellow 6 red CABLE CHART / MOTOR 841776 Konelab 30 (30i, Kusti) MUUTOS REVISIONS Z SUHDE SCALE PVM DATE SURF (liquid detector, needle tilt) / HEDS (feedback opto) OPTO2 23 cuvette loader (back) 82 Segment (in storage) OPTO1 (zero point) 2 3 Cuvette loader (middle) PARAL. (motor windings) SERIAL (motor windings) 18,114 Diluent pump white 3 green 5 841854 4101 B KOODI CODE LAJI CLASSIF. 05.04.2001 JN M-FILMI M-FILM HYV. APPR. HYV. APPR. 27.03.2001 JHen 04.04.2001 JHen TARK. CHECKED PIIRT. DRAWN TEKI DRAWN SONCEBOZ LINEAR ACTUATOR W 7214 R005 8.8V 46 Cable Charts KORVATTU REPLACED LEHTI SHEET MERKKI MARK 2 1 7 8 1 2 2 black 4 red-white 6 black-white 8 green 123Konelab SURF/HEDS 1 TILT 2 SURF/CHA 3 SURFOSC 4 GND 5 VDD 6 LED 7 LED/CHB 8 -5V OPTO 1 LED 2 GND 3 VDD 4 GND 5 OPT 6 NC/+28VP MOTOR 1 OUTB2 2 OUTB1 3 OUTB2 4 OUTB1 5 OUTA2 6 OUTA1 7 OUTA2 8 OUTA1 red 1 white 3 green-white 5 orange 7 SONCEBOZ 6500 R.497 1A / Ph 3-100 Version I Figure 3-94 Motor (30, 30i, Kusti, (981850,981851, 981860, 981861)) November 2, 2003 November 2, 2003 GND VDD1 48953054-4081 15 /20 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab 4 5 6 4 5 6 XP2 1 MEASGND 2 RES13 RES1+ 4 CH1IN 5 RES16 RES1+ 1 2 3 1 2 3 NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES XP4 1 MEASGND 2 RES23 RES2+ 4 CH4IN 5 RES26 RES2+ MUUTOS REVISIONS CABLE CHART / TEMP 841776 Konelab 30 (30i, Kusti) (THERM 4-6) RES2 40 MeasCh (THERM 1-3) Z SUHDE SCALE PVM DATE (TEMP1) RES1 40 Incub (TEMP1), 49 ISE block (TEMP2) TEKI DRAWN 4101 B 841854 05.04.2001 JN LAJI CLASSIF. KOODI CODE HYV. APPR. M-FILMI M-FILM TARK. CHECKED HYV. APPR. 27.03.2001 JHen 04.04.2001 JHen PIIRT. DRAWN Version I Cable Charts 3-101 Figure 3-95 Temp (30, 30i, Kusti, (981850,981851, 981860, 981861)) Konelab Service Manual Konelab Service Manual 1 2 3 5 6 6 5 4 2 1 48953054-4081 16 /20 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MUUTOS REVISIONS CABLE CHART / PHOTO 841776 Konelab 30 (30i, Kusti) POWER CAN CAN LAMP POWER CHOPPER MOTOR SYNC OPTO PHOTREF (reference channel) Z SUHDE SCALE PVM DATE TEKI DRAWN 841854 4101 B KOODI CODE LAJI CLASSIF. 05.04.2001 JN M-FILMI M-FILM HYV. APPR. HYV. APPR. 27.03.2001 JHen 04.04.2001 JHen TARK. CHECKED PIIRT. DRAWN PHOTSIG Jumper JP1-JP2 (signal channel) Cable Charts KORVATTU REPLACED LEHTI SHEET MERKKI MARK 1 123Konelab XP8 1 +28V 2 GND 3 GND 4 GND 5 GND 6 GND XP6, 7 1 CANA 2 CANA 3 CANB 4 CANB XP4 1 GND 2 MOT+ 3 GND 4 +5VCH 5 +5VCH 6 NC XP5 1 NC 2 LAMP+ 3 GND 4 NC 5 +15VM 6 - 15VM XP3 1 CHOPLED 2 GND 3 +5VCH 4 GND 5 CHOPSYNC 6 AGND XP1, XP2 1 +12V 2 -12V 3 CH S / R 4 GNDSENS 5 PREGAIN 6 AGND 3-102 Version I Figure 3-96 Photo (30, 30i, Kusti, (981850,981851, 981860, 981861)) November 2, 2003 November 2, 2003 VDD1 GND XP10 1 TXD 2 SUPPLYGND 3 TRIGGER 4 SIGNALGND 5 RXD 6 +5V 7 BCR_RESET 8 +12VRS 8 2 5 6 1 2 7 1 48953054-4081 Bar Code Reader XP6, 7, 8, 9 1A A 2 GND 3 +5V 4 GND 5 IN A_C 6 NC/+28VP XP3, 4, 5 1A B 2 GND 3 +5V 4 GND 5 IN B_C 6 NC/+28VP XP2 1 LED1A 2 GND 3 LED2A 4 GND 5 LED3A 6 GND 7 LED4A 8 GND 17 /20 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES CABLE CHART / INOUT 841776 Konelab 30 (30i, Kusti) MUUTOS REVISIONS 1 / 32 Cuvettes in Storage Opto 2 / 34 Segment Loader Opto 1 / 32 Cuvette Loader Opto 2 / 34 Segment Cover Opto IN3A IN4A 1 / 32 Reagent Cover Opto 2 / 34 Stat Cover Opto 1 / 32 Reagent Storage Cover Opto 2 / 34 Sample Storage Cover Opto 2 / 34 Water (Diluent) Detector 1 / 32 MeasCh Reflective Object Sensor 2 / 34 Waste Detector 2 / ID34 Segm. GLED Segm. RLED Stat GLED Stat RLED IN2A IN1A IN3B IN2B IN1B LEDS 1 / ID32 Cuv. GLED Cuv. RLED Reag. GLED Reag. RLED Z SUHDE SCALE PVM DATE TEKI DRAWN 4101 B 841854 05.04.2001 JN LAJI CLASSIF. KOODI CODE HYV. APPR. M-FILMI M-FILM TARK. CHECKED HYV. APPR. 27.03.2001 JHen 04.04.2001 JHen PIIRT. DRAWN Version I Cable Charts 3-103 Figure 3-97 INOUT (30, 30i, Kusti, (981850,981851, 981860, 981861)) Konelab Service Manual Konelab Service Manual VDD1 GND A (only in 30i) 2 6 1 5 1 48953054-4081 KORVAA REPLACES KORVATTU REPLACED MUUTOS REVISIONS CABLE CHART / ISE 841776 Konelab 30 (30i, Kusti) Z SUHDE SCALE PVM DATE LIQ DET BLK SIM PREAMP (ISEAMP) TEKI DRAWN HYV. APPR. M-FILMI M-FILM 841854 4101 B LAJI CLASSIF. 05.04.2001 JN 27.03.2001 JHen 04.04.2001 JHen KOODI CODE HYV. APPR. TARK. CHECKED PIIRT. DRAWN Cable Charts NIMI NAME LIITTYY ASSOCIATES LEHTI SHEET 18 /20 LIITTYY ASSOCIATES 123Konelab MERKKI MARK XP5 1 VDD1TEST 2 +15VTEST 3 - 15VTEST 4 +5VTEST 5 - 5VTEST 6 GND XP4 1 LIQEDETOUT 2 LIQEDETOUT 3 LIQEDETOUT 4 LIQEDETOUT 5 GND 6 GND XP3 1 BS1P 2 BS2P 3 BS3P 4 BS4P 5 +12VBS 6 A GND XP2 1 DETACK1KB 2 DETON 3 DETLED 4 DETOUT 5 MUX1P 6 MUX2P 7 MUX3P 8 MUX4P 9 AGND 10 SIGIN 11 GNDSENSE 12 VREF+ 13 VREF14 +12VP 15 -12VP 3-104 Version I Figure 3-98 ISE (30, 30i, Kusti, (981850,981851, 981860, 981861)) November 2, 2003 XP10 11 NC 1 NC 12 -12VM 2 NC 13 GND 3 GND 14 NC 4 +5VM 15 GND 5 GND 16 GND 6 +5VM 17 GND 7 GND 18 - 5VM 8 POWERGOOD 19 + 5VM 9 +5VM 20 +5VM 10 +12VM Sample November 2, 2003 K214 XP7 1 +28V 2 GND 3 GND 4 GND 5 GND 6 GND XP6 1 GND 2 +5V1TEST 3 VDD5V1TEST 4 +19VTEST 5 - 19VTEST 6 VDIFFTEST 7 VAVETEST 8 VADJTEST K197 XP5 1 NC 2 NC 3 MAINSW+ 4 MAINSW5 NC 6 NC K58 F1: COOLING (STORAGES) B A RE1 POWER UNIT +28V K194 48953054-4081 LEHTI SHEET 19 /20 NIMI NAME LIITTYY ASSOCIATES CABLE CHART / POWCAN 841776 2 1 KORVAA REPLACES KORVATTU REPLACED Z SUHDE SCALE PVM DATE 8 7 Konelab 30 (30i, Kusti) 4 MUUTOS REVISIONS XP1, 2 1 CANA 2 CANA 3 CANB 4 CANB 5 1 LIITTYY ASSOCIATES K149 K163 2 MERKKI MARK T6.3A K189 XP3 1 +28V 2 GND 3 GND 4 GND 5 GND 6 GND 1 123Konelab F2 XP4 1 NC 2 NC 3 POWFAIL+ 4 POWFAIL5 NC 6 NC 6 T3.15A F1 3 F3 K215 XP8 1 GND 2 PELTIER23 PELTIER2+ 4 THERM2 5 PELTIER26 PELTIER2+ Reagent K216 XP9 1 GND 2 PELTIER13 PELTIER1+ 4 THERM1 5 PELTIER16 PELTIER1+ TEKI DRAWN 4101 B 841854 05.04.2001 JN LAJI CLASSIF. KOODI CODE HYV. APPR. M-FILMI M-FILM TARK. CHECKED HYV. APPR. 27.03.2001 JHen 04.04.2001 JHen PIIRT. DRAWN Version I Cable Charts 3-105 T6.3A B A RE2 F1 F2: POWCAN, CAN BUS, K193 INTERNAL PC POWER F3: CHARGING (BATTERIES) Figure 3-99 POWCAN (30, 30i, Kusti, (981850,981851, 981860, 981861)) Konelab Service Manual 48953054-4081 K209 K234 IO 32 XP8, XP2 IO 34 XP2 XP2 XP1 XP1 XP3 A D3 XP3 LED1-1 XP2 TRI COLOR LED D3 XP1 XP2 D2 XP3 C D1 B XP2 XP1 LED1-2 XP3 Cathode CUVETTE COVER OPTO K208 XP1 C XP2 D2 XP3 C D1 C D1 D2 K233 GREEN RED 20 /20 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES CABLE CHART / COVERS 841776 Konelab 30 (30i, Kusti) MUUTOS REVISIONS LED1-1 TRI COLOR LED Z SUHDE SCALE PVM DATE TEKI DRAWN 841854 4101 B KOODI CODE LAJI CLASSIF. 05.04.2001 JN M-FILMI M-FILM HYV. APPR. HYV. APPR. 27.03.2001 JHen 04.04.2001 JHen TARK. CHECKED PIIRT. DRAWN Cable Charts KORVATTU REPLACED LEHTI SHEET MERKKI MARK XP1 123Konelab D XP2 XP3 Konelab Service Manual D3 3-106 Version I Figure 3-100 Covers (30, 30i, Kusti, (981850,981851, 981860, 981861)) November 2, 2003 123Konelab PHOTREF *1 MERKKI MARK +28V 4101 B 48414900 LAJI CLASSIF. Z HYV. APPR. KOODI CODE SUHDE SCALE CABLE CHART / BLOCK DIAGRAM NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES PHOTO * 1 - ADC - lamp control - chopper drive 1 / 16 MUUTOS REVISIONS CAN BUS PHOTSIG *1 LEHTI SHEET Windows NT Termination Konelab 20, 20i WORKSTATION KORVAA REPLACES ANALYZER KORVATTU REPLACED HYV. APPR. TEKI DRAWN PVM DATE PIIRT. DRAWN M-FILMI M-FILM 3-107 01.10.99 JHen 04.10.99 JHen 07.10.99 JN Cable Charts TARK. CHECKED Version I SURF * 1 (* 2 in 20i) limit switches MOTOR * 10 (* 14 MAINS INPUT in 20i) position feedback +28V LEDS CANBIAS *1 - CAN-bus bias - status leds - mixer motor filtering - LED interface +28V POWER control status - mains switch - 100 - 230 VAC input - 28 VDC output +28V MODULE +28V TEMP * 1 thermistors RS232 - heatings - 2 channels +28V Bar code reader ISEAMP * 1 ISE * 1 (only in 20i) - ADC - liquid detection limit switches INOUT * 1 - digital I/O - analog inputs - RS232 interfaces - LED, button etc. interfaces +28V LEDS +28V Figure 3-101 Block Diagram (Konelab 20, 20i) November 2, 2003 48953054-4081 Konelab Service Manual Konelab Service Manual T P 1 J P 8 J P 6 J P 4 J P 2 X P 1 3 X P 1 2 M E R K K I M A R K 23 D ILU EN T PU M P 22 IN O U T 21 IN C U BATO R 20 C U VETTE LO AD ER 19 D ISPEN SER Y 18 D ISPEN SER . 16 C AN BIAS 48953054-4081 K O R V A A 2 / 1 6 R E P L A C E S R E P L A C E D A S S O C IA T E S A S S O C IA T E S N IM I N A M E L IIT T Y Y L IIT T Y Y M U U T O S R E V IS IO N S C A B L E C H A R T / R A C K S K o n e la b 2 0 , 2 0 i D A T E Z S U H D E S C A L E P V M X P 1 1 X P 1 3 T E K I D R A W N P IIR T . D R A W N L A J I C L A S S IF . K O O D I C O D E H Y V . A P P R . T A R K . C H E C K E D M -F IL M I M -F IL M 4 1 0 1 B 4 8 4 1 4 9 0 0 H Y V . A P P R . 0 1 .1 0 .9 9 J H e n 0 4 .1 0 .9 9 J H e n 0 7 .1 0 .9 9 J N Cable Charts K O R V A T T U L E H T I S H E E T 1 2 3 K o n e la b 37 ISE . O N LY IN 20i X P 9 X P 8 X P 7 38 ISE D ILU EN T PU M P X P 1 0 X P 6 39 ISE W ASH X P 1 1 X P 9 24 SYR IN G E X P 8 J P 8 J P 6 J P 4 J P 2 X P 1 32 M EAS C H AN N EL X P 7 T P 1 X P 2 33 STO R AG E X P 6 J P 7 J P 5 J P 3 J P 1 X P 5 X P 3 34 FILTER D ISK X P 5 M B1-9 2 X P 4 35 TEM P X P 4 M B1-9 1 36 ISE Y X P 3 40 ISE X P 1 0 X P 1 2 J P 7 J P 5 J P 3 J P 1 X P 2 17 N EED LE M IXER X P 1 3-108 Version I 126 PH O TO R AC K1 Figure 3-102 Racks (Konelab 20, 20i) November 2, 2003 November 2, 2003 48953054-4081 BACK PANEL FANS IN K277 + 24V GND R2 STORAGE R1 28V K349 XP12 CAN XP10 K274 K276 K275 MB 1-9 1 REAGENT AND SAMPLE K271 K345 XP13 28V XP11 CAN PHOTO 28V + 28V XP12 CAN XP10 XP8 28V K346 K273 XP1 MB 1-9 2 CAN XP7 CAN TERMINATION XP6 XP13 a KORVAA REPLACES KORVATTU REPLACED 3 / 16 123Konelab LEHTI SHEET K346 K345 NIMI NAME MUUTOS REVISIONS Konelab 20, 20i CABLE CHART / POWER, CAN AND FAN CABLES LIITTYY ASSOCIATES LIITTYY ASSOCIATES K345, K346 lis„tty. K345, K346 added. K272 MERKKI MARK 28V XP11 CAN K278 HOUSE LAMP TEKI DRAWN JHen KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE 07.12.99 HYV. APPR. M-FILMI M-FILM 4101 B 48414900 01.10.99 JHen 04.10.99 JHen 07.10.99 JN Version I Cable Charts 3-109 Figure 3-103 Power, can and fan cables (Konelab 20, 20i) Konelab Service Manual 48953054-4081 2 6 L 1 5 shield black black N 4 3 K200 red S1 red K285 K267 (ETHERNET) WORK STATION red K268 1 K270 F1 2 _ red red MERKKI MARK KORVAA REPLACES 4 / 16 NIMI NAME MUUTOS REVISIONS Konelab 20, 20i K273 K272 K274 CABLE CHART / CONNECTOR PANEL AND POWER UNIT LIITTYY ASSOCIATES LIITTYY ASSOCIATES black shield red TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE XP1 M-FILMI M-FILM 4101 B 48414900 01.10.99 JHen 04.10.99 JHen 07.10.99 JN HYV. APPR. MB1-9(2) XP13 FRAME Cable Charts KORVATTU REPLACED LEHTI SHEET 123Konelab brown blue black POWER UNIT CANBIAS XP2 28V K269 GND + CONNECTOR PANEL blue brown L N _S Konelab Service Manual +S 3-110 Version I Figure 3-104 Connector panel power unit (Konelab 20, 20i) November 2, 2003 November 2, 2003 B 48953054-4081 XP1 XP1 1 2 K 2 9 8 XP2 (2 0 0 ) CO NN 1-8 XP1 M B 1 -9 (1 ) M O T O R ID 1 9 D IS P . Y (2 0 0 ) XP 7 NN CO 1 1-6 XP Y -M O V M O T O R ID 1 8 D IS P . B (2 0 0 ) CO N N 1-8 XP2 XP2 7 CO NN 1-6 1 K 2 9 7 B -M O V K 2 6 6 K 2 9 5 X P 7 X P 2 X P 5 Y -O P T O K 2 9 6 K 2 6 2 K 2 6 5 X P 7 X P 2 X P 5 (2 0 0 ) K 2 9 9 -O P T O D IS P E N S E R K 2 5 6 C O N N 1 -6 M O T O R ID 1 7 N E E D L E M IX E R K 3 0 0 X P 7 X P 2 X P 5 K 2 5 4 K 1 2 T O X P 3 C A N ID 1 M IX F IL T B IA S X P 7 K 1 1 M O T O R E R IN G 6 X P 6 S U R F X P 2 C H A S S IS X P 1 K 2 5 5 O P T O K 1 8 5 T O C H A S S IS M E R K K I M A R K K O R V A A K O R V A T T U 5 / 1 6 R E P L A C E S R E P L A C E D L E H T I S H E E T 1 2 3 K o n e la b M U U T O S R E V IS IO N S K o n e la b 2 0 , 2 0 i O P T O D A T E Z S U H D E S C A L E P V M L A J I C L A S S IF . K O O D I C O D E H Y V . A P P R . T A R K . C H E C K E D P IIR T . D R A W N T E K I D R A W N K 1 9 0 X P 4 IS E ID 4 0 ( o n ly in 2 0 i) X P 2 K 3 0 6 M O T O R ID 3 8 IS E D IL P X P 3 C A B L E C H A R T / D IS P E N S E R S A S S O C IA T E S A S S O C IA T E S N IM I N A M E L IIT T Y Y L IIT T Y Y M B 1 -9 (2 ) M O T O R ID 3 7 IS E D IS P . B ( o n ly in 2 0 i) K 3 0 5 M O T O R ID 3 6 IS E D IS P . Y ( o n ly in 2 0 i) K 3 0 4 X P 7 X P 2 X P 5 K 3 0 3 Y -M O V B -M O V X P 7 X P 2 X P 5 K 3 0 1 K 3 0 2 B -O P T O Y -O P T O X P 3 S U R F X P 2 K 1 8 1 X P 1 IS E A M P IS E D IS P E N S E R (O N LY IN 20i) X P 1 M -F IL M I M -F IL M 4 1 0 1 B 4 8 4 1 4 9 0 0 H Y V . A P P R . 0 1 .1 0 .9 9 J H e n 0 4 .1 0 .9 9 J H e n 0 7 .1 0 .9 9 J N Version I Cable Charts 3-111 Figure 3-105 Dispensers (Konelab 20, 20i) Konelab Service Manual Konelab Service Manual 48953054-4081 K311 XP2 MOTOR ID 23 DILUENT PUMP K310 XP6 MB 1-9 (1) MOTOR ID 24 SYRINGE K308 K309 XP7 XP2 K190 K312 XP7 MOTOR ID 39 ISE WASH (only in 2 0i) MB 1-9 (2) MOTOR ID 38 ISE DIL. PUMP (only in 2 0i) XP2 XP3 K314 XP6 K313 ISE ID 40 XP4 KORVAA REPLACES 6 / 16 MUUTOS REVISIONS Konelab 20, 20i CABLE CHART / SYRINGES AND PUMPS NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM 4101 B 48414900 01.10.99 JHen 04.10.99 JHen 07.10.99 JN Cable Charts KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab ISE (ONLY IN 20i) 3-112 Version I Figure 3-106 Syringes and pumps (Konelab 20, 20i) November 2, 2003 K315 48953054-4081 XP2 1 K316 MB 1-9 (1) 1 XP NN CO 1-6 7 K319 1 2 XP (600) K321 1 7 XP2 XP7 XP2 XP7 XP9 b 7 / 16 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET NIMI NAME added. CABLE CHART / INCUBATOR AND MEASURING CHANNEL LIITTYY ASSOCIATES CONN1-6 MUUTOS REVISIONS K327 TEMP1 ID 35 KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN TEKI DRAWN JHen M-FILMI M-FILM 4101 B 48414900 01.10.99 JHen 04.10.99 JHen 07.10.99 JN HYV. APPR. K328 SUHDE SCALE PVM DATE 13.06.2000 MB 1-9 (2) MOTOR ID 32 MEASCH. Konelab 20, 20i . K350, LIITTYY ASSOCIATES K350, CONN1-6 lis„tty K225 MERKKI MARK K326 XP4 123Konelab K325 XP7 MOTOR ID 21 INCUB. (600) K350 K324 XP2 MOTOR ID 20 CUVETTE LOADER (200) K264 XP2 1-6 CONN XP1 K322 K224 K317 REF. XP2 INOUT ID 22 (600) K318 K320 K323 1 (600) 7 K83 XP2 NN CO 1- 6 1 XP XP1 K84 7 7 XP2 1-6 XP 1 PHOTO ID 126 CONN 1 XP1 CO NN November 2, 2003 SIG. 1-6 Jumper JP1-JP2 XP 2 Version I Cable Charts 3-113 XP3 XP5 Figure 3-107 Incubator and measuring channel (Konelab 20, 20i) Konelab Service Manual Konelab Service Manual ETHERNET (connector panel) LEDS +28V / XP1 K270 GND / chassis 48953054-4081 MOTOR ID 18 DISP. f INOUT ID 22 K330 K329 XP2 (200) 1 7 K 263 1-6 CONN XP1 K125 XP7 XP4 XP3 XP2 XP5 MB 1-9 (2) MOTOR ID 33 STORAGE K339 XP5 MB 1-9 (1) MOTOR ID 17 NEEDLE MIXER K343 K341 cooling unit XP2 CANBIAS ID 16 K342 black K345 K338 red K346 K340 SAMPLE / REAGENT STORAGE a MERKKI MARK KORVAA REPLACES 8 / 16 NIMI NAME CABLE CHART / STORAGE LIITTYY ASSOCIATES MUUTOS REVISIONS Konelab 20, 20i Z SUHDE SCALE PVM DATE 07.12.99 TEKI DRAWN JHen LAJI CLASSIF. KOODI CODE HYV. APPR. TARK. CHECKED PIIRT. DRAWN HYV. APPR. M-FILMI M-FILM 4101 B 48414900 01.10.99 JHen 04.10.99 JHen 07.10.99 JN Cable Charts KORVATTU REPLACED LEHTI SHEET LIITTYY ASSOCIATES K270, K345, K346 lis„tty. K270, K345, K346 added. 123Konelab 3-114 Version I XP10 XP5 XP5 Figure 3-108 Storages (Konelab 20, 20i) November 2, 2003 November 2, 2003 48953054-4081 7 (600) K279 1 MB 1-3 (5) MOTOR ID 34 FILTER DISK XP7 XP2 K78 XP2 1-6 CONN XP1 K80 1-6 7 XP2 CONN XP1 1 K77 CHOPPER MOTOR XP1 XP2 1-6 CONN 1 7 K79 (600) XP3 K81 XP5 K241 XP4 (600) K280 K82 LAMP HOUSE PHOTO ID 126 XP4 K204 9 / 16 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET 123Konelab MERKKI MARK MB 1-9 (1) INOUT ID 22 XP3 K203 WASTE NIMI NAME MUUTOS REVISIONS Konelab 20, 20i CABLE CHART / LAMP HOUSE AND WATER DETECTORS LIITTYY ASSOCIATES LIITTYY ASSOCIATES DILUENT TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM 4101 B 48414900 01.10.99 JHen 04.10.99 JHen 07.10.99 JN Version I Cable Charts 3-115 Figure 3-109 Lamp house and water detectors (Konelab 20, 20i) Konelab Service Manual Konelab Service Manual red 1 w hite-yellow 3 black 5 w hite-orange 7 2 red-w hite 4 yellow 6 w hite-black 8 orange PAC IFIC SC IEN TIFIC 1.8° M 21N R XE 1,01A yellow 3 orange 5 4 red 6 brow n ESC AP P110 -064 -015 red-w hite 3 green 5 4 red 6 green-w hite red-w hite 3 green 5 4 red 6 green-w hite SO N C EBO Z 6600 R .158 1.3A /Ph 48953054-4081 7 8 1 2 5 6 1 2 K O R V A A 1 0 / 1 6 R E P L A C E S R E P L A C E D A S S O C IA T E S A S S O C IA T E S N IM I N A M E L IIT T Y Y L IIT T Y Y 4 yellow 6 red R E V IS IO N S C A B L E C H A R T / M O T O R K o n e la b 2 0 , 2 0 i M U U T O S D A T E Z S U H D E S C A L E P V M L A J I C L A S S IF . K O O D I C O D E H Y V . A P P R . T A R K . C H E C K E D P IIR T . D R A W N T E K I D R A W N H Y V . A P P R . M -F IL M I M -F IL M 4 1 0 1 B 4 8 4 1 4 9 0 0 0 1 .1 0 .9 9 J H e n 0 4 .1 0 .9 9 J H e n 0 7 .1 0 .9 9 J N SU R F (liquid detector,needle tilt)/ H ED S (feedback opto) O PTO 2 20 C uvette loader(back) 38 ISE LIQ D ET O PTO 1 (zero point) 20 C uvette loader(m iddle) PAR AL.(m otorw indings) SER IAL.(m otorw indings) 23 D iluentpum p 38 ISE D iluentpum p w hite 3 green 5 SO N C EBO Z LIN EAR AC TU ATO R 7214 R 005 8.8V 46 9 Cable Charts K O R V A T T U L E H T I S H E E T M E R K K I M A R K 2 black 4 red-w hite 6 black-w hite 8 green 1 2 3 K o n e la b SU R F/H ED S 1 TILT 2 SU R F/C H A 3 SU R FO SC 4 G ND 5 VD D 6 LED 7 LED /C H B 8 -5V O PTO 1 LED 2 G ND 3 VD D 4 G ND 5 O PT 6 N C /+28VP M O TO R 1 O U TB2 2 O U TB1 3 O U TB2 4 O U TB1 5 O U TA2 6 O U TA1 7 O U TA2 8 O U TA1 red 1 w hite 3 green-w hite 5 orange 7 SO N C EBO Z 6500 R .497 1A /Ph M olex 90142-0008 D ualR ow C -G rid IIIC rim p C onnectorH ousing 90119-2110 Fem ale C rim p Term inal 90119-0110 Fem ale C rim p Term inal) SO N C EBO Z 1.4A /Ph 2.6 9 (C onnector: Term inal: M O TO R C O N N EC TIO N S TO XP7,VIEW FR O M C A B LE SID E 3-116 Version I Figure 3-110 Motor (Konelab 20, 20i) November 2, 2003 November 2, 2003 GND VDD1 48953054-4081 11 / 16 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab 4 5 6 4 5 6 XP2 1 MEASGND 2 RES13 RES1+ 4 CH1IN 5 RES16 RES1+ 1 2 3 1 2 3 NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES XP4 1 MEASGND 2 RES23 RES2+ 4 CH4IN 5 RES26 RES2+ MUUTOS REVISIONS CABLE CHART / TEMP Konelab 20, 20i (THERM 4-6) RES2 MeasCh (THERM 1-3) RES1 Incub TEKI DRAWN PIIRT. DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM 4101 B 48414900 01.10.99 JHen 04.10.99 JHen 07.10.99 JN Version I Cable Charts 3-117 Figure 3-111 Temp (Konelab 20, 20i) Konelab Service Manual Konelab Service Manual 1 2 3 5 6 6 5 4 2 1 48953054-4081 12 / 16 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MUUTOS REVISIONS CABLE CHART / PHOTO Konelab 20, 20i POWER CAN CAN LAMP POWER CHOPPER MOTOR SYNC OPTO PHOTREF (reference channel) TEKI DRAWN PIIRT. DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED SUHDE SCALE PVM DATE PHOTSIG Jumper JP1-JP2 (signal channel) HYV. APPR. M-FILMI M-FILM 4101 B 48414900 01.10.99 JHen 04.10.99 JHen 07.10.99 JN Cable Charts KORVATTU REPLACED LEHTI SHEET MERKKI MARK 1 123Konelab XP8 1 +28V 2 GND 3 GND 4 GND 5 GND 6 GND XP6, 7 1 CANA 2 CANA 3 CANB 4 CANB XP4 1 GND 2 MOT+ 3 GND 4 +5VCH 5 +5VCH 6 NC XP5 1 NC 2 LAMP+ 3 GND 4 NC 5 +15VM 6 - 15VM XP3 1 CHOPLED 2 GND 3 +5VCH 4 GND 5 CHOPSYNC 6 AGND XP1, XP2 1 +12V 2 -12V 3 CH S / R 4 GNDSENS 5 PREGAIN 6 AGND 3-118 Version I Figure 3-112 Photo (Konelab 20, 20i) November 2, 2003 November 2, 2003 VDD1 GND XP10 1 TXD 2 SUPPLYGND 3 TRIGGER 4 SIGNALGND 5 RXD 6 +5V 7 BCR_RESET 8 +12VRS 2 6 1 5 7 8 1 2 XP6, 7, 8, 9 1A A 2 GND 3 +5V 4 GND 5 IN A_C 6 NC /+28VP XP3, 4, 5 1A B 2 GND 3 +5V 4 GND 5 IN B_C 6 NC/+28VP XP2 1 LED1A 2 GND 3 LED2A 4 GND 5 LED3A 6 GND 7 LED4A 8 GND 48953054-4081 LEHTI SHEET KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES CANBIAS XP3 CABLE CHART / INOUT Konelab 20, 20i MUUTOS REVISIONS Cuvettes in Storage Opto 13 / 16 KORVATTU REPLACED / Stat Cover Reed Relay Cuvette Cover Opto Segment Rea gent Cover Opto MeasCh Reflective Object Sensor Water (Diluent) Detector Waste Detector Segm. / Stat GLED Segm. / Stat RLED Reag. GLED Reag. RLED 123Konelab MERKKI MARK IN4A IN3A IN2A IN1A IN3B IN2B IN1B LEDS TEKI DRAWN PIIRT. DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM 4101 B 48414900 01.10.99 JHen 04.10.99 JHen 07.10.99 JN Version I Cable Charts 3-119 Figure 3-113 INOUT (Konelab 20, 20i) Konelab Service Manual VDD1 Konelab Service Manual GND (only in 20i) 48953054-4081 6 5 1 2 1 1 MERKKI MARK 14 / 16 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MUUTOS REVISIONS CABLE CHART / ISE Konelab 20, 20i TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE LIQ DET BLK SIM PREAMP (ISEAMP) HYV. APPR. M-FILMI M-FILM 4101 B 48414900 01.10.99 JHen 04.10.99 JHen 07.10.99 JN Cable Charts KORVATTU REPLACED LEHTI SHEET 123Konelab XP5 1 VDD1TEST 2 +15VTEST 3 - 15VTEST 4 +5VTEST 5 - 5VTEST 6 GND XP4 1 LIQEDETOUT 2 LIQEDETOUT 3 LIQEDETOUT 4 LIQEDETOUT 5 GND 6 GND XP3 1 BS1P 2 BS2P 3 BS3P 4 BS4P 5 +12VBS 6 A GND XP2 1 DETACK1KB 2 DETON 3 DETLED 4 DETOUT 5 MUX1P 6 MUX2P 7 MUX3P 8 MUX4P 9 AGND 10 SIGIN 11 GNDSENSE 12 VREF+ 13 VREF14 +12VP 15 -12VP 3-120 Version I Figure 3-114 ISE (Konelab 20, 20i) November 2, 2003 November 2, 2003 48953054-4081 15 / 16 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET MERKKI MARK 123Konelab NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES CABLE CHART / CANBIAS Konelab 20, 20i MUUTOS REVISIONS DC LED RES LED DOM LED MOT OUT (Needle Mixer) TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE (Cuvette Loader GLED Cuvette Loader RLED) MOT IN (Needle Mixer) LEDS BCR OUT SER IN (from INOUT) CAN OUT HYV. APPR. M-FILMI M-FILM 4101 B 48414900 01.10.99 JHen 04.10.99 JHen 07.10.99 JN Version I Cable Charts 3-121 Figure 3-115 CANBIAS (Konelab 20, 20i) Konelab Service Manual XP2 XP1 Konelab Service Manual XP 2 XP 1 XP3 D3 K333 LED1-1 R K331 XP3 LED1-1 XP3 S D3 REAGENT COVER OPTO LED1-1 K332 XP2 XP1 TRI COLOR LED D3 K336 LED1-3 CONN1-6 K331 XP2 XP1 D2 XP3 C D1 K335 XP2 XP1 LED1-3 48953054-4081 16 / 16 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MUUTOS REVISIONS CABLE CHART / COVERS Konelab 20, 20i TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM 4101 B 48414900 01.10.99 JHen 04.10.99 JHen 07.10.99 JN Cable Charts KORVATTU REPLACED LEHTI SHEET 123Konelab MERKKI MARK INOUT XP8 INOUT XP7 CANBIAS XP5 K334 CUVETTE COVER OPTO K331 K334 K338 K335 RED GREEN K337 D1 D2 K331 K334 C INOUT XP6 INOUT XP2 XP3 Cathode 3-122 Version I Figure 3-116 Covers (Konelab 20, 20i) November 2, 2003 limit switches MOTOR * 13 (* 17 P841993 4101 A LAJI CLASSIF. Z HYV. APPR. KOODI CODE SUHDE SCALE KORVAA REPLACES SURF * 1 (* 2 in 25i) LIITTYY ASSOCIATES MERKKI MARK +28V 1 / 17 PHOTREF *1 LEHTI SHEET MUUTOS REVISIONS - ADC - lamp control - chopper drive LIITTYY ASSOCIATES PHOTO * 1 Thermo Clinical Labsystems Oy CAN BUS PHOTSIG *1 Konelab 25 Windows NT Termination CABLE CHART / BLOCK DIAGRAM WORKSTATION NIMI NAME ANALYZER KORVATTU REPLACED HYV. APPR. TEKI DRAWN PVM DATE TARK. CHECKED M-FILMI M-FILM 3-123 02.08.01 ARen 24.04.02 SK 24.04.02 JN Cable Charts PIIRT. DRAWN Version I MAINS INPUT in 25i) position feedback +28V LEDS CANBIAS *1 - CAN-bus bias - status leds - LED interface +28V POWER control status - mains switch - 100 - 230 VAC input - 28 VDC output +28V MODULE +28V TEMP * 1 thermistors RS232 - heatings - 2 channels +28V Bar code reader ISEAMP * 1 ISE * 1 (only in 25i) - ADC - liquid detection limit switches INOUT * 1 - digital I/O - analog inputs - RS232 interfaces - LED, button etc. interfaces +28V LEDS +28V Figure 3-117 Block Diagram (Konelab 20XT, 20XTi) November 2, 2003 48953054-4081 Konelab Service Manual JP7 JP5 JP3 JP1 TP1 JP8 JP6 JP4 JP2 XP6 XP4 1 XP5 20 INCUBATOR 19 DISPENSER Y XP3 MB1-9 21 FMI PUMP 18 DISPENSER XP2 23 MIXER Y 22 INOUT Konelab Service Manual 17 CUVETTE LOADER JP8 JP6 JP4 JP2 XP2 TP1 XP3 50 FILTER DISK 49 STORAGE XP1 F JP7 JP5 JP3 JP1 48 MEAS CH 48953054-4081 XP5 XP7 MERKKI MARK KORVAA REPLACES 2 / 17 NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES CABLE CHART / RACKS Konelab 25 MUUTOS REVISIONS ONLY IN 25i TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE XP11 XP13 HYV. APPR. M-FILMI M-FILM P841993 4101 A 02.08.01 ARen 24.04.02 SK 24.04.02 JN Cable Charts KORVATTU REPLACED LEHTI SHEET Thermo Clinical Labsystems Oy 32 MIXER MOTOR 3 33 SYRINGE F MB1-3 JP8 JP6 JP4 JP2 34 MIXER WASH XP10 XP12 TP1 XP9 XP8 XP7 38 ISE FMI PUMP XP11 XP13 JP7 JP5 JP3 JP1 XP6 XP4 35 TEMP XP3 2 XP5 36 ISE Y XP2 MB1-9 37 ISE XP1 39 ISE WASH XP4 XP8 XP6 XP9 24 MIXER XP7 40 ISE XP10 XP12 XP1 3-124 Version I RACK2 126 PHOTO F 16 CAN BIAS RACK1 Figure 3-118 Racks (Konelab 20XT, 20XTi) November 2, 2003 48953054-4081 BACK PANEL FANS IN K277 + 24V GND R2 STORAGE R1 28V K349 XP12 CAN XP10 K274 K276 K275 MB 1-9 1 REAGENT AND SAMPLE K271 K345 XP13 28V XP11 CAN PHOTO 28V + 28V XP12 CAN XP10 XP8 28V K346 K370 K273 XP1 MB 1-9 2 CAN XP7 CAN TERMINATION XP6 KORVAA REPLACES 3 / 17 NIMI NAME MUUTOS REVISIONS CABLE CHART / POWER, CAN AND FAN CABLES LIITTYY ASSOCIATES KORVATTU REPLACED LEHTI SHEET K371 TEMP XP3 Konelab 25 K345 LIITTYY ASSOCIATES MERKKI MARK K272 K346 Thermo Clinical Labsystems Oy 28V XP11 CAN XP13 K368 K369 HOUSE LAMP CAN 3 XP5 MB 1-3 28V XP7 XP6 28V November 2, 2003 CAN XP4 TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM P841993 4101 A 02.08.01 ARen 24.04.02 SK 24.04.02 JN Version I Cable Charts 3-125 Figure 3-119 Power, can and fan cables (Konelab 20XT, 20XTi) Konelab Service Manual 48953054-4081 K269 L 2 6 shield black 1 5 N 4 3 K200 red S1 red K285 K267 (ETHERNET) WORK STATION red K268 1 K270 F1 2 _ KORVAA REPLACES 4 / 17 NIMI NAME MUUTOS REVISIONS Konelab 25 K273 K272 K274 CABLE CHART / CONNECTOR PANEL AND POWER UNIT LIITTYY ASSOCIATES LIITTYY ASSOCIATES black shield red TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE XP1 HYV. APPR. M-FILMI M-FILM P841993 4101 A 02.08.01 ARen 24.04.02 SK 24.04.02 JN MB1-9(2) XP13 FRAME Cable Charts KORVATTU REPLACED LEHTI SHEET Thermo Clinical Labsystems Oy MERKKI MARK red red brown blue black POWER UNIT CANBIAS XP2 28V black GND + CONNECTOR PANEL blue brown L N _S Konelab Service Manual +S 3-126 Version I Figure 3-120 Connector panel power unit (Konelab 20XT, 20XTi) November 2, 2003 November 2, 2003 48953054-4081 XP1 XP1 (200) XP2 1 K266 7 XP2 1-8 CONN XP1 (200) K295 K298 MB 1-9 (1) MOTOR ID 19 DISP. Y K116 NN CO 1-6 XP1 Y-MOV HEDS MOTOR ID 18 DISP. f (200) K262 CONN 1-8 XP 2 1 7 K297 f -MOV XP7 XP2 XP5 XP2 1-6 CONN Y -OPTO K296 XP7 XP2 XP5 (200) K265 K 299 f -OPTO DISPENSER K254 XP1 XP2 K11 K12 TO CHASSIS XP3 SURF K185 TO CHASSIS K305 KORVAA REPLACES NIMI NAME MUUTOS REVISIONS Konelab 25 CABLE CHART / DISPENSERS LIITTYY ASSOCIATES 5 / 17 LEHTI SHEET KORVATTU REPLACED LIITTYY ASSOCIATES Thermo Clinical Labsystems Oy MERKKI MARK K117 MB 1-9 (2) MOTOR ID 37 ISE DISP. f (only in 25 i) K304 MOTOR ID 36 ISE DISP. Y (only in 25 i) K303 XP7 XP2 XP5 K302 Y-MOV HEDS f -MOV (ONLY IN 25i) XP7 XP2 XP5 K301 Y -OPTO f -OPTO XP3 SURF XP2 K181 XP1 ISEAMP ISE DISPENSER XP1 Z SUHDE SCALE PVM DATE LAJI CLASSIF. KOODI CODE HYV. APPR. TARK. CHECKED PIIRT. DRAWN TEKI DRAWN K190 XP4 ISE ID 40 (only in 25 i) XP2 K306 MOTOR ID 38 ISEDILP XP3 OPTO HYV. APPR. M-FILMI M-FILM P841993 4101 A 02.08.01 ARen 24.04.02 SK 24.04.02 JN Version I Cable Charts 3-127 Figure 3-121 Dispensers (Konelab 20XT, 20XTi) Konelab Service Manual Konelab Service Manual 48953054-4081 K97 XP7 K14 MB 1-9 (1) MOTOR ID 24 MIXER f K110 XP2 K96 MOTOR ID 23 MIXER Y XP3 XP2 XP7 K109 f -OPTO MIXER Y -OPTO 1 7 7 1 XP2 XP2 MB 1-9 (2) MOTOR ID 32 MIXER XP7 K14 Y-MOV f -MOV XP1 XP1 K13 K15 KORVAA REPLACES 6 / 17 NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MUUTOS REVISIONS CABLE CHART / MIXER Konelab 25 Z SUHDE SCALE PVM DATE TEKI DRAWN LAJI CLASSIF. KOODI CODE HYV. APPR. TARK. CHECKED PIIRT. DRAWN HYV. APPR. M-FILMI M-FILM P841993 4101 A 02.08.01 ARen 24.04.02 SK 24.04.02 JN Cable Charts KORVATTU REPLACED LEHTI SHEET Thermo Clinical Labsystems Oy MERKKI MARK OPTO 3-128 Version I Figure 3-122 Mixer November 2, 2003 November 2, 2003 48953054-4081 XP6 MB 1-9 (1) MOTOR ID 21 FMI PUMP XP2 (200) K363 (200) K364 XP2 1-8 CO NN XP1 K310 X P2 CO NN 1-6 7 K308 1 XP1 XP2 K309 K373 MOTOR ID 33 SYRINGE XP7 K311 XP2 CO NN 1-8 XP 1 MB 1-9 (2) K312 KORVAA REPLACES KORVATTU REPLACED LEHTI SHEET 7 / 17 MUUTOS REVISIONS Konelab 25 CABLE CHART / SYRINGES AND PUMPS NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES MOTOR ID 39 ISE WASH (only in 25 i) XP7 K366 (200) XP2 1-8 CONN XP1 Thermo Clinical Labsystems Oy MERKKI MARK XP2 XP3 K190 MOTOR ID 38 ISE FMI PUMP (only in 25 i) K314 XP6 K367 (200) ISE ID 40 XP4 XP7 XP2 CONN 1-8 XP 1 MOTOR ID 34 MIXER WASH K365 (200) K313 ISE (ONLY IN 25i) TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM P841993 4101 A 02.08.01 ARen 24.04.02 SK 24.04.02 JN Version I Cable Charts 3-129 Figure 3-123 Syringes and pumps (Konelab 20XT, 20XTi) Konelab Service Manual K315 7 48953054-4081 2 XP 1 K316 K320 MB 1-9 (1) K319 K321 (200) K317 1 7 K323 K324 XP4 K225 XP1 XP2 XP7 XP2 XP7 XP9 NIMI NAME MUUTOS REVISIONS Konelab 25 TEKI DRAWN KOODI CODE LAJI CLASSIF. HYV. APPR. TARK. CHECKED PIIRT. DRAWN Z PVM DATE Storage SUHDE SCALE K325 MB 1-3 MOTOR ID 48 MEASCH. CABLE CHART / INCUBATOR AND MEASURING CHANNEL XP2 KORVAA REPLACES 8 / 17 LIITTYY ASSOCIATES K351 K371 M-FILMI M-FILM P841993 4101 A 02.08.01 ARen 24.04.02 SK 24.04.02 JN HYV. APPR. Sample/Reagent Cable Charts KORVATTU REPLACED LIITTYY ASSOCIATES LEHTI SHEET MB 1-9 (2) Thermo Clinical Labsystems Oy MERKKI MARK XP3 TEMP ID 35 K327 XP5 MOTOR ID 20 INCUB. K328 K326 HEDS XP7 MOTOR ID 17 CUVETTE LOADER (200) K264 XP2 1-6 CONN XP1 K322 K224 REF. XP2 INOUT ID 22 (600) K318 K83 7 (600) NN CO 1-6 1 XP XP1 K84 1 7 XP2 XP2 XP 1 1-6 1 PHOTO ID 126 CONN CO NN Konelab Service Manual SIG. 1-6 Jumper JP1-JP2 XP 2 3-130 Version I XP3 XP5 Figure 3-124 Incubator and measuring channel (Konelab 20XT, 20XTi) November 2, 2003 November 2, 2003 48953054-4081 K270 ETHERNET (connector panel) LEDS X P1 MOTOR ID 32 MIXER MOTOR K371 XP10 XP8 XP7 XP6 XP2 XP4 XP3 XP2 TEMP ID 35 XP3 XP5 CONN 1-8 XP2 MB 1-9 (2) MOTOR ID 34 MIXER WASH K342 XP4 INOUT ID 22 K343 thermistor KORVAA REPLACES NIMI NAME Konelab 25 MUUTOS REVISIONS CABLE CHART / STORAGE LIITTYY ASSOCIATES 9 / 17 LEHTI SHEET KORVATTU REPLACED K339 K340, K342 ja K341, K343 paikat vaihdettu MB 1-3 MOTOR ID 49 STORAGE LIITTYY ASSOCIATES a K329 XP5 Thermo Clinical Labsystems Oy MERKKI MARK K125 XP7 MB 1-9 (1) K337 K330 K341 cooling unit K340 XP2 CANBIAS ID 16 K338 black K345 GND / chassis K372 red K346 +28V / XP1 SAMPLE / REAGENT STORAGE TEKI DRAWN Z SUHDE SCALE ARen LAJI CLASSIF. KOODI CODE HYV. APPR. TARK. CHECKED PIIRT. DRAWN 05.11.02 PVM DATE JN HYV. APPR. M-FILMI M-FILM P841993 4101 A 02.08.01 ARen 24.04.02 SK 24.04.02 JN Version I Cable Charts 3-131 XP2 XP5 XP5 Figure 3-125 Storages (Konelab 20XT, 20XTi) Konelab Service Manual Konelab Service Manual 48953054-4081 K279 XP2 MB 1-3 MOTOR ID 50 FILTER DISK XP7 K78 1-6 7 XP2 CONN XP1 1 K77 CHOPPER MOTOR XP1 XP2 1-6 CONN 1 7 K79 (600) K81 K241 (600) K280 K82 LAMP HOUSE XP5 XP4 XP3 PHOTO ID 126 XP4 K204 a KORVAA REPLACES 10 / 17 NIMI NAME CABLE CHART / LAMP HOUSE AND WATER DETECTORS LIITTYY ASSOCIATES Konelab 25 MUUTOS REVISIONS DILUENT TEKI DRAWN ARen KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE 05.11.02 JN HYV. APPR. M-FILMI M-FILM P841993 4101 A 02.08.01 ARen 24.04.02 SK 24.04.02 JN Cable Charts KORVATTU REPLACED LEHTI SHEET LIITTYY ASSOCIATES poistettu merkint„ K80 Thermo Clinical Labsystems Oy MERKKI MARK MB 1-9 (1) INOUT ID 22 XP3 K203 WASTE 3-132 Version I Figure 3-126 Lamp house and water detectors (Konelab 20XT, 20XTi) November 2, 2003 November 2, 2003 red 1 white-yellow 3 black 5 white-orange 7 2 red-white 4 yellow 6 white-black 8 orange PACIFIC SCIENTIFIC 1.8ø M21NRXE 1,01A yellow 3 orange 5 4 red 6 brown ESCAP P110 - 064 - 015 4 red 6 green-white W red-white 3 green 5 4 red 6 green-white SONCEBOZ 6600 R.158 1.3A / Ph Molex 90142-0008 Dual Row C-Grid III Crimp Connector Housing 90119-2110 Female Crimp Terminal 90119-0110 Female Crimp Terminal) SONCEBOZ 1.4A / Ph 2.6 red-white 3 green 5 (Connector: Terminal: MOTOR CONNECTIONS TO XP7, VIEW FROM CABLE SIDE 48953054-4081 KORVAA REPLACES 11 / 17 NIMI NAME LIITTYY ASSOCIATES KORVATTU REPLACED LEHTI SHEET 6 5 LIITTYY ASSOCIATES 2 1 7 8 1 2 2 black 4 red-white 6 black-white 8 green Thermo Clinical Labsystems Oy MERKKI MARK SURF/HEDS 1 TILT 2 SURF/CHA 3 SURFOSC 4 GND 5 VDD 6 LED 7 LED/CHB 8 -5V OPTO 1 LED 2 GND 3 VDD 4 GND 5 OPT 6 NC /+28VP MOTOR 1 OUTB2 2 OUTB1 3 OUTB2 4 OUTB1 5 OUTA2 6 OUTA1 7 OUTA2 8 OUTA1 red 1 white 3 green-white 5 orange 7 SONCEBOZ 6500 R.497 1A / Ph 4 yellow 6 red CABLE CHART / MOTOR Konelab 25 MUUTOS REVISIONS Z SUHDE SCALE PVM DATE SURF (liquid detector, needle tilt) / HEDS (feedback opto) OPTO2 17 Cuvette loader (back) 38 ISE LIQ DET OPTO1 (zero point) 17 Cuvette loader (middle) PARAL. (motor windings) SERIAL. (motor windings) 21 Diluent pump 38 ISE Diluent pump white 3 green 5 LAJI CLASSIF. KOODI CODE HYV. APPR. TARK. CHECKED PIIRT. DRAWN TEKI DRAWN SONCEBOZ LINEAR ACTUATOR W 7214 R005 8.8V 46 HYV. APPR. M-FILMI M-FILM P841993 4101 A 02.08.01 ARen 24.04.02 SK 24.04.02 JN Version I Cable Charts 3-133 Figure 3-127 Motor (Konelab 20XT, 20XTi) Konelab Service Manual Konelab Service Manual GND VDD1 48953054-4081 MERKKI MARK KORVAA REPLACES 12 / 17 1 2 3 1 2 3 NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES XP4 1 MEASGND 2 RES23 RES2+ 4 CH4IN 5 RES26 RES2+ MUUTOS REVISIONS CABLE CHART / TEMP Konelab 25 (THERM 4-6) RES2 MeasCh TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE THERM 1-3 Sample/Reagent Storage Thermistor RES1 Incub HYV. APPR. M-FILMI M-FILM P841993 4101 A 02.08.01 ARen 24.04.02 SK 24.04.02 JN Cable Charts KORVATTU REPLACED LEHTI SHEET Thermo Clinical Labsystems Oy 4 5 6 4 5 6 XP2 1 MEASGND 2 RES13 RES1+ 4 CH1IN 5 RES16 RES1+ 3-134 Version I Figure 3-128 Temp (Konelab 20XT, 20XTi) November 2, 2003 November 2, 2003 48953054-4081 2 3 6 KORVAA REPLACES 13 / 17 NIMI NAME LIITTYY ASSOCIATES KORVATTU REPLACED LEHTI SHEET 1 LIITTYY ASSOCIATES XP8 1 +28V 2 GND 3 GND 4 GND 5 GND 6 GND XP6, 7 1 CANA 2 CANA 3 CANB 4 CANB XP4 1 GND 2 MOT+ 3 GND 4 +5VCH 5 +5VCH 6 NC XP5 1 NC 2 LAMP+ 3 GND 4 NC 5 +15VM 6 - 15VM XP3 1 CHOPLED 2 GND 3 +5VCH 4 GND 5 CHOPSYNC 6 AGND Thermo Clinical Labsystems Oy MERKKI MARK 1 5 6 5 4 2 1 XP1, XP2 1 +12V 2 -12V 3 CH S / R 4 GNDSENS 5 PREGAIN 6 AGND MUUTOS REVISIONS CABLE CHART / PHOTO Konelab 25 POWER CAN CAN LAMP POWER CHOPPER MOTOR SYNC OPTO PHOTREF (reference channel) TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE PHOTSIG Jumper JP1-JP2 (signal channel) HYV. APPR. M-FILMI M-FILM P841993 4101 A 02.08.01 ARen 24.04.02 SK 24.04.02 JN Version I Cable Charts 3-135 Figure 3-129 Photo (Konelab 20XT, 20XTi) Konelab Service Manual Konelab Service Manual VDD1 GND XP10 1 TXD 2 SUPPLYGND 3 TRIGGER 4 SIGNALGND 5 RXD 6 +5V 7 BCR_RESET 8 +12VRS 8 7 5 6 1 2 2 1 XP6, 7, 8, 9 1A A 2 GND 3 +5V 4 GND 5 IN A_C 6 NC /+28VP XP3, 4, 5 1A B 2 GND 3 +5V 4 GND 5 IN B_C 6 NC/+28VP XP2 1 LED1A 2 GND 3 LED2A 4 GND 5 LED3A 6 GND 7 LED4A 8 GND 48953054-4081 KORVAA REPLACES 14 / 17 NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES CANBIAS XP3 CABLE CHART / INOUT Konelab 25 MUUTOS REVISIONS Cuvettes in Storage Opto TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM P841993 4101 A 02.08.01 ARen 24.04.02 SK 24.04.02 JN Cable Charts KORVATTU REPLACED LEHTI SHEET / Stat Cover Reed Relay Cuvette Cover Opto Segment Rea gent Cover Opto MeasCh Reflective Object Sensor Water (Diluent) Detector Waste Detector Segm. / Stat GLED Segm. / Stat RLED Reag. GLED Reag. RLED Thermo Clinical Labsystems Oy MERKKI MARK IN4A IN3A IN2A IN1A IN3B IN2B IN1B LEDS 3-136 Version I Figure 3-130 INOUT (Konelab 20XT, 20XTi) November 2, 2003 VDD1 November 2, 2003 GND (only in 25i) 48953054-4081 6 5 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES 15 / 17 LEHTI SHEET KORVATTU REPLACED LIITTYY ASSOCIATES XP5 1 VDD1TEST 2 +15VTEST 3 - 15VTEST 4 +5VTEST 5 - 5VTEST 6 GND XP4 1 LIQEDETOUT 2 LIQEDETOUT 3 LIQEDETOUT 4 LIQEDETOUT 5 GND 6 GND XP3 1 BS1P 2 BS2P 3 BS3P 4 BS4P 5 +12VBS 6 A GND XP2 1 DETACK1KB 2 DETON 3 DETLED 4 DETOUT 5 MUX1P 6 MUX2P 7 MUX3P 8 MUX4P 9 AGND 10 SIGIN 11 GNDSENSE 12 VREF+ 13 VREF14 +12VP 15 -12VP Thermo Clinical Labsystems Oy MERKKI MARK 1 2 1 1 MUUTOS REVISIONS CABLE CHART / ISE Konelab 25 TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE LIQ DET BLK SIM PREAMP (ISEAMP) HYV. APPR. M-FILMI M-FILM P841993 4101 A 02.08.01 ARen 24.04.02 SK 24.04.02 JN Version I Cable Charts 3-137 Figure 3-131 ISE (Konelab 20XT, 20XTi) Konelab Service Manual Konelab Service Manual 48953054-4081 MERKKI MARK KORVAA REPLACES 16 / 17 NIMI NAME LIITTYY ASSOCIATES LIITTYY ASSOCIATES CABLE CHART / CANBIAS Konelab 25 MUUTOS REVISIONS DC LED RES LED DOM LED TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM P841993 4101 A 02.08.01 ARen 24.04.02 SK 24.04.02 JN Cable Charts KORVATTU REPLACED LEHTI SHEET Thermo Clinical Labsystems Oy (Cuvette Loader GLED) (Cuvette Loader RLED) MOT OUT MOT IN LEDS BCR OUT SER IN (from INOUT) CAN OUT 3-138 Version I Figure 3-132 CANBIAS (Konelab 20XT, 20XTi) November 2, 2003 November 2, 2003 XP2 XP1 XP 2 XP 1 XP 3 D3 K333 LED1-1 R K331 XP3 LED1-1 XP3 S D3 REAGENT COVER OPTO LED1-1 K332 XP2 XP1 TRI COLOR LED D3 K336 LED1-3 CONN1-6 K331 XP2 XP1 D2 XP3 C D1 K335 XP2 XP1 LED1-3 48953054-4081 KORVAA REPLACES NIMI NAME LIITTYY ASSOCIATES 17 / 17 LEHTI SHEET KORVATTU REPLACED LIITTYY ASSOCIATES MERKKI MARK Thermo Clinical Labsystems Oy INOUT XP8 INOUT XP7 CANBIAS XP5 K338 MUUTOS REVISIONS CABLE CHART / COVERS Konelab 25 CUVETTE COVER OPTO K331 K334 K337 K335 RED GREEN K334 D1 D2 K331 K334 C INOUT XP6 INOUT XP2 XP3 Cathode TEKI DRAWN KOODI CODE LAJI CLASSIF. Z HYV. APPR. TARK. CHECKED PIIRT. DRAWN SUHDE SCALE PVM DATE HYV. APPR. M-FILMI M-FILM P841993 4101 A 02.08.01 ARen 24.04.02 SK 24.04.02 JN Version I Cable Charts 3-139 Figure 3-133 Covers (Konelab 20XT, 20XTi) Konelab Service Manual 3-140 Konelab Service Manual Cable Charts 48953054-4081 Version I November 2, 2003 Version I Different Parts of Konelab 4-1 Section 4 Different Parts of Konelab Different parts of Konelab are presented here in alphabetical order: 4.1 Arms ..................................................................................................................... page 4-3 4.1.1 Dispensing Arm Konelab 60 &30 840293 Konelab 20 841326 4.1.2 ISE Arm .................................................................................................. page 4-6 Konelab 60 & 30 & 20 840169 4.1.3 Mixer Arm Konelab 60 & 30 840275 4.2 Back Panel ........................................................................................................... page 4-9 Konelab 60 840374 Konelab 30 840376 Konelab 20 841380 4.3 Connector Panel................................................................................................... page 4-13 Konelab 60 840372 Konelab 30 840858 Konelab 20 841378 4.4 Cuvette Loader .................................................................................................... page 4-17 4.4.1 Konelab 60 4.4.1.1 Cuvette feeder 840233 4.4.1.2 Cuvette magazine 840221 4.4.1.3 Cuvette pusher 840198 4.4.1.4 Mover unit 840239 4.4.1.5 Rotation unit 840214 4.4.2 Konelab 30 & 20 840511 ......................................................................... page 4-24 4.5 Dispensing Drive Unit .......................................................................................... page 4-26 Konelab 60 & 30 & 20 840000 4.6 Driving Unit .......................................................................................................... page 4-28 Konelab 60 & 30 840046 Konelab 20 841360 4.7 Incubating Unit...................................................................................................... page 4-31 Konelab 60 840127 4.7.1 Dispensing Channel ................................................................................ page 4-31 Konelab 60 840078 4.7.2 Measuring Channel ................................................................................. page 4-34 Konelab 60 840088 Konelab 30 & 20 840600 4.7.2.1 Measuring Head 886060.............................. page 4-38 4.8 Lamp House ........................................................................................................ page 4-40 Konelab 60 & 30 & 20 840120 4.9 Reagent Storage ................................................................................................. page 4-42 Konelab 60 & 30 840173 4.10 Sample Storage ................................................................................................. page 4-44 Konelab 60 & 30 840184 4.10.1 Segment Loader ................................................................................... page 4-46 Konelab 60 & 30 840024 4.11 Sample & Reagent Basin.................................................................................... page 4-48 November 2, 2003 48953054-4081 Konelab Service Manual 4-2 Different Parts of Konelab Version I Konelab 20 841521 4.11.1 Reagent Cooling Unit ........................................................................... page 4-50 Konelab 20 841489 4.12 Syringe Unit ....................................................................................................... page 4-52 Konelab 60 & 30 840133 Konelab 20 841459 4.13 Tubings ............................................................................................................... page 4-57 Konelab 60 Konelab 30 Konelab 20 Konelab Service Manual 48953054-4081 November 2, 2003 Version I 4.1 Different Parts of Konelab 4-3 Arms 4.1.1 Dispensing Arm Konelab 60 & 30 840293 p840294E 6. 26. 27. 29. 840338 831687 840344 840551 SURF-TILTOPTO cable 180 Ground wire D531 SURF-MOTOR cable Ground wire 500 Refer to next page for Figure. Konelab 20 841326 p841327D 8. 11. 23. 25. 26. 29. 840348 841396 840338 831687 841394 840551 TILTOPTO cable 80 MIXMOTOR cable SURF-TILTOPTO cable 180 Ground wire D531 SURF-MOTOR cable Ground wire 500 Refer to page 4-5 for figure. November 2, 2003 48953054-4081 Konelab Service Manual 4-4 Different Parts of Konelab Version I Figure 4-1 Konelab 60 & 30: Dispensing arm 840293 Konelab Service Manual 48953054-4081 November 2, 2003 48953054-4081 E /DDNHULWOXNLWDDQ/2&7,7( F F D .685);3 .685);3 .RPSOHY\685) NLLQQLWHWllQORSSXNRNRRQSDQRVVD 0\|VOXLVWLQMDNHONDQ NLLQQLW\NVHVVl E .&211 F .&211 7RFKDVVLV .685);3 9DUUHQWXOHHROOD\KGHQVXXQWDLQHQ UXQJRQNDQVVDHLNlVHVDDYllQWllDNVHOHLWD 0RRWWRULVllGHWllQRLNHDOOHNRUNHXGHOOH UXXYLOODPLQNlMlONHHQODLSSDOXNLWDDQ UXQNRRQ0RRWWRULRQRLNHDOODNRUNHXGHOODNXQ QHXODRQS\VW\VXRUDVVDMDRSWROLSSDRQNXYDQ RVRLWWDPDVVDDVHQQRVVD 0RGHOQDPH BDQQRVWHOXYDUVL 'UDZLQJQDPHBDQQRVWHOXYDUVL November 2, 2003 Q G F 5XXYLOXNLWDDQ/2&7,7( /DDNHULWDSSLOXNLWDDQNHONDQKDKORQ\OlODLWDDQ E $NVHOLQMDRSWOHY\QYlOLLQ/2&7,7( 2SWROHY\SXULVWHWDDQDNVHOLLQ O\|GllQSLHQHWWlSlW .RPSOHY\&211 KDHWDDQORSSXNRNRRQSDQRQK\OO\VWl E 0XXWVHNRLWLQYDUVLODDNHULVLNVLMDYDVWDNVHOLODDNHULVLNVL PXXWHWWXODDNHULWDSLQVllW|DODODLGDVWD\OlODLWDDQ 8UDUXXYL0[',1 ,WVHOXNLWWDYDPXWWHUL0',1 $OXVOHY\$',1 $OXVOHY\$',1 .XXVLRNRORUXXYL0[',1 .XXVLRNRORUXXYL0[',1 2VD!0[',1$,6, 5LVWLXUDUXXYL0[',1 5LVWLXUDUXXYL0[',1 8SSRNULVWLXUDUXXYL0[',1 7KHUPR&OLQLFDO /DEV\VWHPV $WWDFK .RQHODE $WWDFK 6XUIDFHILQLVK 0DWHULDO $QQRVWHOXYDUVL. 'LVSHQFLQJDUP. 6KHHW 1DPH 6FDOH &RGH &ODVVLI 5HY ' -35 -35 'DWH 'HVLJQHU 'HVLJ -35 ,QVS MSU $SSU MSU MSU -35 +0] /XNNRUHQJDV',1 -RKGLQVLGH .XXVLRNRORSLGlWLQUXXYL0[',1 .XXVLRNRORSLGlWLQUXXYL0[',1 .XXVLRNRORSLGlWLQUXXYL0[',1 .XXVLRNRORSLGlWLQUXXYL0[',1 -RKGLQVLGHDQNNXUL E 2VDQURYDLKGHWWXRVDOXHWWHORVVDRVD!OLVlWW\OLLPDXVRKMHHW D /LVlWW\VllW|RKMHVLYPLWWDWHNVWL9DUUHQWXOHHROOD 5HY 0RGLILFDWLRQ F G 0XWWHUL\OlSXROHOOH G 9DNR 7\\SSL 1R Version I Different Parts of Konelab 4-5 Figure 4-2 Konelab 20: Dispensing arm 841326 Konelab Service Manual 4-6 Different Parts of Konelab Version I 4.1.2 ISE Arm Konelab 60 & 30 & 20 840169 p840170J 24. 25. 32. 33. 38. 64. 840340 840342 840338 840392 840551 831687 SURF-MOTOR-TEMP cable ISEAMP-ISE cable SURF-TILTOPTO cable 180 Block heating cable Ground wire 500 Ground wire D531 Refer to page 4-7 for figure. 4.1.3 Mixer Arm Konelab 60 & 30 840275 p840276E 5. 6. 7. 840367 840348 840346 MIXMOTOR cable TILTOPTO cable 80 MIXER-MIX Y-mixer arm cable Refer to page 4-8 for figure. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-7 Figure 4-3 Konelab 60 & 30 & 20: ISE Arm 840169 November 2, 2003 48953054-4081 Konelab Service Manual 4-8 Different Parts of Konelab Version I Figure 4-4 Konelab 60 & 30: Mixer arm 840275 Konelab Service Manual 48953054-4081 November 2, 2003 Version I 4.2 Different Parts of Konelab 4-9 Back Panel Konelab 60 840374 p840375A 8. 9. 10. 570264 711548 711559 Brushless DC Fan 24 V Antenna wire Antenna wire Refer to next page for figure. Konelab 30 840376 p840377A 8. 9. 10. 570264 711548 711559 Brushless DC Fan 24 V Antenna wire Antenna wire Refer to page 4-11 for figure. Konelab 20 841380 p841412A 8. 570264 Brushless DC Fan 24 V Refer to page 4-12 for figure. November 2, 2003 48953054-4081 Konelab Service Manual 4-10 Different Parts of Konelab Version I Figure 4-5 Konelab 60: Back panel 840374 Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-11 Figure 4-6 Konelab 30: Back panel 840376 November 2, 2003 48953054-4081 Konelab Service Manual Konelab Service Manual 48953054-4081 A A 20 15 20 15 a a + Osa Nimi a Arvo, tyyppi, aines 20 15 1 4 3 6 Kpl a VAKO 540472 619250 619252 631289 636308 731593 1/1 Korvattu Superseded Korvaa Supersedes Lehti Sheet 5 2 7 19 Muutos 17 18 Takalevy Back panel 48413808 - 4152 Konelab 20 Nimi Name Liittyy Liittyy Muutettu johtojen suunta Konelab Oy 18 19 16 1:3 Suhde Scale Pvm 16.9.99 jpr Hyv. Laji Classif. 2110 A 28414122 30.4.99 jpr 30.4.99 jpr Teki Koodi Code Hyv. Tark. Piirt. LEIKKAUS A - A 8 7 Puhallussuunta 11 Different Parts of Konelab Merkki Ruuvit lukitaan normaalisti Tyyppi Johdinside L=92 Kuusiokoloruuvi M4x8 DIN912 Kuusiokoloruuvi M4x12 DIN912 Kuusiomutteri M4 DIN934 Kehäl.aluslevy A4.3 DIN6798 Itsel.pandu-ankkuri Puhaltimien toiminta testataan kytkemällä virtalähteeseen No 15 16 17 18 19 20 4-12 Version I Figure 4-7 Konelab 20: Back panel 841380 November 2, 2003 Version I 4.3 Different Parts of Konelab 4-13 Connector Panel Konelab 60 840372 p840373G F1 S1 XP1 2. 511952 521521 540017 840716 Circuit breaker Power switch Mains inlet Ethernet cable Refer to next page for figure. Konelab 30 840858 p840859C S1 XP1 2. 521521 540017 840716 Power switch Mains inlet Ethernet cable Refer to page 4-15 for figure. Konelab 20 841378 p841393B F1 S1 XP1 2. 511952 521521 540017 841432 Circuit breaker Power switch Mains inlet Ethernet cable Refer to page 4-16 for figure. November 2, 2003 48953054-4081 Konelab Service Manual Konelab Service Manual G G 48953054-4081 . 0',1 $',1 NSO 0',1 $',1 0[',1 . $$ J . I $ .LHUUHWW\WZLVWHG ;3 ) 3RZHUXQLW 0',1 NSO SXUHG J . 6KHHW /LLWLQSDQHHOL &RQQHFWRUSDQHO 1DPH 0DWHULDO 6XUIDFHILQLVK 6FDOH 'DWH 5HY * $SSU ,QVS ONHQ MRP -35 -20 -20 -35 -35 -35 -35 -35 FD -35 -35 &ODVVLI &RGH $SSU ,QVS 'HVLJ 'HVLJ +0] +0] ONHQ ONHQ ONHQ MRP MRP 3&&$1 . 6DUMDQURWDUUD .DVDXVSlLYlWDUUD FD Different Parts of Konelab 7KHUPR&OLQLFDO /DEV\VWHPV 0RGLILFDWLRQV .RQHODE 5HY $WWDFK J 0',1 $',1 PXEON . SXUHG . PXEON . 32:&$1 .DDSHOLW.!.MD.!. 8XVLNXYDOLVlWW\3RVMD. /LVlWW\RVD /LVlWW\RDVW PXXWHWWX.MD.SDLNNRMD)VVl 0XXWHWWXVXODNNHHQSDLNND /LVlWW\) H $ . . $WWDFK J I H G F E D . SXUHG SXUHG .LHUUHWW\WZLVWHG . . I PXEON PXEON $',1 NSO 0',1 $',1 0[',1 6 .\WNHQWlRKMH&RQQHFWLRQLQVWUXFWLRQ 4-14 Version I Figure 4-8 Konelab 60: Connector panel 840372 November 2, 2003 0RGHOQDPH BOLLWLQSDQHHOL 'UDZLQJQDPH BOLLWLQSDQHHOL E November 2, 2003 E 48953054-4081 ."" 0',1 $',1 NSO 0',1 $',1 0[',1 $$ . D . D $ PXEON 0',1 NSO . . F 3RZHUXQLW SXUHG PXEON . $',1 NSO ;3 .LHUUHWW\WZLVWHG F 0',1 $',1 0[',1 6 6KHHW 7KHUPR&OLQLFDO /DEV\VWHPV 0DWHULDO 6XUIDFHILQLVK /LLWLQSDQHHOL &RQQHFWRUSDQHO 1DPH 0RGLILFDWLRQV .RQHODE 5HY $WWDFK . 8XVLNXYDOLVlWW\3RVMD. /LVlWW\RVDW PXXWHWWXNDDSHOLQXPHURW. !.. !. $ $WWDFK F E D . PXEON 32:&$1 SXUHG .LHUUHWW\WZLVWHG SXUHG . .\WNHQWlRKMH&RQQHFWLRQLQVWUXFWLRQ . 6FDOH &ODVVLI &RGH $SSU ,QVS 5HY & $SSU MRP -35 -35 FD ONHQ MRP -35 ,QVS -35 'HVLJ 'DWH 'HVLJ +0] ONHQ ONHQ 3&&$1 FD 6DUMDQURWDUUD .DVDXVSlLYlWDUUD Version I Different Parts of Konelab 4-15 Figure 4-9 Konelab 30: Connector panel 840858 Konelab Service Manual 0RGHOQDPH BOLLWLQSDQHHOL 'UDZLQJQDPH BOLLWLQSDQHHOL Konelab Service Manual 6DUMDQURWDUUD .DVDXVSlLYlWDUUD E ) D 48953054-4081 FD 0[',1 0',1 $',1 0',1 NSO . $',1 NSO ;3 6 . 3RZHU8QLW $$ . . . . 6XUIDFHILQLVK /LLWLQSDQHHOL &RQQHFWRUSDQHO 1DPH &$1%,$6 0DWHULDO E . E SXUHG . D 6FDOH ,QVS &ODVVLI &RGH $SSU 5HY % $SSU ,QVS MRP MRP -35 MRP -35 -35 'HVLJ 'DWH 'HVLJ +0] MRP Different Parts of Konelab 7KHUPR&OLQLFDO /DEV\VWHPV 6KHHW $WWDFK $WWDFK .RQHODE 0RGLILFDWLRQV 5HY E D 0',1 $ . SXUHG 8XVLNXYDOLVlWW\3RVMD. /LVlWW\)MD. $',1 NSO .""" $ .LHUUHWW\WZLVWHG PXEON SXUHG PXEON .\WNHQWlRKMH&RQQHFWLRQLQVWUXFWLRQ 4-16 Version I Figure 4-10 Konelab 20: Connector panel 841378 November 2, 2003 0RGHOQDPH BOLLWLQSDQHHOL 'UDZLQJQDPH BOLLWLQSDQHHOL Version I 4.4 Different Parts of Konelab 4-17 Cuvette Loader 4.4.1 Konelab 60 Cuvette feeder 840233 p840234J 1. 12. 21. 840235 840302 840380 Cuvette path Opto cable 620 Extension cable 600 Refer to page 4-19 for figure. Cuvette magazine 840221 p840222D 1. 5. 6. 19. 840223 840227 840228 840231 Magazine Front latch Rear latch Switch lever Refer to page 4-20 for figure. Cuvette pusher 840198 p840199I 1. 3. 4. 9. 14. 19. 21. 34. 840213 840691 840380 570114 840205 840210 840302 840417 Timing belt Extension cable 1500 Extension cable 600 Stepper motor Pusher arm Pusher Opto cable 620 Wide gap opto cable 620 Refer to page 4-21 for figure. Mover unit 840239 p840240F 6. 13. 16. 34. 570114 840246 840302 840380 Stepper motor Pusher Opto cable 620 Extension cable 600 Refer to page 4-22 for figure. November 2, 2003 48953054-4081 Konelab Service Manual 4-18 Different Parts of Konelab Rotation unit 840214 p840215C 6. 7. 8. 29. 840674 840396 840302 840398 30. Stepper motor + cable Linear motor+cable Opto cable 620 Linear motor extension cable 500 Extension cable 600 Version I 840380 Refer to page 4-23 for figure. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-19 Figure 4-11 Konelab 60: Cuvette feeder 840233 November 2, 2003 48953054-4081 Konelab Service Manual 4-20 Different Parts of Konelab Version I Figure 4-12 Konelab 60: Cuvette magazine 840221 Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-21 Figure 4-13 Konelab 60: Cuvette pusher 840198 November 2, 2003 48953054-4081 Konelab Service Manual 4-22 Different Parts of Konelab Version I Figure 4-14 Konelab 60: Mover unit 840239 Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-23 Figure 4-15 Konelab 60: Rotation unit 840214 November 2, 2003 48953054-4081 Konelab Service Manual 4-24 Different Parts of Konelab Version I 4.4.2 Konelab 30 & 20 Cuvette loader 840511 p840512H 1. 3. 5. 6. 7. 8. 9. 17. 20. 36. 42. 840228 840302 840380 840513 840514 840515 840516 840524 840527 570114 840417 Rear latch Opto cable 620 Extension cable 600 Stopper latch Detector plate, back Detector plate, middle Central latch Cuvette detector arm Front pushe Stepper motor Wide gap opto cable 620 Refer to next page for Figure. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-25 Figure 4-16 Konelab 30 & 20: Cuvette loader 840512 November 2, 2003 48953054-4081 Konelab Service Manual 4-26 4.5 Different Parts of Konelab Version I Dispensing Drive Unit Konelab 60 & 30 & 20 840000 p840001F 5. 24. 25. 840006 840302 570114 Dispensing arm holder Opto cable 620 Stepper motor Refer to next page for figure. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-27 Figure 4-17 Konelab 60 & 30 & 20: Dispensing drive unit 840000 November 2, 2003 48953054-4081 Konelab Service Manual 4-28 4.6 Different Parts of Konelab Version I Driving Unit Konelab 60 & 30 840046 p840047C 11. 12. 840302 840058 Opto cable 620 Encoder unit Refer to next page for figure. Konelab 20 841360 p841361B 2. 3. 11. 840058 840302 570118 Encoder unit Opto cable 620 Stepper motor Refer to page 4-30 for figure. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-29 Figure 4-18 Konelab 60 & 30: Driving unit 840046 November 2, 2003 48953054-4081 Konelab Service Manual D 48953054-4081 0[',1 0[',1 $$ 0[',1 E D /DDNHULOLLPDWDDQ/2&7,7(OOD +DPPDVKLKQDS\|UlRQDVHQQHWWDYDQLLQHWWl DVHPRLQWLOHY\QVXRUDWUHXQDWMDOLHUL|VRNNDRYDWVDPDOODOLQMDOOD 0[',1 0',1 $',1 0[',1 Konelab Service Manual 0[',1 $',1 0[',1 !"#$%$&' $ $ 7KHUPR&OLQLFDO /DEV\VWHPV 1DPH .l\WW|ODLWH. 'ULYLQJXQLW. 6XUIDFHILQLVK 0DWHULDO 6FDOH 'DWH ,QVS -35 -35 $SSU MRP MRP 5HY MSU % +0] +0] &ODVVLI &RGH $SSU ,QVS 'HVLJ 'HVLJ +0] +0] Different Parts of Konelab $WWDFK 6KHHW .RQHODE 0RGLILFDWLRQV /LVlWW\KXRPDXWXV E /LVlWW\PLWWDDWMD D 5HY $WWDFK 4-30 Version I Figure 4-19 Konelab 20: Driving unit 841360 November 2, 2003 0RGHOQDPH BNl\WW|ODLWH. 'UDZLQJQDPHB.l\W|ODLWHN Version I 4.7 Different Parts of Konelab 4-31 Incubating Unit Konelab 60 840127 p840128G 2. 3. 4. 9. 10. 11. 840070 840078 840088 840333 840302 840380 Incubating disk Dispensing channel Measuring channel Incubating disk's heating cable Opto cable 620 Extension cable 600 Refer to next page for figure. 4.7.1 Dispensing Channel Konelab 60 840078 p840079I 2. 13. 14. 15. 16. 840076 840335 840378 840691 840790 Cuvette arm Heating cable Reflective opto cable Extension cable 1500 Thermistor cable 50 Refer to page 4-33 for figure. November 2, 2003 48953054-4081 Konelab Service Manual 4-32 Different Parts of Konelab Version I Figure 4-20 Konelab 60: Incubating unit 840127 Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-33 Figure 4-21 Konelab 60: Dispensing channel 840078 November 2, 2003 48953054-4081 Konelab Service Manual 4-34 Different Parts of Konelab Version I 4.7.2 Measuring Channel Konelab 60 840088 p840089I 2. 15. 20. 21. 22. 23. 24. 840076 886060 840335 840378 840691 840646 840790 Cuvette arm Measuring head Heating cable Reflective opto cable Extension cable 1500 PHOTO-PHOTAMP cable Thermistor cable 100 Refer to next page for figure. Konelab 20 840600 p840607O 3. 5. 6. 7. 13. 15. 28. 38. 46. 56. 57. 58. 840302 840335 840378 840380 840612 840615 840634 886060 570114 840646 840866 840790 Opto cable 620 Heating cable Reflective opto cable Extension cable 600 Incubator Frame, measurement channel Cuvette arm Measuring head Stepper motor PHOTO-PHOTAMP cable Incubator heating cable Thermistor cable 100 Refer to page 4-36 for figure. Konelab 30 & 20 XT 841772 p841773C 3. 5. 6. 7. 13. 15. 28. 38. 46. 56. 57. 58. 840302 840335 840378 840380 840612 840615 840634 886060 570116 840646 N01124 840790 Opto cable 620 Heating cable Reflective opto cable Extension cable 600 Incubator Frame, measurement channel Cuvette arm Measuring head Stepper motor PHOTO-PHOTAMP cable Incubator heating cable Thermistor cable 100 Refer to page 4-37 for figure. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-35 Figure 4-22 Konelab 60: Measuring channel 840088 November 2, 2003 48953054-4081 Konelab Service Manual 4-36 Different Parts of Konelab Version I Figure 4-23 Konelab 20: Measuring channel 840600 Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-37 Figure 4-24 Konelab 30 & 20 XT: Measuring channel 841772 November 2, 2003 48953054-4081 Konelab Service Manual 4-38 Different Parts of Konelab Version I 4.7.2.1 Measuring Head Konelab 60 & 30 & 20 886060 p886064F 13. 18. 512709 512712 Beam splitter Biconvex lens Refer to next page for figure. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-39 Figure 4-25 Konelab 60 & 30 & 20: Measuring head 886060 November 2, 2003 48953054-4081 Konelab Service Manual 4-40 4.8 Different Parts of Konelab Version I Lamp House Konelab 60 & 30 & 20 840120 p840121J 6. 8. 10. 16. 20. 22. 27. 47. 884323 840460 888822 840112 830609 840302 840417 840380 Condenser Chopper motor+cable Lamp connector cable Filter wheel Lamp 6 V 20 W Opto cable 620 Wide gap opto cable 620 Extension cable 600 Refer to next page for figure. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-41 Figure 4-26 Konelab 60 & 30 & 20: Lamp house 840120 November 2, 2003 48953054-4081 Konelab Service Manual 4-42 4.9 Different Parts of Konelab Version I Reagent Storage Konelab 60 & 30 840173 p840174J 1. 5. 9. 10. 11. 12. 14. 15. 16. 830761 840177 733262 840269 570264 840302 840380 840629 840176 Cooling handle Heat exchange piece Silicon tube Window for barcode reader Brushless DC Fan 24 V Opto cable 620 Extension cable 600 Peltier and thermistor cables Cooling jacket Refer to next page for figure. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-43 Figure 4-27 Konelab 60 & 30: Reagent storage 840173 November 2, 2003 48953054-4081 Konelab Service Manual 4-44 4.10 Different Parts of Konelab Version I Sample Storage Konelab 60 & 30 840184 p840185J 1. 2. 4. 8. 9. 11. 16. 830761 840123 840182 840302 840705 570264 733262 Cooling handle Basin 40185 Heat exchange piece Opto cable 620 Peltier and thermistor cables Brushless DC Fan 24 V Silicon tube Refer to next page for figure. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-45 Figure 4-28 Konelab 60 & 30: Sample storage 840184 November 2, 2003 48953054-4081 Konelab Service Manual 4-46 Different Parts of Konelab Version I 4.10.1 Segment Loader Konelab 60 & 30 840024 p840025E Refer to next page for figure. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-47 Figure 4-29 Konelab 60 & 30: Segment loader 840024 November 2, 2003 48953054-4081 Konelab Service Manual 4-48 4.11 Different Parts of Konelab Version I Sample & Reagent Basin Konelab 20 841521 p841522E 1. 5. 841383 841532 Cooling plate Sample/ Reagent fans cable Refer to next page for figure. Konelab Service Manual 48953054-4081 November 2, 2003 November 2, 2003 (7( 0 - 48953054-4081 < - * *+ 37;%( >F> 7 ( ( 0DWHULDO 6XUIDFHILQLVK 6FDOH 'DWH 5HY ( ,QVS $SSU +0] +0] MSU &ODVVLI &RGH $SSU ,QVS 'HVLJ 'HVLJ +0] ? @B>E ? @B>E +0] -35 +0] -35 ) ) =7G )7G- 1DPH 6KHHW 0RGLILFDWLRQV 7KHUPR&OLQLFDO /DEV\VWHPV $WWDFK .RQHODE $WWDFK 5HY H /LVlWW\3RV < !=> 3RLVWHWWXRVDMD F /LVlWW\DVHQQXVRKMHHW3RV!0[ E /LVlWW\DVHQQXVRKMHHW D Version I Different Parts of Konelab 4-49 Figure 4-30 Konelab 20: Sample & Reagent basin 841521 Konelab Service Manual 0RGHOQDPH B1l\WHUHDJHQVVLDOODV 'UDZLQJQDPH B1l\WHUHDJHQVVLDOODV 4-50 Different Parts of Konelab Version I 4.11.1 Reagent Cooling Unit Konelab 20 841489 p841661B Figure 4-31 Konelab 20: Reagent cooling unit 841489 Konelab Service Manual 48953054-4081 November 2, 2003 Version I November 2, 2003 Different Parts of Konelab 48953054-4081 4-51 Konelab Service Manual 4-52 4.12 Different Parts of Konelab Version I Syringe Unit Konelab 60 & 30 840133 p840134D 2. 22. 840674 840302 Stepper motor + cable Opto cable 620 Refer to next page for figure. Konelab 20 Syringe motor and cable Syringe opto cable Syringe front plate 841459 p841472A p841501B p841502 Refer to page 4-54, page 4-55 and page 4-56 for figures. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-53 Figure 4-32 Konelab 60 & 30: Syringe unit 840133 November 2, 2003 48953054-4081 Konelab Service Manual 4-54 Different Parts of Konelab 4 3 Version I 550mm 1 XJ1 2 Katkaise musta ja valkoinen johto, suojaa katkaisukohdat kutistemuovilla Cut the black and white wire, cover the ends with heat shrink tubing 700 1 2 blue orange red yellow SYRINGE MOTOR 3 4 5 6 7 8 3 4 M XP7 5 6 Johdot t„ytyy jatkaa saman v„risill„ johdoilla ! Wires must be extended using wires of the same colors ! XJ1 crimp connector housing CGrid III dual row 1 EMI -ferrite 2 Molex 90142 8s Steward 28B0562-200 Kitagawa RI 14-28-6 Molex 90119 AWG22-24 90119-2110 90142-008 28B0562-200 RI 14-28-6 terminal CGrid III female crimp 3 cable sleeve D7mm lenght 550mm 4 motor Step-Syn TYPE 103-540-26 DC 4V 0,6A 1,8DEG/STEP a Kytkent„ korjattu, l is„tty ohje. Connection 123Konelab LIITTYY ASSOCIATES LEHTI SHEET LIITTYY ASSOCIATES KORVATTU REPLACED KORVAA REPLACES 1/1 corrected, note MUUTOS REVISIONS MERKKI MARK NIMI NAME added. 12.10.99 JHen JN PVM DATE TEKI DRAWN HYV. APPR. PIIRT. DRAWN 05.08.99 JHen TARK. CHECKED 05.08.99 JHen HYV. APPR. 05.08.99 JPR SUHDE SCALE KOODI CODE Z LAJI CLASSIF. 48414720 4112 A Konelab (841459) RUISKUN MOOTTORI + kaapeli SYRINGE MOTOR + cable M-FILMI M-FILM Figure 4-33 Konelab 20: Syringe motor and cable 841459 Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-55 Johtimet kierret„„n tai palmikoidaan l”ys„sti ennen liittimen laittamista! Wires must be twisted or plaited together slackly before putting the connector housing! XJ1 1 2 3 40 600 1 2 3 4 5 6 M XP2 red black white green blue 1 2 3 4 5 XJ1 crimp connector housing CGrid III dual row 1 EMI ferrite 2 terminal CGrid III female crimp SYRINGE MOTOR OPTO Molex 90142 6 s 90142-006 Steward 28B0375-300 Kitagawa RI 11-18-5 Molex 90119 AWG 28B0375-300 RI 11-18-5 90119-2121 loose 90119-0121 reel 90119-2122 loose 90119-0122 reel 26-28 3 optical switch Optek OPB943W51 OPB943W51 b a Jatkojohdot poistettu. Extension wires removed. Lis„tty ohje jatkojohdoista. Instruction added for extension wires. MUUTOS REVISIONS MERKKI MARK 123Konelab LIITTYY ASSOCIATES LEHTI SHEET LIITTYY ASSOCIATES 1/1 KORVATTU REPLACED KORVAA REPLACES NIMI NAME 08.11.99 12.10.99 JHen JHen JN PVM DATE TEKI DRAWN HYV. APPR. Konelab (841459) Ruiskun optokaapeli Syringe optocable M-FILMI M-FILM PIIRT. DRAWN 05.08.99 JHen TARK. CHECKED 05.08.99 JHen HYV. APPR. 05.08.99 JPR SUHDE SCALE KOODI CODE Z LAJI CLASSIF. 48415013 4112 B Figure 4-34 Konelab 20: Syringe opto cable (841459) November 2, 2003 48953054-4081 Konelab Service Manual 4-56 Different Parts of Konelab Version I Figure 4-35 Konelab 20: Syringe front plate 841459 Konelab Service Manual 48953054-4081 November 2, 2003 Version I 4.13 Different Parts of Konelab 4-57 Tubings Konelab 60 p841245 Assembly instruction II E-version Refer to next page for figure. Konelab 30 p841246 Assembly instruction II E-version Refer to page 4-56 for figure. Konelab 20 p841433 Assembly instruction E-version Refer to page 4-57 for figure. Konelab 20 XT p842053 Assembly instruction B-version November 2, 2003 48953054-4081 Konelab Service Manual 4-58 Different Parts of Konelab Version I Figure 4-36 Konelab 60: Assembly instruction II p841245 Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-59 Figure 4-37 Konelab 30: Assembly instruction II p841246 November 2, 2003 48953054-4081 Konelab Service Manual 4-60 Different Parts of Konelab Version I Figure 4-38 Konelab 20: Assembly instruction p841433 Konelab Service Manual 48953054-4081 November 2, 2003 Version I Different Parts of Konelab 4-61 Figure 4-39 Konelab 20 XT: Assembly instruction p842053 November 2, 2003 48953054-4081 Konelab Service Manual 4-62 Konelab Service Manual Different Parts of Konelab 48953054-4081 Version I November 2, 2003 Version I Maintenance 5-1 Section 5 Maintenance 5.1 Lubrication ............................................................................................................ page 5-3 5.1.1 Greasing of pump rollers ............................................................ page 5-3 5.2 Maintenance Window ........................................................................................... page 5-4 5.3 Maintenance Kits .................................................................................................. page 5-6 5.4 Maintenance Procedures...................................................................................... page 5-8 5.4.1 Replacing the lamp assembly.................................................................. page 5-8 5.4.2 Replacing interference filters ................................................................... page 5-10 5.4.3 Replacing a syringe ................................................................................. page 5-11 5.4.3.1 Konelab 60 and 30 ........................................................... page 5-11 5.4.3.2 Konelab 20 ....................................................................... page 5-12 5.4.4 Replacing needle units ............................................................................ page 5-13 5.4.5 Replacing mixing paddles........................................................................ page 5-16 5.4.6 Replacing tubes....................................................................................... page 5-16 5.4.6.1 Replacing pump tubes ..................................................... page 5-17 5.4.6.2 Replacing diluent and wash tubes ................................... page 5-21 5.4.6.3 Replacing drain and waste tubes ..................................... page 5-24 5.4.6.4 Replacing ISE tubes......................................................... page 5-27 5.4.6.5 Replacing KUSTI tubes.................................................... page 5-30 5.4.7 Replacing electrodes ............................................................................... page 5-31 5.5 Accuracy results ................................................................................................... page 5-33 5.5.1 Accuracy factors ...................................................................................... page 5-34 November 2, 2003 48953054-4081 Konelab Service Manual 5-2 Konelab Service Manual Maintenance 48953054-4081 Version I November 2, 2003 Version I Maintenance 5-3 /8%5,&$7,21 &RQGXFWRUVDQGEDOOEDUUHOV &RQGXFWRUVDQGEDOOEDUUHOVDUHFOHDQHGIURPSUHVHUYLQJRLOEHIRUHOXEULFDWLRQ)RU FOHDQLQJ\RXFDQXVH6ROPDVWHUFOHDQHUIRUHOHFWURQLFV6$ Use lubrication oil silicon (752312) for segment loader, lower rail of incubator in Konelab 30 and 30i. Silicon paste (840202) for peltiers and thermistors. Lithium grease (981614) for motor units, Kerk screws in syringe, upper rail of incubator in Konelab 30 and 30i. )RUOXEULFDWLRQXVH/LWKLXPVRDSGLHVWHURLOEDVHGOXEULFDQW6.)/*/7RU FRUUHVSRQGLQJ .(5.PRYHPHQWVFUHZVHJLQV\ULQJH )RUOXEULFDWLRQXVH/LWKLXPVRDSGLHVWHURLOEDVHGOXEULFDQW6.)/*/7RU FRUUHVSRQGLQJ %HDULQJV )RUOXEULFDWLRQXVH/LWKLXPVRDSGLHVWHURLOEDVHGOXEULFDQW6.)/*/7RU FRUUHVSRQGLQJ 7REHWWHUWKHUPDOFRQWDFWLQSHOWLHUVWKHUPLVWRUV 6LOLFRQSDVWHRUGHULQJFRGHLVXVHGWREHWWHUWKHUPDOFRQWDFW3HOWURQ3.( *RUFRUUHVSRQGLQJ 6FUHZORFNHU /RFWLWHRUFRUUHVSRQGLQJLVXVHGDVVFUHZORFNHULIH[WUDVWURQJIDVWHQLQJLV QHHGHG/RFWLWHRUFRUUHVSRQGLQJLVXVHG %HDULQJVORFNHU /RFWLWHRUFRUUHVSRQGLQJLVXVHGDVEHDULQJVORFNHULIH[WUDVWURQJIDVWHQLQJLV QHHGHG/RFWLWHRUFRUUHVSRQGLQJLVXVHG *HQHUDOJOXH /RFWLWHRUFRUUHVSRQGLQJLVXVHGIRUJOXLQJ *HQHUDOOXEULFDWLRQ 9,6275,)/2:$RUFRUUHVSRQGLQJFDQEHXVHGIRUJHQHUDOOXEULFDWLRQXQOHVV RWKHULVPHQWLRQHG *5($6,1*2)380352//(56 ,ISXPSVDUHQRLV\WKHJUHDVLQJRISXPSUROOHUVZLWK/LWKLXPVRDSGLHVWHURLOEDVHG OXEULFDQW6.)/*/7RUFRUUHVSRQGLQJFDQKHOS F November 2, 2003 3XWJUHDVHEHWZHHQWKHSODWHDQGUROOHUV 48953054-4081 Konelab Service Manual 5-4 Maintenance Version I 0$,17(1$1&(:,1'2: ,QVWUDFWLRQV )) 0DLQWHQDQFH 0DQDJHPHQW )) 0DLQWHQDQFH 0DLQWHQDQFH $ % 7KH0DLQWHQDQFHZLQGRZLVSURYLGHGZLWKWKHFKHFNLQJWDEOHRIWKHPDLQWHQDQFH SURFHGXUHV7KHPDLQWHQDQFHRSHUDWLRQVDUHVHHQLQWKHRUGHURIXUJHQF\ ,QIRUPDWLRQVHHQLQWKH0DLQWHQDQFHZLQGRZ 7KHH[FODPDWLRQPDUNUHPLQGVWKDWWKHWLPHWRSHUIRUPWKH PDLQWHQDQFHWDVNLVDOUHDG\RYHU 2SHUDWLRQ 'HVFULSWLRQRIWKHPDLQWHQDQFHWDVNWREHGRQH 1H[W 7KHGDWHIRUWKHQH[WPDLQWHQDQFHRSHUDWLRQ 3HUIRUPHG 7KHGDWHZKHQRSHUDWLRQKDVEHHQSHUIRUPHG ,QWHUYDO 7KHLQWHUYDORIWKHRSHUDWLRQLQGD\V :KR 7KHQDPHRIWKHSHUVRQZKRSHUIRUPHGWKHWDVN &RPPHQW $Q\FRPPHQWFRQFHUQLQJRSHUDWLRQ $ 6HOHFWWKHPDLQWHQDQFHRSHUDWLRQ % $FWLYDWH)WRPDUNWKHWDVNSHUIRUPHG*LYH\RXUQDPHDQGDQ\ FRPPHQWFRQFHUQLQJWKHRSHUDWLRQ7KHGDWHSHUIRUPHGDQGWKHGDWHIRU WKHQH[WRSHUDWLRQDUHXSGDWHGDXWRPDWLFDOO\ Konelab Service Manual 48953054-4081 November 2, 2003 Version I Maintenance 5-5 F 6DYHFKDQJHVZLWK):LWK)\RXFDQFDQFHOWKHFKDQJHVPDGHDIWHUWKH ODVWVDYH 7RFKDQJHWKHLQWHUYDO F 6HOHFW)WRFKDQJHWKHLQWHUYDORIWKHPDLQWHQDQFHRSHUDWLRQ7KHLQWHUYDO LVJLYHQDVGD\V<RXFDQJLYHLI\RXZDQWWKDWWKHRSHUDWLRQLVQRWIROORZHG HJDFFXUDF\WHVWLQJ November 2, 2003 48953054-4081 Konelab Service Manual 5-6 Maintenance Version I 0$,17(1$1&(.,76 0217+60$,17(1$1&(.,7)25.21(/$%$1'L 'LOXHQWDQGZDVKWXEHV +DORJHQODPS SF SF 0217+60$,17(1$1&(.,7)25.21(/$%$1'L 'LOXHQWDQGZDVKWXEHV +DORJHQODPS SF SF 0217+60$,17(1$1&(.,7)25.21(/$%$1'L 'LOXHQWDQGZDVKWXEHV +DORJHQODPS SF SF 0217+6,6(&RPSOHWHWXELQJIRU.RQHODEL ,6(7XELQJNLW SF 0217+60$,17(1$1&(.,7)25.21(/$%;7$1' ;7L 'LOXHQWWXEHV +DORJHQODPS SF SF 0217+6,6(&RPSOHWHWXELQJIRU.RQHODELDQGL 0217+60$,17(1$1&(.,7)25.21(/$%$1'L 6\ULQJHµOJULSIL[ 'LVSHQVLQJQHHGOHUHDJHQWVDPSOH 'LOXHQWDQGZDVKWXEHV 'UDLQZDVWHWXEHV +DORJHQODPS 'LVSHQVHUJURXQGZLUH SF SF SF SF SF SF 1 0217+60$,17(1$1&(.,7)25.21(/$%;7$1' ;7L 'LOXHQWWXEHV 'UDLQDQGZDVWHWXEHV 'LVSHQVLQJQHHGOH 0L[LQJSDGGOH +DORJHQODPS *URXQGZLUH 6\ULQJHO SF SF SF SF SF SF SF 0217+60$,17(1$1&(.,7)25.21(/$%$1'L 6\ULQJHO 'LVSHQVLQJQHHGOHUHDJHQWVDPSOH 'LOXHQWDQGZDVKWXEHV 'UDLQZDVWHWXEHV +DORJHQODPS 0L[LQJSDGGOH 'LVSHQVHUJURXQGZLUH SF SF SF SF SF SF SF Konelab Service Manual 48953054-4081 November 2, 2003 Version I Maintenance 0217+60$,17(1$1&(.,7)25.21(/$%$1'L 6\ULQJHO 'LVSHQVLQJQHHGOHUHDJHQWVDPSOH 'LOXHQWDQGZDVKWXEHV 'UDLQZDVWHWXEHV +DORJHQODPS 0L[LQJSDGGOH 'LVSHQVHUJURXQGZLUH SFV SFV SF SF SF SFV SF 0217+6,6(',63(16(5.,7IRU.RQHODEL;7 ,6(&RPSOHWHWXELQJ 'LVSHQVLQJQHHGOH *URXQGZLUH SF SF SF 0217+6,6(',63(16(5.,7IRU.RQHODELDQGL ,6(&RPSOHWHWXELQJ 'LVSHQVLQJQHHGOH,6( 6\ULQJHO 3XPSWXEH *URXQGZLUH SF SF SF SFV SF 0217+60$,17(1$1&(.,7IRU.867, 'LVSHQVLQJQHHGOH 7XELQJNLW *URXQGZLUH SF SF SF ,167580(17$&&85$&<7(67,1*.,7 $FFXUDF\VROXWLRQNLW $FFXUDF\WHVWSURFHGXUH±GHVFULSWLRQ SF SF November 2, 2003 5-7 48953054-4081 Konelab Service Manual 5-8 Maintenance Version I 0$,17(1$1&(352&('85(6 5(3/$&,1*7+(/$03$66(0%/< WARNING! The direct ultraviolet radiation from the lamp is dangerous for the eyes and skin. Do not touch glass surfaces of the lamp. The lamp house can be hot. 7KHODPSDQGWRDFHUWDLQH[WHQWLQWHUIHUHQFHILOWHUVGHJUDGHVVORZO\ZLWKWLPH :LWK .867, RSWLRQ A halogen lamp is delivered with the code number 981481. )LJXUH7KHSODFHRIWKHODPSKRXVHLQ.RQHODEDQG.RQHODELVEHKLQGWKH IURQWSDQHODQGLQ.RQHODEEHKLQGWKHOHIWVLGHSDQHOVHHQIURPWKHIURQWRIWKH DQDO\VHU,QFDVH.RQHODEKDVWKH.867,RSWLRQWKHQWKHODPSKRXVHLVEHKLQGWKH IURQWSDQHO F F &KDQJHWKHODPSZKHQWKHSRZHULVWXUQHGRII 2SHQWKHLQVWUXPHQW VOHIWVLGHSDQHOLQ.DQGIURQWSDQHOLQ.. DQG.ZLWK.867,5HIHUWR)LJXUH,QVLGHWKHDQDO\]HUEHKLQGWKHEODFN GRRULVWKHDFWXDOODPSDVVHPEO\2SHQWKHODPSKRXVH VGRRU F 7RUHPRYHWKHROGODPSILUVWVSUHDGWKHPHWDOFOLSVE\PRYLQJWKHPVOLJKWO\ RXWZDUGXSWRWKHQRWFKHV5HIHUWR)LJXUH7KHQSXOOWKHODPSDVVHPEO\RXWE\ KROGLQJIDVWRIWKHJUH\VRFNHW 5HPRYHWKHROGODPSDVVHPEO\WKHODPSHTXLSSHGZLWKWKHPHWDOFROODUIURPWKH JUH\VRFNHWE\KROGLQJIDVWRIWKHFROODU'LVFDUGWKHROGODPSDVVHPEO\ F FROODU ,QVWDOODQHZODPSDVVHPEO\LQWRWKHVRFNHWE\KROGLQJIDVWRIWKHPHWDO 1RZPHWDOFOLSVVKRXOGEHZLGH,IQRWVSUHDGWKHPHWDOFOLSVE\PRYLQJWKHP VOLJKWO\RXWZDUGXSWRWKHQRWFKHVDVVKRZQLQ)LJXUH 7KHQSODFHWKHDVVHPEO\LQWRWKHODPSFRPSDUWPHQWVRWKDWWKHQRWFKRQWKHPHWDO FROODUDOLJQVZLWKWKHSRVLWLRQLQJSLQLQWKHFRPSDUWPHQWZDOO6LPXOWDQHRXVO\ZLWK RWKHUKDQGUHOHDVHWKHPHWDOFOLSV&KHFNWKDWWKH\ZLOOUHWXUQWRWKHRULJLQDO ORFDWLRQV F Konelab Service Manual $IWHUFKDQJLQJWKHODPSSHUIRUPWKHIXQFWLRQ)6WDUWXS 48953054-4081 November 2, 2003 Version I Maintenance 5-9 6FUHZIRUYHUWLFDO DGMXVWPHQW 1RWFKHV /DPSVRFNHW 0HWDOFOLSV 6FUHZIRUKRUL]RQWDO DGMXVWPHQW )LJXUH7KHODPSDVVHPEO\DWWDFKHGZLWKWKHPHWDOFOLSVWKHPHWDOFOLSVDUH RSHQHGZKHQUHPRYLQJWKHODPSDQGUHOHDVHGZKHQDVVHPEOLQJDQHZODPS F F 7KHODPSLVSUHIRFXVHGDQGQRUPDOO\GRHVQRWQHHGWREHDGMXVWHG ,QFDVHWKHIROORZLQJPHVVDJHVDSSHDU\RXQHHGWRDGMXVWWKHIRFXVRIWKH ODPS 3RRUZDWHUEODQN 1RWHQRXJKOLJKW %HIRUHDGMXVWLQJPDNHVXUHWKDWWKHVHPHVVDJHVGRQRWFRPHEHFDXVHRI EXEEOHVLQWKHIOXLGLFFLUFXLWRUGLUW\LQFXYHWWHV ,IDGMXVWPHQWLVQHHGHGLWLVGRQHLQWKH,QVWUXPHQWDFWLRQVZLQGRZ)) $GMXVWPHQWSURJUDP0HDVXULQJXQLW)LOWHUGLVNEHDPDOLJQPHQW :KHQILOWHUGLVNEHDPDOLJQPHQWLVVHOHFWHGWKHLQVWUXPHQWLVILUVWGULYLQJWKHILOWHU ZKHHOWRLWVILUVWSRVLWLRQ$GMXVWWKHEHDPRIWKHODPSLQWRWKHPLGGOHRIWKHILOWHU SRVLWLRQZLWKWKHDGMXVWPHQWSURJUDP $IWHUWKDWWKHLQVWUXPHQWLVGULYLQJWKHILOWHUZKHHOLQWRLWVHPSW\SRVLWLRQ$GMXVWWKH OLJKWVSRWVRWKDWWKHILEHUEXQGOHLVVHHQLQWKHPLGGOHRILWUHIHUWR)LJXUHEHORZ $GMXVWPHQWLVGRQHZLWKWKHKRUL]RQWDODQGYHUWLFDOVFUHZVLQWKHODPSDVVHPEO\ /LJKWVSRW )LEHUEXQGOH F November 2, 2003 &ORVHWKHGRRURIWKHODPSKRXVHDQGWKHSDQHORIWKHLQVWUXPHQW 48953054-4081 Konelab Service Manual 5-10 Maintenance Version I 5(3/$&,1*,17(5)(5(1&(),/7(56 QP_QPQP_QP RSWLRQDO QP QP QP %ODFN CAUTION: Do not put your hand into the analyzer when the light chopper is rotating. QP (PSW\ QP_QP_QP_QP RSWLRQDO QP QP QP QP QP QP QP )LJXUH,QWHUIHUHQFHILOWHUVDUHDWWDFKHGWRWKHILOWHUZKHHO7KHZKHHOLVLQIURQWRI WKHODPSFRPSDUWPHQW7KHZKHHOSRVLWLRQVDUHQXPEHUHGIURPWR 7KHODPSYROWDJHLVDGMXVWHGDXWRPDWLFDOO\GXULQJ6WDUWXS7KHYDOXHVRIODPS YROWDJHVDQGVLJQDODQGUHIHUHQFHJDLQVDUHVHHQLQWKHZLQGRZ&KHFNZDWHUEODQN 5HIHUWRVHFWLRQLQ5HIPDQXDO 3RVVLEOHJDLQYDOXHVDUH:KHQWKHJDLQLVORZWKHILOWHULVJRRG :LWKWKHJDLQLVXVXDOO\RU:KHQWKHILOWHURUODPSRUIRFXVLVEORFNHGRU JHWWLQJROGDQGPXVWEHFKDQJHG:LWKWKHJDLQLVXVXDOO\RU:LWKDOOWKH UHVWILOWHUVRU6RPHWLPHVHYHQ 7KHODPSYROWDJHLVZKHQWKHILOWHUSRVLWLRQLVHPSW\ F F &KDQJHILOWHUVZKHQWKHDQDO\VHULVVZLWFKHGRII 2SHQWKHGRRURIWKHODPSKRXVH'HWDFKWKHODPSKRXVHVKLHOGE\RSHQLQJ WKHFURVVKHDGVFUHZVRQLW F F /RRVHQWKHILOWHUE\XQVFUHZLQJWKHKROGHUIURPWKHZKHHO 2QHVLGHRIWKHLQWHUIHUHQFHILOWHULVFRORXUHGWKHRWKHULVVLOYHU,QVWDOOD QHZLQWHUIHUHQFHILOWHUVRWKDWWKHVLOYHUVXUIDFHLVDJDLQVWWKHOLJKWVRXUFH F $WWDFKWKHODPSKRXVHVKLHOGE\VFUHZVDQGFORVHWKHODPSKRXVHGRRU Konelab Service Manual 48953054-4081 November 2, 2003 Version I Maintenance 5-11 5(3/$&,1*$6<5,1*( CAUTION: Do not put your hand into the analyzer when the light chopper is rotating. &KHFNLQJFULWHULD 7KHFRQQHFWLRQVVKRXOGEHWLJKW$LUWKDWJDWKHUVLQWRWKHF\OLQGHURUWXEHVDQGIUHH VROLGPDWHULDORQWKHSLVWRQWLSVLQGLFDWHWKHQHHGRIFKDQJLQJWKHV\ULQJH6\ULQJHV VKRXOGEHFKDQJHGRQFHD\HDU .21(/$%$1' F F &KDQJHWKHV\ULQJHZKHQWKHV\VWHPLVLQ67$1'%<0DNHVXUHWKDWWKH SLVWRQLVLQWKHXSSHUSRVLWLRQ /RRVHQWKHERWWRPKROGLQJVFUHZ/RRVHQWKHUHWDLQLQJVFUHZZKLFK IL[HVWKHEORFN3XOORXWWKHV\ULQJHSLVWRQDQGF\OLQGHU'HWDFKWKHWXEHVE\ XQVFUHZLQJWKHILWWLQJVRQWKHERWKVLGHVRIWKHV\ULQJHUHIHUWR)LJXUH F 7DNHDQHZV\ULQJH CAUTION! Tightening the screws (1), (3) in the wrong order and when the piston is in the down position may break the cylinder. ),*85(D7KHV\ULQJH XQLWRI.ODQG 6FUHZ &ODPS 6FUHZ )LWWLQJV F 6FUHZWKHILWWLQJVZLWKWKHWXEHVRQWKHERWKVLGHVRIWKHV\ULQJH(QVXUH WKDWWKHFRQQHFWLRQVDUHZDWHUWLJKW F F November 2, 2003 3ODFHWKHV\ULQJHLQWRWKHFODPS(QVXUHWKDWWKHV\ULQJHLVVWUDLJKW 7LJKWHQWKHUHWDLQLQJVFUHZDQGWKHQWKHKROGLQJVFUHZLQWKLVRUGHU 48953054-4081 Konelab Service Manual 5-12 Maintenance Version I .21(/$% 8SSHUVFUHZ /RZHUVFUHZ )LJXUHE7KHV\ULQJHXQLWRI.RQHODE F F F &KDQJHWKHV\ULQJHZKHQWKHV\VWHPLVLQ67$1'%< /RRVHQWKHORZHUVFUHZ'UDZLWGRZQVRWKDWWKHSLVWRQLVQRWIROORZLQJ /RRVHQWKHXSSHUVFUHZDQGWDNHWKHROGV\ULQJHRXW5HSODFHLWZLWKDQHZ RQH7LJKWHQWKHXSSHUVFUHZ F 3XVKWKHORZHUVFUHZXSWLJKWHQLWDQGPDNHVXUHWKDWLWGUDZVWKHSLVWRQ SURSHUO\ Konelab Service Manual 48953054-4081 November 2, 2003 Version I Maintenance 5-13 5(3/$&,1*1(('/(81,76 $//(1 $OOHQVFUHZV Dispensing needle(s) for sample/ reagent dispenser arm(s) are delivered with the code number 984010. 723 'LVSHQVHUDUPFRYHUYLHZIURPWKHWRS ',63(16(5 /HYHOGHWHFWLRQZLUH 7XEHKROGHUV &5( 6FUHZ 6,'( 5HDJHQWGLVSHQVHUDUPLQ.RQHODE ',63(16(5 .867,GLVSHQVHUDUP 1HHGOHWXEH YLHZIURPWKHVLGH 6\ULQJH 1RWHWKHQHHGOH DOLJQPHQW 127(352%( 6<5,1 /HYHOGHWHFWLRQZLUH 6FUHZ 7XEHKROGHUV 6DPSOHGLVSHQVHUDUPLQ.O 6DPSOHUHDJHQWGLVSHQVHUDUPLQ.ODQG.O YLHZIURPWKHVLGH )LJXUH$VDPSOHUHDJHQWQHHGOHDVVHPEO\ November 2, 2003 48953054-4081 Konelab Service Manual 5-14 Maintenance Version I 5HPRYHWKHGLVSHQVHUDUPFRYHUE\GHWDFKLQJWKHWKUHH$OOHQVFUHZVRQERWK VLGHVDQGWRSRIWKHFRYHU 'HWDFKWKHQHHGOHWXEHIURPWKHV\ULQJH 'HWDFKWKHOHYHOGHWHFWLRQZLUHIURPWKHFRQQHFWRULQWKHQHHGOH 'HWDFKWKHWXEHIURPKROGHUVDWWKHDUP 2SHQWKHVFUHZDWWKHQHHGOHKROGHU 5HPRYHWKHQHHGOHDQGUHSODFHLWZLWKDQHZQHHGOHDVVHPEO\1RWHWKH DOLJQPHQWWKHHYHQVLGHRIWKHQHHGOHDVVHPEO\PXVWEHDORQJVLGHZLWKWKHGLVSHQVHU DUPVRWKDWWKHQHHGOHJRHVGRZQSURSHUO\ &ORVHWKHVFUHZDWWKHQHHGOHKROGHU &RQQHFWWKHOHYHOGHWHFWLRQZLUHWRWKHFRQQHFWRULQWKHQHHGOHDVVHPEO\ &RQQHFWWKHWXEHWRWKHV\ULQJH $WWDFKWKHWXEHWRKROGHUVDWWKHDUP &KHFNWKDWWKHQHHGOHDVVHPEO\LVSURSHUO\LQSODFH$WWDFKWKHFRYHUWRWKH GLVSHQVHUDUP7KHULJKWSRVLWLRQRIWKHQHHGOHFDQEHFKHFNHGZLWK)LQ,QVWUXPHQW DFWLRQVZLQGRZ 3HUIRUPZDWHUZDVK)LQ,QVWUXPHQWDFWLRQVZLQGRZWRZDVKWKHQHHGOH .867,GLVSHQVLQJQHHGOH Dispensing needle for the KUSTI module is delivered with the code number 984073. /LIWWKH.867,FRYHUXS 'HWDFKWKHQHHGOHWXEHIURPWKH)0,SXPSIRXQGEHKLQGWKHGRRULQIURQWRIWKH LQVWUXPHQW 'HWDFKWKHOHYHOGHWHFWLRQZLUHIURPWKHFRQQHFWRULQWKHQHHGOH 'HWDFKWKHWXEHIURPKROGHUVDWWKHDUP 2SHQWKHVFUHZDWWKHQHHGOHKROGHU 5HPRYHWKHQHHGOHDQGUHSODFHLWZLWKDQHZQHHGOHDVVHPEO\1RWHWKH DOLJQPHQWWKHHYHQVLGHRIWKHQHHGOHDVVHPEO\PXVWEHDORQJVLGHZLWKWKHGLVSHQVHU DUPVRWKDWWKHQHHGOHJRHVGRZQSURSHUO\ &ORVHWKHVFUHZDWWKHQHHGOHKROGHU &RQQHFWWKHOHYHOGHWHFWLRQZLUHWRWKHFRQQHFWRULQWKHQHHGOHDVVHPEO\ &RQQHFWQHZWXEHWRWKH)0,SXPS $WWDFKWKHWXEHWRKROGHUVDWWKHDUP &KHFNWKDWWKHQHHGOHDVVHPEO\LVSURSHUO\LQSODFH$WWDFKWKHFRYHUWRWKH GLVSHQVHUDUP7KHULJKWSRVLWLRQRIWKHQHHGOHFDQEHFKHFNHGZLWK)LQ,QVWUXPHQW DFWLRQVZLQGRZ 3HUIRUPZDWHUZDVK)LQ,QVWUXPHQWDFWLRQVZLQGRZWRZDVKWKHQHHGOH Konelab Service Manual 48953054-4081 November 2, 2003 Version I Maintenance 5-15 Dispensing needle for ISE dispenser arm is delivered with the code number 984011. /HYHOGHWHFWLRQZLUH &RYHURI,6('LVSHQVHUDUP 1HHGOHWXEH 6FUHZ 1HHGOHKROGHUVHHQIURP WKHIURQWVLGH 1HHGOHKROGHUVHHQIURP WKHEDFNVLGH )LJXUH$Q,6(QHHGOHDVVHPEO\ 2SHQWKHFRYHURIWKH,6(GLVSHQVHUDUP7KHFRYHULVKLQJHGVRLWLVHDV\WR WXUQRSHQ 'HWDFKWKHQHHGOHWXEHIURPWKHHQGVOLFHRIWKH,6(EORFN 'HWDFKWKHOHYHOGHWHFWLRQZLUHIURPWKHFRQQHFWRULQWKHQHHGOH 2SHQWKHVFUHZDWWKHEDFNRIWKHQHHGOHKROGHU 5HPRYHWKHQHHGOHDQGUHSODFHLWZLWKDQHZQHHGOHDVVHPEO\1RWHWKH DOLJQPHQWWKHHYHQVLGHRIWKHQHHGOHDVVHPEO\PXVWEHDORQJVLGHZLWKWKHGLVSHQVHU DUPVRWKDWWKHQHHGOHJRHVGRZQSURSHUO\ &ORVHWKHVFUHZDWWKHQHHGOHKROGHU &RQQHFWWKHOHYHOGHWHFWLRQZLUHWRWKHFRQQHFWRULQWKHQHHGOHDVVHPEO\ &RQQHFWWKHWXEHWRWKHHQGVOLFH &KHFNWKDWWKHQHHGOHDVVHPEO\LVSURSHUO\LQSODFH&ORVHWKHFRYHURIWKH,6( GLVSHQVHUDUP7KHULJKWSRVLWLRQRIWKHQHHGOHFDQEHFKHFNHGZLWK)LQ,QVWUXPHQW DFWLRQVZLQGRZ 3HUIRUPZDWHUZDVK)LQ,QVWUXPHQWDFWLRQVZLQGRZWRZDVKWKHQHHGOH November 2, 2003 48953054-4081 Konelab Service Manual 5-16 Maintenance Version I 5(3/$&,1*0,;,1*3$''/(6 Mixing paddle(s) for mixer arm(s) are delivered with the code number 984012. )LJXUH:KHQUHSODFLQJPL[LQJSDGGOHVLQ.RQHODERSHQWKHZKROHGLVSHQVLQJ FRYHU7KHUHLVDEHDULQJURGWRNHHSWKHFRYHURSHQ,Q.RQHODELVRQO\QHHGWRRSHQ WKHXSSHUFRYHU F 7KHPL[LQJSDGGOHLVIDVWHQHGZLWKDVFUHZ2SHQWKHVFUHZ7KHUHLVQR QHHGWRRSHQWKHPL[LQJDUP VFRYHU F $VVHPEOHDQHZPL[LQJSDGGOH)DVWHQWKHVFUHZ 5(3/$&,1*78%(6 /LTXLGVLQWKHWXEHVVKRXOGPRYHVPRRWKO\DQGWKHWXEHFRQQHFWLRQVVKRXOGEH DLUWLJKW3HUPDQHQWIODWQHVVHVSHFLDOO\LQWKHSXPSWXEHVDUHQRWDOORZHG,IWKH WXELQJVKRZVVLJQVRIGHWHULRUDWLRQHJFRORXUFKDQJHVLWPXVWEHFKDQJHG 5HFRPPHQGHGFKDQJLQJLQWHUYDOIRUSXPSWXEHVDQGGLOXHQWDQGZDVKWXEHVLVWZLFH D\HDU'UDLQDQGZDVWHWXEHVDUHUHFRPPHQGHGWRFKDQJHRQFHD\HDU You can change tubes only when the analyser is switched off. Do not touch the tubing while analysis is in progress. 6RPHJXLGHOLQHVZKHQFKDQJLQJWKHWXELQJ F F 5HPRYHWKHGLVWLOOHGZDWHUFRQWDLQHU 3HUIRUPWZLFH:DWHUZDVK)LQ,QVWUXPHQWDFWLRQVWRUHPRYHWKHOLTXLGV IURPWKHWXELQJEHIRUHFKDQJLQJ F F $IWHUFKDQJLQJUHSODFHWKHGLVWLOOHGZDWHUFRQWDLQHU 3HUIRUPWZLFH:DWHUZDVK)LQ,QVWUXPHQWDFWLRQVSULRUWRVWDUWDQDO\VLV 7KLVZLOOILOOWKHWXEHVZLWKGLVWLOOHGZDWHUDQGDWWKHVDPHWLPH\RXFDQFKHFNWKH WLJKWQHVVRIWKHWXEHFRQQHFWLRQVDQGWKDWWKHUHDUHQRDLUEXEEOHVLQWKHWXEHVDIWHU UHSODFLQJWKHP Konelab Service Manual 48953054-4081 November 2, 2003 Version I Maintenance 5-17 5(3/$&,1*380378%(6 .RQHODE )LJXUH7KHSODFHRIWKH,6(ZDVKLQJSXPSLQ.RQHODEL .RQHODELLQFOXGHVWZR)0,SXPSVDQGRQHFRQYHQWLRQDOSXPS,6(:DVKLQJ SXPSIRURXWVLGHZDVKLQJRIWKH,6(GLVSHQVLQJDUPQHHGOH ,QVLGHRIWKH,6(:DVKLQJSXPSFRYHULVDVKRUW\HOORZLVPDSUHQHWXEH5HIHUWR VHFWLRQ5HSODFLQJ,6(WXEHVWRUHSODFHLW November 2, 2003 48953054-4081 Konelab Service Manual 5-18 Maintenance Version I .RQHODEDQG.RQHODE Pump tubes are included in: - 984023 diluent and wash tubes for K30 and 30i, - 984021 diluent and wash tubes for K60 and 60i, - 984020 ISE Complete tubing kit for K30i and 60i 3 3 3 3 )LJXUHD7KHSODFHVRISXPSWXEHVLQ.RQHODEL 3,6(GLVSHQVLQJSXPSLVXVHGWRWUDQVIHUDVDPSOHDQG,6(&DOLEUDWRUVROXWLRQ WRWKH,6(EORFNDQGDIWHUPHDVXUHPHQWWRWKHZDVWH 3:DVKLQJSXPSLVXVHGIRURXWVLGHZDVKLQJRIWKH,6(GLVSHQVLQJDUPQHHGOH 3:DVKLQJSXPSLVXVHGWRZDVKWKHVDPSOHPL[HU 3:DVKLQJSXPSLVXVHGWRZDVKWKHUHDJHQWPL[HU :DVKLQJSXPSWXEHV33DQG3DUH\HOORZLVPDSUHQHWXEHVDQGWKH\KDYHOLODF EULGJHV,6(GLVSHQVLQJSXPSWXEH3LVDWUDQVSDUHQW39&WXEHDQGLWKDVJUH\ EULGJHV Konelab Service Manual 48953054-4081 Pump tubes are delivered separately with the code numbers: - 980306 (transparent PVC tube with grey bridges for ISE dispensing pump) and - 981342 (yellow ismaprene tube with lilac bridges for washing pumps) November 2, 2003 Version I Maintenance 5-19 3 3 3 3 )LJXUHE7KHSODFHVRISXPSWXEHVLQ.RQHODEL 3,6(GLVSHQVLQJSXPSLVXVHGWRWUDQVIHUDVDPSOHDQG,6(&DOLEUDWRUVROXWLRQ WRWKH,6(EORFNDQGDIWHUPHDVXUHPHQWWRWKHZDVWH 3:DVKLQJSXPSLVXVHGIRURXWVLGHZDVKLQJRIWKH,6(GLVSHQVLQJDUPQHHGOH 3:DVKLQJSXPSLVXVHGWRZDVKWKHPL[HU :DVKLQJSXPSWXEHV3DQG3DUH\HOORZLVPDSUHQHWXEHVDQGWKH\KDYHOLODF EULGJHV,6(GLVSHQVLQJSXPSWXEH3LVDWUDQVSDUHQW39&WXEHDQGLWKDVJUH\ EULGJHV November 2, 2003 48953054-4081 Konelab Service Manual 5-20 Maintenance Version I 7RUHPRYHWKHROGWXEHLQ.RQHODEDQG F F F 3XOOXSWKHWXEHDQGOLIWWKHFROODUIURPWKHQRWFK5HIHUWR)LJXUH 0DQXDOO\URWDWHWKHSXPSFORFNZLVH6LPXOWDQHRXVO\SXOOWKHWXEHRXW 'HWDFKWKHWXEHIURPWKHILWWLQJV &ROODU 1RWFKHV )LJXUH'HWDFKPHQWRIWKHSXPSWXEH ,QVWDOOWKHWXEHVLQDUHYHUVHPDQQHUWRUHPRYDO F F Make sure that the pump tube doesn't get twisted. $WWDFKWKHWXEHWRWKHILWWLQJV 6HWWKHWXEHWRWKHVWHHULQJUROOHUDQGURWDWHWKHSXPSFORFNZLVH/HWWKH URWDWLRQRIWKHSXPSIHHGWKHWXEH'RQRWVWUHWFKLW F F F /LIWWKHFROODULQWRWKHQRWFKHV &KHFNWKDWWKHWXEHLVRQHYHU\VWHHULQJUROOHU 5RWDWHWKHSXPSWRFKHFNWKHZDWHUIHHG Konelab Service Manual 48953054-4081 November 2, 2003 Version I Maintenance 'LOXHQWDQGZDVKWXEHV DUHGHOLYHUHGIRU.RQHODE ZLWKWKHFRGHQXPEHU 5-21 5(3/$&,1*',/8(17$1':$6+78%(6 5HIHUWR)LJXUHVDQGWRVHHWKHSODFHVRIWXEHVDQGWR)LJXUHV DQGWRVHHWKHFRQILJXUDWLRQRIWXEHV )0,SXPSIRUGLOXHQW 6DPSOH PL[HU :DVKLQJ VWDWLRQ 5HDJHQW PL[HU :DVKLQJ VWDWLRQ 6DPSOH ZDVKLQJ VWDWLRQ 5HDJHQW ZDVKLQJ VWDWLRQ )0, SXPS IRUGLO 5HDJ ZDVK SXPS 6DPSOHZDVKLQJSXPS 6DPSOHGLVN 5HDJHQWGLVN 'LOXHQWWXEHVDUH WKUHDGHGWKURXJK SURWHFWLRQVRFN 'LOXHQW FRQWDLQHU 7XEH FRQQHFWRU 'LOXHQW FRQWDLQHU :DVWHFRQWDLQHU )LJXUH7KHSODFHVRIGLOXHQWDQGZDVKWXEHVLQ.RQHODE )0,SXPS 6DPSOH V\ULQJH 6DPSOH PL[HU :DVKLQJ VWDWLRQ 5HDJHQW V\ULQJH 5HDJHQW PL[HU :DVKLQJ VWDWLRQ 3XPSWXEHOLODF )0,SXPS 3XPSWXEHOLODF 'LOXHQW FRQWDLQHU 'LOXHQW FRQWDLQHU 'LOXHQW FRQWDLQHU 'LOXHQW FRQWDLQHU )LJXUH'LOXHQWDQGZDVKWXEHVLQ.RQHODE November 2, 2003 48953054-4081 Konelab Service Manual 5-22 Maintenance Version I :DVKLQJSXPS )0,SXPSIRUGLOXHQW 0L[HU ZDVKLQJ VWDWLRQ 6DPSOH ZDVKLQJ VWDWLRQ 5HDJHQW ZDVKLQJ VWDWLRQ 6DPSOHGLVN 'LOXHQWWXEHVDUH WKUHDGHGWKURXJK SURWHFWLRQVRFN 'LOXHQWDQGZDVKWXEHV DUHGHOLYHUHGIRU.RQHODE ZLWKWKHFRGHQXPEHU 7XEH FRQQHFWRU 'LOXHQW FRQWDLQHU 'LOXHQW FRQWDLQHU :DVWHFRQWDLQHU )LJXUH7KHSODFHVRIGLOXHQWDQGZDVKWXEHVLQ.RQHODE )0,SXPS 6DPSOH V\ULQJH 0L[HU ZDVKLQJ VWDWLRQ 5HDJHQWGLVN 3XPSWXEHOLODF 'LOXHQW FRQWDLQHU 'LOXHQW FRQWDLQHU )LJXUH'LOXHQWDQGZDVKWXEHVLQ.RQHODE Konelab Service Manual 48953054-4081 November 2, 2003 Version I Maintenance 5-23 )0,SXPSIRUGLOXHQW 'LOXHQWDQGZDVKWXEHV DUHGHOLYHUHGIRU.RQHODE ZLWKWKHFRGHQXPEHU 6DPSOH ZDVKLQJVWDWLRQ 6DPSOHUHDJHQWGLVN 'LOXHQWWXEHVDUH WKUHDGHGWKURXJK SURWHFWLRQVRFN 'LOXHQWFRQWDLQHU :DVWHFRQWDLQHU )LJXUH7KHSODFHVRIGLOXHQWDQGZDVKWXEHVLQ.RQHODE )0,SXPS 6DPSOH V\ULQJH 7KRVHWXEHVZKLFKRWKHU HQGLVLQWKHGLOXHQW ZDWHUFRQWDLQHUFDQEH SXWLQWKHLUSODFHVXVLQJ WKHKHOSRIWKHROGRQHV &RQQHFWWKHQHZWXEHWR WKHROGRQHXVLQJDILWWLQJ DQGGUDZWKHROGWXEHVR WKDWWKHQHZWXEHIROORZV 'HWDFKWKHROGWXEHIURP WKHQHZRQHDQGGLVFDUG WKHROGWXEH November 2, 2003 'LOXHQW FRQWDLQHU )LJXUH'LOXHQWDQGZDVKWXEHVLQ.RQHODE F 'HWDFKWKHROGWXEHVIURPWKHFRQQHFWRUV7ZHH]HUVPD\KHOSGHWDFKLQJ,Q .RQHODELVQHHGHGWRRSHQWKHPLGGOHSDUWRIWKHEDFNSDQHO,WLVIDVWHQHGZLWK VFUHZV F ,QVWDOOQHZWXEHVWRWKHFRQQHFWRUV 48953054-4081 Konelab Service Manual 5-24 Maintenance Version I 5(3/$&,1*'5$,1$1':$67(78%(6 'UDLQDQGZDVWHWXEHV IRU.DQG.DUH GHOLYHUHGZLWKWKHFRGH QXPEHU 5HIHUWR)LJXUHVDQGWRVHHWKHSODFHVRIWXEHVDQGWR)LJXUHV DQGWRVHHWKHFRQILJXUDWLRQRIWXEHV,Q.RQHODEDQGRQHWXEHLV FRPLQJIURPWKHVDPSOHGLVNDQGDQRWKHUWXEHLVFRPLQJIURPWKHUHDJHQWGLVNWRWKH ZDVWHZDWHUFRQWDLQHU7KH\DUHIRUFRQGHQVLQJZDWHUDQGWKH\DUHQRWQHFHVVDU\WR FKDQJH,Q.RQHODEWKHUHDUHWZRVLPLODUWXEHVFRPLQJIURPWKHFRPELQHG VDPSOHUHDJHQWGLVN ,6(GLVSHQVLQJDQG ZDVKLQJSXPSV )0,SXPSIRUVDPSOHGLOXHQW DQGVDPSOHZDVKLQJSXPS )0,SXPSIRUUHDJHQWGLOXHQW DQGUHDJHQWZDVKLQJSXPS 6DPSOH PL[HU :DVKLQJ VWDWLRQ 5HDJHQW PL[HU :DVKLQJ VWDWLRQ 6DPSOH ZDVKLQJ VWDWLRQ %O RFN ,6( ZDVKLQJ VWDWLRQ 6DPSOHGLVN 5HDJHQW ZDVKLQJ VWDWLRQ 5HDJHQWGLVN 7XEH FRQQHFWRU :DVWHFRQWDLQHU )LJXUH7KHSODFHVRIGUDLQDQGZDVWHWXEHVLQ.RQHODEL 7XEHFRQQHFWRU 6DPSOHGLVN 5HDJHQWGLVN ,6(:DVKLQJVWDWLRQ 6DPSOHZDVKLQJVWDWLRQ 6DPSOHPL[HU :DVKLQJVWDWLRQ 5HDJHQWPL[HU :DVKLQJVWDWLRQ :DVWH FRQWDLQHU 5HDJHQWZDVKLQJVWDWLRQ )LJXUH'UDLQDQGZDVWHWXEHVLQ.RQHODEL Konelab Service Manual 48953054-4081 November 2, 2003 Version I Maintenance ,6(GLVSHQVLQJDQG ZDVKLQJSXPSV 5-25 6DPSOH5HDJHQW ZDVKLQJSXPS 6DPSOH ZDVKLQJ VWDWLRQ 0L[HU ZDVKLQJ VWDWLRQ 5HDJHQW ZDVKLQJ VWDWLRQ ,6( ZDVKLQJ VWDWLRQ 6DPSOHGLVN 5HDJHQWGLVN :DVWHFRQWDLQHU 7XEH FRQQHFWRU )LJXUH7KHSODFHVRIGUDLQDQGZDVWHWXEHVLQ.RQHODEL 7XEHFRQQHFWRU 6DPSOHGLVN 5HDJHQWGLVN ,6(:DVKLQJVWDWLRQ 6DPSOHZDVKLQJVWDWLRQ 0L[HUZDVKLQJVWDWLRQ 5HDJHQWZDVKLQJVWDWLRQ :DVWH FRQWDLQHU )LJXUH'UDLQDQGZDVWHWXEHVLQ.RQHODEL 7KHULJKWVLGHSDQHOXQGHUWKHUHDJHQWGLVNLVQHHGHGWRRSHQLQ.RQHODEDQG ,WLVIDVWHQHGZLWKVFUHZV,Q.RQHODEDOVRWKHEDFNSDQHOLVQHHGHGWRRSHQWRSXW WKHPL[HUZDVWHWXEHLQLWVSODFH November 2, 2003 48953054-4081 Konelab Service Manual 5-26 Maintenance Version I 'UDLQDQGZDVWH WXEHVIRU.DUH GHOLYHUHGZLWKWKH FRGHQXPEHU ,6( ZDVKLQJ VWDWLRQ 6DPSOH ZDVKLQJVWDWLRQ 7XEHFRQQHFWRU 6DPSOH UHDJHQWGLVN :DVWHFRQWDLQHU )LJXUH7KHSODFHVRIGUDLQDQGZDVWHWXEHVLQ.RQHODE, 7XEHFRQQHFWRU 6DPSOH UHDJHQWGLVN :DVWH FRQWDLQHU ,6(:DVKLQJVWDWLRQ 6DPSOHZDVKLQJVWDWLRQ )LJXUH'UDLQDQGZDVWHWXEHVLQ.RQHODEL F ,QVWDOOQHZWXEHVXVLQJWKHKHOSRIWKHROGRQHV&RQQHFWWKHQHZWXEHWRWKH ROGRQHXVLQJDILWWLQJWKHHQGLQWKHZDVWHZDWHUFRQWDLQHUDQGGUDZWKHROGWXEH VRWKDWWKHQHZWXEHIROORZV'HWDFKWKHROGWXEHIURPWKHQHZRQHDQGGLVFDUGWKH ROGWXEH F Konelab Service Manual 6HWWKHQHZWXEHLQWRWKHILWWLQJDQGSXWWKHWXEHFRQQHFWRULQLWVSODFH 48953054-4081 November 2, 2003 Version I Maintenance 5-27 5(3/$&,1*,6(78%(6 ,6(GLVSHQVLQJDQG ZDVKLQJSXPSV ,6(WXEHVIRU.DQG DUHGHOLYHUHGZLWKWKH FRGHQXPEHU ,6(&DOLEUDWRU6RO 3XPSWXEHVIRU.DQG DUHGHOLYHUHG VHSDUDWHO\ZLWKWKHFRGH QXPEHUV WUDQVSDUHQW39&WXEH ZLWKJUH\EULGJHVIRU GLOXHQWSXPSDQG \HOORZLVPDSUHQH WXEHZLWKOLODFEULGJHVIRU ZDVKLQJSXPS PP ' ,6( EORFN : ,6( :DVKLQJ VWDWLRQ )LJXUH7KHSODFHVRI,6(&RPSOHWHWXELQJLQ.RQHODELDQGL &XWWRPP ,6( &DOLEUDWRU 6RO ,6(DUP EORFN ,6( ZDVKLQJ VWDWLRQ ,6( 6\ULQJH 3XPSWXEHJUH\EULGJHV 3XPSWXEHOLODF ,6( 6\ULQJH 'LOXHQW FRQWDLQHU )LJXUH,6(&RPSOHWHWXELQJLQ.RQHODELDQGL F 'HWDFKWKHROGWXEHVIURPWKHFRQQHFWRUV7ZHH]HUVPD\KHOSGHWDFKLQJ 7KHWXEHEHWZHHQWKHZDVKSXPSDQGWKHGLOXHQWZDWHUFRQWDLQHUFDQEHSXWLQLWV SODFHXVLQJWKHKHOSRIWKHROGRQH&RQQHFWWKHQHZWXEHWRWKHROGRQHXVLQJD ILWWLQJDQGGUDZWKHROGWXEHVRWKDWWKHQHZWXEHIROORZV'HWDFKWKHROGWXEHIURP WKHQHZRQHDQGGLVFDUGWKHROGWXEH,Q.RQHODELVQHHGHGWRRSHQWKHPLGGOH SDUWRIWKHEDFNSDQHO,WLVIDVWHQHGZLWKVFUHZV,QVWDOOQHZWXEHVWRWKHFRQQHFWRUV November 2, 2003 48953054-4081 Konelab Service Manual 5-28 Maintenance Version I )0,SXPSIRU ,6( ,6(WXEHVIRU. DUHGHOLYHUHGZLWK WKHFRGHQXPEHU ,6(&DOLEUDWRU 6RO ,6( EORFN ,6( :DVKLQJ SXPS ,6( ZDVKLQJ VWDWLRQ 'LOXHQWWXEHVDUHWKUHDGHG WKURXJKSURWHFWLRQVRFN 'LOXHQWFRQWDLQHU )LJXUH7KHSODFHVRI,6(FRPSOHWHWXELQJLQ.RQHODEL ,6( &DOLEUDWRU 6RO )0,SXPS ,6(DUP EORFN ,6( ZDVKLQJ VWDWLRQ 3XPSWXEH )0,SXPS 'LOXHQW FRQWDLQHU )LJXUH,6(&RPSOHWHWXELQJLQ.RQHODEL F 'HWDFKWKHROGWXEHVIURPWKHFRQQHFWRUV7ZHH]HUVPD\KHOSGHWDFKLQJ 7KHWXEHEHWZHHQWKHZDVKSXPSDQGWKHGLOXHQWZDWHUFRQWDLQHUFDQEHSXWLQLWV SODFHXVLQJWKHKHOSRIWKHROGRQH&RQQHFWWKHQHZWXEHWRWKHROGRQHXVLQJD ILWWLQJDQGGUDZWKHROGWXEHVRWKDWWKHQHZWXEHIROORZV'HWDFKWKHROGWXEHIURP WKHQHZRQHDQGGLVFDUGWKHROGWXEH,QVWDOOQHZWXEHVWRWKHFRQQHFWRUV Konelab Service Manual 48953054-4081 November 2, 2003 Version I Maintenance 5-29 7RUHSODFHWKH,6(ZDVKLQJSXPSWXEH F ,QVLGH,6(ZDVKLQJSXPSFRYHULVDVKRUW\HOORZWXEH7RUHSODFHLW )LUVWSUHVVWKHFRYHUIURPERWKVLGHVDQGOLIWLWXS 7KHQGUDZWKHJUD\SODVWLFKROGHURXWZDUGV 3XVKWKHJUD\SODVWLFKROGHUXSVRWKDW\RXFDQVHHWKHHQGRIWKHWXEH 5HSODFHWKHWXEHDQGFRQQHFWWKHKROGHUDQGFRYHULQWKHLUSODFHV November 2, 2003 48953054-4081 Konelab Service Manual 5-30 Maintenance Version I 5(3/$&,1*.867,78%(6 .867,WXEHVDUH GHOLYHUHGZLWKWKHFRGH QXPEHU ,6(&DOLEUDWRU6RO .867, GLVSHQVLQJ DUP )0,SXPS IRU.867, .867, ZDVKLQJ VWDWLRQ :DVWHFRQWDLQHU 'LOXHQWFRQWDLQHU )LJXUH7KHSODFHVRI.867,WXEHV )0, SXPS ,6(&DOLEUDWRU 6ROEDJ 'LOXHQW FRQWDLQHU ,6(WXEHH[WHQVLRQ ,6(SXPSWXEH :DVWH FRQWDLQHU .867, ZDVKLQJ VWDWLRQ )LJXUH.867,&RPSOHWHWXELQJ F 'HWDFKWKHROGWXEHVIURPWKHFRQQHFWRUV7ZHH]HUVPD\KHOSGHWDFKLQJ 7KHZDVKWXEHEHWZHHQWKH)0,SXPSDQGWKHGLOXHQWZDWHUFRQWDLQHUDQGWKHZDVWH WXEHEHWZHHQ.867,ZDVKLQJVWDWLRQDQGZDVWHFRQWDLQHUFDQEHSXWLQLWVSODFH XVLQJWKHKHOSRIWKHROGRQH&RQQHFWWKHQHZWXEHWRWKHROGRQHXVLQJDILWWLQJDQG GUDZWKHROGWXEHVRWKDWWKHQHZWXEHIROORZV'HWDFKWKHROGWXEHIURPWKHQHZRQH DQGGLVFDUGWKHROGWXEH F Konelab Service Manual ,QVWDOOQHZWXEHVWRWKHFRQQHFWRUV 48953054-4081 November 2, 2003 Version I Maintenance 5-31 5(3/$&,1*(/(&752'(6 Deionized water or other solvents must never be in contact with the membranes. Store the electrode block so that the measurement channel is empty. 7KHH[SHFWHGOLIHWLPHRIHOHFWURGHVLVVKRZQLQWKHIROORZLQJWDEOH7KHPDLQ FULWHULRQIRUUHSODFLQJLVXQVDWLVILHGTXDOLW\FRQWUROYDOXHV7KHDOORZHGYDOXHVIRU WKH,6(WHVWV¶FDOLEUDWLRQVDUHVHHQLQVHFWLRQ (OHFWURGH &O &D /L . 1D 3+ 5HI 0RQWKVRU RU RU RU RU RU RU RU 6DPSOHV 5HSODFLQJDQHOHFWURGH $QHOHFWURGHVKRXOGEHUHPRYHGDQGUHSODFHGE\DQHZHOHFWURGHZKHQSHUIRUPDQFH EHFRPHVXQVDWLVIDFWRU\ When assembling electrodes or replacing an electrode, either use new o-rings or place the old rings in the same positions they were earlier. There must always be an o-ring between two electrodes. )LJXUH7KH,6(GLVSHQVLQJDUP F 7XUQWKHFRYHURIWKH,6(GLVSHQVLQJDUPVRWKDW\RXFDQVHHWKHSRVLWLRQRI WKHEORFN7KHFRYHULVKLQJHGVRLWLVHDV\WRRSHQ F 'LVFRQQHFWWKHVLJQDOZLUHVDQGFDSVIURPWKHFRQQHFWLQJSLQVRIWKH PHDVXULQJHOHFWURGHVFRORXUFRGHG,WLVQRWQHFHVVDU\WRGLVFRQQHFWWKHVDPSOH GHWHFWLRQDQGJURXQGLQJZLUHVIURPWKHFRQQHFWRUVLQWKHHQGVOLFHV F 5HOHDVHWKHHOHFWURGHEORFNWXUQLQJWKHOHYHUDQGGHWDFKWKHEORFNIURPWKH HQGVOLFHV F F 3UHVVWKHHQGVOLFHVWRJHWKHUWRNHHSWKHOLTXLGOLQHFORVHG 'HWDFKRQO\WKHHOHFWURGHWKDWQHHGVUHSODFHPHQW)ROORZWKHLQVWUXFWLRQVLQ VHFWLRQVIRUWKHPDWHULDOLQVWDOODWLRQDQGDVVHPEOLQJ F )LOOWKH,QVWDOODWLRQDQG:DUUDQW\6KHHWVRIWKHHOHFWURGH7KHVHVKHHWVDUH HQFORVHGWRHDFK(OHFWURGH.LW November 2, 2003 48953054-4081 Konelab Service Manual 5-32 Maintenance Version I $IWHUSRVLWLRQLQJWKHHOHFWURGHEORFNGRWKHIROORZLQJ F F &DUU\RXW67$5783*LYHVRPH,6(UHTXHVWVDQGHQWHUVHUDDVVDPSOH &KHFNWKHGHWDLOHGFDOLEUDWLRQGDWDLQWKH&DOLEUDWLRQUHVXOWVZLQGRZIRUDOO WKRVHHOHFWURGHVWKDWKDVEHHQFKDQJHG After replacing an electrode a pre run of sera must be analysed with subsequent new calibration. F ,ISUREOHPVRFFXUFKHFNWKHFRQQHFWLRQVRIWKHHOHFWURGHVDQG,6( FDOLEUDWRU5HFDOLEUDWHLQWKH&DOLEUDWLRQ4&VHOHFWLRQZLQGRZ :KHQFDOLEUDWLRQLVVXFFHVVIXODSUHUXQRIVHUDVKRXOGEHDQDO\VHGZLWK VXEVHTXHQWQHZFDOLEUDWLRQEHIRUHDQDO\VLQJSDWLHQWVDPSOHV Konelab Service Manual 48953054-4081 November 2, 2003 Version I Maintenance 5-33 $&&85$&<5(68/76 ,QVWUDFWLRQV )) $FFXUDF\ UHVXOWV $FFXUDF\ IDFWRUV ) $FFXUDF\ UHVXOWV $FFXUDF\UHVXOWV $IWHUWKHSUHYHQWLYHPDLQWHQDQFHGRQHRQFHSHU\HDULWLVUHFRPPHQGHGWRSHUIRUP DFFXUDF\PHDVXUHPHQWVWRFKHFNWKHFRQGLWLRQRILQVWUXPHQW5HVXOWVRIWKHVH PHDVXUHPHQWVDUHVHHQLQWKLVZLQGRZ5HVXOWVDUHFRPLQJDXWRPDWLFDOO\IURPWKH GDWDEDVHRIWKHPHDVXUHPHQW November 2, 2003 48953054-4081 Konelab Service Manual 5-34 Maintenance Version I $&&85$&<)$&7256 $FFXUDF\ UHVXOWV ) $FFXUDF\ IDFWRUV $FFXUDF\IDFWRUV $FFXUDF\PHDVXUHPHQWVDUHGRQHZLWKWKHDFFXUDF\VROXWLRQNLW$XWKRULW\PHDVXUHV YDOXHVRIWKHVHVROXWLRQV/RWGHSHQGDQWIDFWRUVDIIHFWLQJDFFXUDF\UHVXOW FDOFXODWLRQVDUHJLYHQLQWKLVZLQGRZ Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting 6-1 Section 6 Error Messages & Troubleshooting 6.1 General................................................................................................................. page 6-3 6.2 Checking Messages ............................................................................................. page 6-4 6.3 Error Messages .................................................................................................... page 6-6 6.3.1 Error Messages coming from the Workstation ........................................ page 6-6 6.3.1.1 Messages from the analyser, messages to the analyser . page 6-6 6.3.1.2 Time Table ....................................................................... page 6-7 6.3.1.3 Response Handler ........................................................... page 6-9 6.3.1.4 User Interface................................................................... page 6-13 6.3.1.5 Laboratory Information Management System .................. page 6-15 6.3.2 Error Messages Coming from the Instrument’s PC ................................. page 6-17 6.3.3 Error Messages Coming from the Instrument’s nodes ............................ page 6-26 6.3.3.1 Boot -6.............................................................................. page 6-26 6.3.3.2 Motor -7 ............................................................................ page 6-27 6.3.3.3 Photo -8............................................................................ page 6-28 6.3.3.4 ISE -9 ............................................................................... page 6-31 6.3.3.5 INOUT -10 ........................................................................ page 6-33 6.3.3.6 TEMP -11 ......................................................................... page 6-34 6.3.3.7 POWCAN -12................................................................... page 6-36 6.3.4 Error Messages coming from Reports..................................................... page 6-39 6.4 Remedy Procedures ............................................................................................. page 6-40 6.4.1 Restarting the Workstation and booting the instrument........................... page 6-40 6.4.1.1 To restart the workstation................................................. page 6-40 6.4.1.2 To reboot the instrument .................................................. page 6-40 6.4.2 Removing a Cuvette from the Incubator.................................................. page 6-42 6.4.3 Attaching the Sample / Reagent Disk...................................................... page 6-43 6.4.3.1 Konelab 60 and 30 ........................................................... page 6-43 6.4.3.2 Konelab 20 ....................................................................... page 6-44 6.4.4 ISE Leakage or Clotting .......................................................................... page 6-45 6.4.5 Recovering from Konelab Database Failure............................................ page 6-46 6.4.6 Dispenser / Mixer Positions of Konelab 20, 30 and 60............................ page 6-47 November 2, 2003 48953054-4081 Konelab Service Manual 6-2 Konelab Service Manual Error Messages & Troubleshooting 48953054-4081 Version I November 2, 2003 Version I Error Messages & Troubleshooting 6-3 *(1(5$/ 7KHDQDO\VHU VLQWHUQDO3&DQGZRUNVWDWLRQ V3&FRPPXQLFDWHZLWKHDFKRWKHU WKURXJKWKH(WKHUQHWFDEOHXVLQJWKHSURWRFRO7&3,37KHILUVWRQHUHFHLYLQJD PHVVDJHDWWKHZRUNVWDWLRQLV75$5(&WUDQVPLWUHFHLYH75$5(&VHQGV PHVVDJHVWRWKHLQWHUQDO3& :25.67$7,213& 8, /,06 5(32576 0HVVDJHTXHXH 0HVVDJHTXHXH 7,0(7 '$7$%$6( 5+ 0HVVDJHTXHXH 0HVVDJHTXHXH 0HVVDJHTXHXH 75$5(& 7&3,3SURWRFRO (WKHUQHWFDEOH ,17(51$/3& 32:&$1 02725[Q &$1%86 7(03[Q ,1287[ 12'(6 3+272 ,6( )LJXUH7KHSDWWHUQRIFRPPXQLFDWLRQLQVLGHWKHZRUNVWDWLRQ3&DQG EHWZHHQWKHDQDO\VHU VLQWHUQDO3&DQGZRUNVWDWLRQ3& 75$5(&UHVHQGVPHVVDJHVLQDTXHXHWRWKHUHVSRQVHKDQGOHU5+,QDGGLWLRQRI UHVSRQVHKDQGOHURWKHUSDUWVZKLFKKDQGOHPHVVDJHVDWWKHZRUNVWDWLRQVLGHDUH November 2, 2003 48953054-4081 Konelab Service Manual 6-4 Error Messages & Troubleshooting Version I XVHULQWHUIDFH8,WLPHWDEOH7,0(7ODERUDWRU\LQIRUPDWLRQPDQDJHPHQWV\VWHP /,06DQGUHSRUWV$OOWKHVHSDUWVDUHRSHUDWLQJZLWKWKHZRUNVWDWLRQGDWDEDVHDQG WRKDQGOHPHVVDJHVLQDFRUUHFWRUGHUWKHGDWDEDVHPXVWEHORFNHGDIWHUHDFK PHVVDJH5HIHUWR)LJXUHRQWKHSUHYLRXVSDJH 7KHWUDQVPLWWHGPHVVDJHLVIUDPHGZLWKWKHVRIWZDUHFRGHVDQGWKLVIUDPHGPHVVDJH LVFDOOHGDSDFNHW6HHHJWKHPHVVDJH &+(&.,1*0(66$*(6 0DLQZLQGRZ ) 0HVVDJHV 0HVVDJHV :KHQ\RXFRQWDFWD 6HUYLFHHQJLQHHUSOHDVH WDNHWKHGHWDLOVRIHUURU PHVVDJHV 0HVVDJHVLQIRUPHGLQWKH0DLQZLQGRZDQGDOOPHVVDJHVLQWKHGDWDEDVHDUHVHHQLQ WKH0HVVDJHVZLQGRZ ,QIRUPDWLRQVHHQLQWKH0(66$*(6ZLQGRZ 7KHILUVWLVWKHPHVVDJHOLVWQXPEHU Konelab Service Manual 0HVVDJH 7KHH[SODQDWLRQRIWKHPHVVDJH 'DWHDQGWLPH 7KHGDWHDQGWLPHZKHQWKHPHVVDJHZDVVHQW (UURUQEU )LUVWLVWKHSURFHVVQXPEHUHJZKLFKVHQWWKHPHVVDJH LPPHGLDWHO\IROORZHGE\WKHQXPEHUVZKLFKLGHQWLILHVWKHHUURUHJ 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting 6-5 <RXFDQVHOHFWZLWK))ZKHWKHUDOOPHVVDJHVRUWKRVHPHVVDJHVZKLFKDUHQRW\HW DFFHSWHGDUHVHHQ F $FWLYDWH)WRVHHWKHGHWDLOVRIWKHPHVVDJH3UHVVLQJWKHEXWWRQDJDLQ UHPRYHVWKHGHWDLOVIURPWKHZLQGRZ 'HWDLOHGLQIRUPDWLRQIURPWKHPHVVDJH 0HVVDJH 7KHQXPEHULQWKHPHVVDJHOLVW 3URFHVV 7KHSURFHVVLGHQWLILFDWLRQZKLFKVHQWWKHPHVVDJH (UURUQEU 7KHQXPEHUZKLFKLGHQWLILHVWKHHUURU (UURULG 7KHGDWDRIWKHHYHQWSODFHWKHLGHQWLILFDWLRQRIWKHXQLWWKH SRVLWLRQDQGVHULDOQXPEHURIWKHERDUGWKHQXPEHURIWKHILOH DQGWKHOLQHLQWKHILOH 3DUDPHWHUV 3DUDPHWHUQXPEHU 6WDWXV 6WDWXVQXPEHU 7RSULQWPHVVDJHV F $FWLYDWH)WRSULQWPHVVDJHV:LWK))\RXFDQSULQWWKHODVWSDJHRI PHVVDJHV 7RUHPRYHWKHPHVVDJH F $FWLYDWH)WRDFFHSWDQGUHPRYHWKHVHOHFWHGPHVVDJHIURPWKLVZLQGRZ DQGIURPWKH0DLQZLQGRZ F $FWLYDWH)WRDFFHSWDQGUHPRYHDOOPHVVDJHVVHHQLQWKHZLQGRZ $FWLYDWH))WRGHOHWHDOOPHVVDJHVIURPWKHGDWDEDVH November 2, 2003 48953054-4081 Konelab Service Manual 6-6 Error Messages & Troubleshooting Version I (55250(66$*(6 (55250(66$*(6&20,1*)520 7+(:25.67$7,21 0(66$*(6)5207+($1$/<6(5 0(66$*(6727+($1$/<6(5 75$5(& )8//0(66$*(48(8('(7(&7('75$5(& 0(66$*(48(8(67$<6)8//75$5(& &$112723(10(66$*(48(8(75$5(& 12)5((0(66$*(%8))(5$9$,/$%/(75$5(& ,17(51$/0(66$*(%8))(5(552575$5(& F 6RIWZDUH VLQWHUQDOFRPPXQLFDWLRQHUURU5HVWDUWWKHZRUNVWDWLRQ5HIHUWR VHFWLRQ ,QFDVHWKHLQVWUXPHQW LVVZLWFKHGRIIDQGWKH PHVVDJHDSSHDUV QRDFWLRQLVQHFHVVDU\ ,167580(17+$6%((1&/26(' &$11276(1'3$&.(772,167580(17 :521*3$&.(76,=()520,167580(17 ,167580(17&20081,&$7,21(5525:521*(1' &$11275(&(,9(3$&.(7)520,167580(17 F 3RVVLEOHFDXVHV &RPPXQLFDWLRQIDXOWEHWZHHQWKHZRUNVWDWLRQDQGWKHDQDO\VHU (JVZLWFKLQJRIIWKHLQVWUXPHQWQRUPDOFDVH VRIWZDUHSUREOHPHUURULQXSGDWLQJIDXOW\ FDEOHRUEURNHQERDUG 5HERRWWKHLQVWUXPHQW,IWKHSUREOHPSHUVLVW FKHFNWKH(WKHUQHWFDEOHFRQQHFWLRQ,ILWLV2. FDOOVHUYLFH (5525,15($',1*)5200(66$*(48(8( 75$5(& (5525,1,17(51$/&20081,&$7,21%8))(5 75$5(& F 6RIWZDUH VLQWHUQDOFRPPXQLFDWLRQHUURU5HVWDUWWKHZRUNVWDWLRQ5HIHUWR VHFWLRQ 75$5(&(55250(66$*(X X0($167+((5525180%(5 6RIWZDUHSUREOHP$QDO\VLVFRQWLQXHV Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting F 6-7 7,0(7$%/(7,0(7 )8//0(66$*(48(8('(7(&7('7,0(7 0(66$*(48(8(67$<6)8//7,0(7 &$112723(10(66$*(48(8(7,0(7 6RIWZDUH VLQWHUQDOFRPPXQLFDWLRQHUURU5HVWDUWWKHZRUNVWDWLRQ5HIHUWR VHFWLRQ F '$7$%$6(/2&.(55257,0(7 ,QWHUQDOVRIWZDUHSUREOHPZLWKWKHGDWDEDVH$QDO\VLVZLOOVWRSDIWHU UHTXHVWVXQGHUDQDO\VLVDUHFRPSOHWHG3UHVV67$57WRFRQWLQXHDQDO\VLV,IWKH SUREOHPSHUVLVWVUHVWDUWWKHZRUNVWDWLRQ5HIHUWRVHFWLRQ F (5525:+(1'2,1*'$7$%$6(23(5$7,217,0(7 :521*'$7$)520'$7$%$6(7,0(7 :521*'$7$)520$127+(5352&(667,0(7 ,17(51$/'$7$(55257,0(7 :DUQLQJDERXWLQWHUQDOVRIWZDUHSUREOHPLQWKHGDWDEDVH$QDO\VLVZLOOVWRS DIWHUUHTXHVWVXQGHUDQDO\VLVDUHFRPSOHWHG3UHVV67$57WRFRQWLQXHDQDO\VLV,I WKHSUREOHPSHUVLVWVUHVWDUWWKHZRUNVWDWLRQ5HIHUWRVHFWLRQ *) F &$112723(1255($'6,1,7,0(7 &255837('.21(/$%,1,7,0(7 :DUQLQJDERXWSUREOHPLQWKHFRQILJXUDWLRQILOWHURUWHPSHUDWXUHGDWD &KHFNWKHGDWDLQWKH&RQILJXUDWLRQZLQGRZ5HIHUWRVHFWLRQ5HIPDQXDO,I WKHSUREOHPSHUVLVWVFRQWDFWVHUYLFH F $1$/<6,1*127$//2:('&+(&.0(66$*(6 7RVWDUWDQDO\VLVFKHFNWKDWWKHGLVWLOOHGZDWHUFRQWDLQHULVIXOODQGWKH ZDVWHZDWHUFRQWDLQHULVHPSW\&KHFNWKDWFRYHUVDUHFORVHGDQGFKHFNWKDWWKHUH DUHFXYHWWHV3UHVV67$57 F F $1$/<6,1*127$//2:('67$5783127'21( 7RVWDUWDQDO\VLVSHUIRUP6WDUWXS3UHVV67$57 $1$/<6,1*67233('&+(&.0(66$*(6 7KHDFWXDOHUURUPHVVDJHVDUHVHHQRQWKH0(66$*(6ZLQGRZ3HUIRUP UHPHG\SURFHGXUHVDQGFRQWLQXHDQDO\VLV F $1$/<6,1*67233('6723+$6%((135(66(' 7RUHVWDUWDQDO\VLVSUHVV67$57 *) Reinstall the software November 2, 2003 48953054-4081 Konelab Service Manual 6-8 Error Messages & Troubleshooting F Version I 67$5783127$//2:('67$5783'21( 6WDUWXSLVSRVVLEOHWRSHUIRUPDIWHUVZLWFKLQJRQWKHDQDO\VHURUDIWHU6WDQG E\6WDUWXSLVUHFRPPHQGHGWREHGRQHRQFHDGD\ F 67$5783127$//2:('&+(&.:$7(5&89(77(6 $1'&29(56 7RSHUIRUP6WDUWXSFKHFNWKDWWKHGLVWLOOHGZDWHUFRQWDLQHULVIXOODQGWKH ZDVWHZDWHUFRQWDLQHULVHPSW\&KHFNWKDWFRYHUVDUHFORVHGDQGFKHFNWKDWWKHUH DUHFXYHWWHV F ,167580(177<3(0,60$7&+6(/(&7&255(&7 7<3( :DUQLQJWKDWZURQJLQIRUPDWLRQDERXWWKHLQVWUXPHQWW\SH GHWHFWHG6HOHFWWKHFRUUHFWLQVWUXPHQWW\SHIURP6WDUW3URJUDPV,QVWUXPHQW VHOHFWLRQ &RQFHUQLQJ .RQHODE DQGL (;,7)$,/('X5(029(&89(77()520 ,1&8%$725 X0($167+(,1&8%$725326,7,21180%(5 &XYHWWHVWLOOLQWKHLQFXEDWRUHJWKHKRRNKDVEURNHQDQGWKHDQDO\VHUKDVIDLOHGWR H[LWLWGXULQJ6WDQGE\RU([LWFXYHWWHVLQWKH,QVWUXPHQWDFWLRQVIXQFWLRQV F :DLWXQWLODQDO\VLVLVFRPSOHWH2SHQWKHDQDO\VHU VDQGLQFXEDWRU VFRYHUV DQGUHPRYHWKHFXYHWWHPDQXDOO\5HIHUWRVHFWLRQ &RQFHUQLQJ .RQHODE DQGL (;,7)$,/('X5(029(&89(77()520 ,1&8%$725,1675$&7,216 X0($167+(,1&8%$725326,7,21180%(5 &XYHWWHVWLOOLQWKHLQFXEDWRUHJWKHKRRNKDVEURNHQDQGWKHDQDO\VHUKDVIDLOHGWR H[LWLWGXULQJ6WDQGE\RU([LWFXYHWWHVLQWKH,QVWUXPHQWDFWLRQVIXQFWLRQV F :DLWXQWLODQDO\VLVLVFRPSOHWH$FWLYDWH)0DQXDOFXYHWWHH[LWLQWKH ,QVWUXPHQWDFWLRQVZLQGRZ2SHQWKHDQDO\VHU VFRYHUDQGUHPRYHWKHFXYHWWH PDQXDOO\5HIHUWRVHFWLRQ 7220$1<8186$%/(&89(77(326,7,216,1 ,1&8%$725 6HYHUDOFXYHWWHVKDYHUHPDLQHGLQWKHLQFXEDWRUHJWKHKRRNKDVEURNHQDQGWKH DQDO\VHUKDVIDLOHGWRH[LWWKHP$QDO\VLVZLOOVWRSDIWHUUHTXHVWVXQGHUDQDO\VLVDUH FRPSOHWHG F 5HPRYHFXYHWWHVZLWK([LWFXYHWWHVLQWKH,QVWUXPHQWDFWLRQVZLQGRZRU SHUIRUP6WDQGE\,IWKHHUURUPHVVDJHDSSHDUVUHPRYHFXYHWWHVPDQXDOO\ 5HIHUWRVHFWLRQ Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting 6-9 1286$%/(&89(77(326,7,216,1,1&8%$725 $OOFXYHWWHVLQWKHLQFXEDWRUDUHXQXVDEOHHJWKHKRRNKDVEURNHQDQGWKHDQDO\VHU KDVIDLOHGWRH[LWWKHP$QDO\VLVZLOOVWRSDIWHUUHTXHVWVXQGHUDQDO\VLVDUH FRPSOHWHG F :LWK.RQHODEUHPRYHFXYHWWHVZLWK0DQXDOFXYHWWHH[LWLQWKH ,QVWUXPHQWDFWLRQVZLQGRZUHIHUWRVHFWLRQDQGDIWHUWKDWVZLWFKWKH DQDO\]HURIIDQGRQ F :LWK.RQHODEDQGVZLWFKWKHDQDO\]HURIIDQGUHPRYHFXYHWWHV PDQXDOO\IURPWKHLQFXEDWRU5HIHUWRVHFWLRQ6ZLWFKWKHDQDO\]HURQ ,167580(177<3($1'7,&./(1*7+0,60$7&+,1 .21(/$%,1, F :DUQLQJWKDWWKHLQVWUXPHQWW\SHGRQRWPDWFKZLWKWKHWLFNOHQJWK.RQHODE DQGDUHXVLQJWKHWLFNOHQJWKRIVHFRQGVDQG.RQHODEWKHWLFNOHQJWK RIVHFRQGV7RFRQWLQXHXVLQJWKH.RQHODESURJUDPILUVWH[LWIURPLWE\VHOHFWLQJ ))LQWKH0DQDJHPHQWZLQGRZ7KHQVHOHFWWKHFRUUHFWLQVWUXPHQWW\SHIURP 6WDUW3URJUDPV,QVWUXPHQWVHOHFWLRQ)LQDOO\VWDUWWKH.RQHODESURJUDPDJDLQE\ FOLFNLQJWKHNRQHODELFRQ1RWHWKDWDOVRLQWKH&RQILJXUDWLRQZLQGRZWKH LQVWUXPHQWW\SHLVVHOHFWHG ,19$/,',17(51$/7,&.9$/8( 7,0(7(55250(66$*(X X0($167+((5525180%(5 :DUQLQJWKDWWKHLQVWUXPHQW VWLFNOHQJWKGRHVQ WPDWFKZLWKWKHRULJLQDORQH $QDO\VLQJFRQWLQXHV 6RIWZDUHSUREOHP$QDO\VLVFRQWLQXHV F 5(63216(+$1'/(55+ )8//0(66$*(48(8('(7(&7('5+ 0(66$*(48(8(67$<6)8//5+ &$112723(10(66$*(48(8(5+ 6RIWZDUH VLQWHUQDOFRPPXQLFDWLRQHUURU5HVWDUWWKHZRUNVWDWLRQ &$/&8/$7,21(5525=(52',9,'(55+ &$/&8/$7,21(5525/2*)5201(*$7,9(5+ &$/&8/$7,21(5525722+,*+(;321(175+ '$7$%$6(/2&.(55255+ :DUQLQJWKDWWKHLQFRUUHFWLQLWLDOYDOXHIRUDFDOFXODWLRQKDVEHHQGHWHFWHG7KH FDOFXODWLRQFDQQRWEHGRQH(JFDOLEUDWLRQLVQRWVXFFHVVIXODQGWHVW VDXWRPDWLF DFFHSWDQFHLVFKDQJHGWRPDQXDO F ,QWHUQDOVRIWZDUHSUREOHPWRKDQGOHWKHGDWDEDVH$QDO\VLVZLOOVWRSDIWHU UHTXHVWVXQGHUDQDO\VLVDUHFRPSOHWHG3UHVV67$57WRFRQWLQXHDQDO\VLV,IWKH SUREOHPSHUVLVWVUHVWDUWWKHZRUNVWDWLRQ5HIHUWRVHFWLRQ November 2, 2003 48953054-4081 Konelab Service Manual 6-10 Error Messages & Troubleshooting F Version I (5525:+(1'2,1*'$7$%$6(23(5$7,215+ :521*'$7$)520'$7$%$6(5+ :521*'$7$)520$127+(5352&(665+ ,17(51$/'$7$(55255+ :DUQLQJDERXWLQWHUQDOVRIWZDUHSUREOHPLQWKHGDWDEDVH$QDO\VLVZLOOVWRS DIWHUUHTXHVWVXQGHUDQDO\VLVDUHFRPSOHWHG3UHVV67$57WRFRQWLQXHDQDO\VLV,I WKHSUREOHPSHUVLVWVUHVWDUWWKHZRUNVWDWLRQ5HIHUWRVHFWLRQ *) F &$112723(1255($'6,1,5+ &255837('.21(/$%,1,5+ :DUQLQJDERXWSUREOHPLQWKHFRQILJXUDWLRQILOWHURUWHPSHUDWXUHGDWD &KHFNWKHGDWDLQWKH&RQILJXUDWLRQZLQGRZ5HIHUWRVHFWLRQ5HIPDQXDO,I WKHSUREOHPSHUVLVWVFDOOVHUYLFH F 5($*(175(*,67(5)8//2)9,$/6 7RKDYHDQHZUHDJHQWUHPRYHRQHERWWOHIURPWKHUHDJHQWGLVNLQWKH 5HDJHQWGLVNZLQGRZZKHQDQDO\VLVLVQRWLQSURJUHVV F 6$03/(5(*,67(5)8//2)6(*0(176 7RDGGDQHZVHJPHQWUHPRYHRQHVHJPHQWIURPWKHVDPSOHGLVNLQWKH 6DPSOHVHJPHQWZLQGRZZKHQDQDO\VLVLVQRWLQSURJUHVV F F 12:$7(5%/$1.'$7$5+ 3HUIRUP6WDUWXS 127(67'$7$5+ 6RIWZDUHHUURU,IWKHSUREOHPSHUVLVWVUHVWDUWWKHZRUNVWDWLRQ5HIHUWR VHFWLRQ &$112723(1255($'(5'$7$7;75+ (UGDWDW[WLQFOXGHVHUURUPHVVDJHV F 5HVWDUWWKHZRUNVWDWLRQ5HIHUWRVHFWLRQ,IWKHSUREOHPSHUVLVWV UHLQVWDOOWKHVRIWZDUHIRUWKHZRUNVWDWLRQ *) Reinstall the software Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting 6-11 3225:$7(5%/$1.0($685(0(17V6' P$ HJ3RRUZDWHUEODQNPHDVXUHPHQWQP6' P$ LHVPHDQVWKHPHDVXUHGZDYHOHQJWKDQG 6' P$PHDQVWKHPHDVXUHGVWDQGDUGGHYLDWLRQ F 5HSHDW6WDUWXS ,IWKHSUREOHPSHUVLVWVWU\WKHIROORZLQJRQHV 'HWHULRUDWHGZDWHU :DVKWKHGLVWLOOHGZDWHUFRQWDLQHUDWOHDVWRQFHD 3RVVLEOHFDXVHV ZHHNZLWKVSLULWDQGGLVWLOOHGGHLRQL]HGZDWHU &KDQJHZDWHUDQGHQVXUHWKDWLWLVSXUH5HSHDW ZDWHUEODQNLQ,QVWUXPHQWDFWLRQV F 'LUW\FXYHWWHV (PSW\WKHFXYHWWHORDGHUDQGUHORDGLW5HSHDW ZDWHUEODQNPHDVXUHPHQW 3KRWRPHWHUHUURU &KHFNWKDWWKHODPSLVQRWEURNHQDQGWKDWLWLV FRUUHFWO\LQVWDOOHG5HIHUWRVHFWLRQ 5HIPDQXDO ,IWKHSUREOHPSHUVLVWVFDOOVHUYLFH 5($*(179,$/+$'$181.12:1%$5&2'(X X0($167+(5($'%$5&2'(180%(5 7KHEDUFRGHLGIRUWKHUHDJHQWLVJLYHQLQWKH5HDJHQWGHILQLWLRQZLQGRZ7KH DQDO\VHUGLGQ WUHFRJQLVHWKHEDUFRGH F 2SHQWKHUHDJHQWLQVHUWFRYHUDQGUHPRYHWKHYLDO7\SHWKHEDUFRGHLGLQ WKH5HDJHQWGHILQLWLRQZLQGRZZKHQDQDO\VLVLVQRWLQSURJUHVV,QVHUWWKHUHDJHQW DJDLQLQWRWKHDQDO\VHU F 12)5((67$7326,7,21 7RKDYHDQHZ67$7VDPSOHUHPRYHRQH67$7VDPSOHIURPWKHVDPSOH GLVNLQWKH6DPSOHHQWU\ZLQGRZZKHQDQDO\VLVLVQRWLQSURJUHVV &255837('(5'$7$7;75+ (UGDWDW[WLQFOXGHVHUURUPHVVDJHV F 5HVWDUWWKHZRUNVWDWLRQ5HIHUWRVHFWLRQ,IWKHSUREOHPSHUVLVWV UHLQVWDOOWKHVRIWZDUHIRUWKHZRUNVWDWLRQ F 129$/,'&$/,%5$7,21 $VNFDOLEUDWLRQLQWKH&DOLEUDWLRQ4&VHOHFWLRQZLQGRZ$IWHUFDOLEUDWLRQ KDVEHHQDFFHSWHGUHTXHVWVDUHDQDO\VHGDXWRPDWLFDOO\ '83/,&$7(6(*0(17,'X X0($167+(6(*0(17 6,'180%(5 $QDO\VHULVUHPRYLQJWKHODVWLQVHUWHGVHJPHQW F November 2, 2003 ,QVHUWVDPSOHVLQWRDQHZVHJPHQW 48953054-4081 Konelab Service Manual 6-12 Error Messages & Troubleshooting Version I $1(:6(*0(17'(7(&7('%<,167580(17X X0($167+(6(*0(17 6,'180%(5 7KHXVHULVLQIRUPHGDERXWDQHZVHJPHQW$QDO\VLVFRQWLQXHV 81.12:15($*(179,$/)281',1326,7,21X X0($167+(5($*(17 6326,7,21 F 3RVVLEOHFDXVHV 5(029(6$03/(6(*0(1760$18$//< (JWKHXVHUKDVFKDQJHGDQHZUHDJHQWGLVNDQGWKH DQDO\VHUFRXOGQ WUHDGWKHEDUFRGHRUWKHUHDJHQWGDWD KDVQRWEHHQJLYHQEXWWKHDQDO\VHUGHWHFWVWKHSUHVHQFH RIDUHDJHQW 2SHQWKHUHDJHQWLQVHUWFRYHUDQGWDNHWKHYLDODZD\ &KHFNWKDWWKHUHDJHQW VGDWDLV2.LQWKH5HDJHQW GHILQLWLRQZLQGRZ&KHFNWKHEDUFRGH,QVHUWWKH UHDJHQWDJDLQLQWRWKHDQDO\VHU F 3RVVLEOHFDXVHV 1D7(670867%(,186(:+(15811,1*/L,6( F (JGXULQJWUDQVSRUWDWLRQDOOVHJPHQWSRVLWLRQVDUHIXOO DQGWKHVHJPHQWORDGHULVDWWKHKLJKHUSRVLWLRQ 7DNHWKHUHGVDPSOHFRYHUDZD\DQGUHPRYHVHJPHQWV PDQXDOO\3HUIRUPµ&KHFNVDPSOHGLVN¶LQWKH6DPSOH GLVNZLQGRZRUERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ $IWHUWKDWWKHVHJPHQWORDGHUZLOOZRUN :KHQOLWKLXPLVPHDVXUHGDOVRVRGLXPPXVWEHLQVWDOOHGEHFDXVHOLWKLXPLV PHDVXULQJQRWRQO\OLWKLXPEXWDOVRVRGLXP6RWKH1DHOHFWURGHPXVWEH PHDVXUHGWRUHGXFHWKHVRGLXPYDOXH&KHFNWKDW1DLVLQVWDOOHGLQWKHEORFNDQG WKDWLWLVPDUNHGWREHLQWKHEORFNLQWKH,6((OHFWURGHVZLQGRZ5HIHUWRVHFWLRQ 5HIPDQXDO F F /$0392/7$*($'-8670(17)$,/('6 60($167+(:$9(/(1*7+ 3HUIRUP6WDUWXS $//6(*0(176)25.867,6$03/,1*$5()8// 126(*0(17)25.867,6$03/,1*,1,167580(17 6(*0(176)25.867,6$03/,1*$5($/0267)8// ,QVHUW.867,VHJPHQWV 6$03/(,6$/5($'<,1,167580(1712 ',63(16,1*)520.867, ,QIRUPDWLRQWRWKHXVHU$QDO\VLQJFRQWLQXHV 5()/(;7(670,66,1* ,QIRUPDWLRQWRWKHXVHU$QDO\VLQJFRQWLQXHV F 7RJHWWKHUHIOH[WHVWLQXVHJRWRWKH7HVWGHILQLWLRQZLQGRZDQGVHOHFW\HV IURPWKHµ7HVWLQXVH¶PHQX Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting 6-13 0,66,1*.867,:$6+,1*62/87,21 ,17(51$/'$7$(5525 (55250(66$*()52081'(),1('352&(66 5(63216(+$1'/(5(55250(66$*(X X0($167+((5525180%(5 :DUQLQJWRWKHXVHU6WDQGE\SURFHGXUHVFRQWLQXHV1H[WWLPHEHIRUH6WDQGE\ SURFHGXUHLQVHUW:DVKLQJVROXWLRQERWWOHLQ.867,ZDVKSRVLWLRQEHVLGHWKH VDPSOHGLVN5HIHUWRVHFWLRQ5HIPDQXDO 7KLVLVRQO\IRUVHUYLFHLQIRUPDWLRQ 6RIWZDUHSUREOHP$QDO\VLVFRQWLQXHV F 86(5,17(5)$&(8, )8//0(66$*(48(8('(7(&7('8, 0(66$*(48(8(67$<6)8//8, &$112723(10(66$*(48(8(8, 6RIWZDUH VLQWHUQDOFRPPXQLFDWLRQHUURU5HVWDUWWKHZRUNVWDWLRQ5HIHUWR VHFWLRQ &$/&8/$7,21(5525=(52',9,'(58, &$/&8/$7,21(5525/2*)5201(*$7,9(8, &$/&8/$7,21(5525722+,*+(;321(178, '$7$%$6(/2&.(55258, :DUQLQJWKDWWKHLQFRUUHFWLQLWLDOYDOXHIRUDFDOFXODWLRQKDVEHHQGHWHFWHG7KH FDOFXODWLRQFDQQRWEHGRQH(JFDOLEUDWLRQLVQRWVXFFHVVIXODQGWHVW VDXWRPDWLF DFFHSWDQFHLVFKDQJHGWRPDQXDO F ,QWHUQDOVRIWZDUHSUREOHPWRKDQGOHWKHGDWDEDVH5HVWDUWWKHZRUNVWDWLRQ 5HIHUWRVHFWLRQ F (5525:+(1'2,1*'$7$%$6(23(5$7,218, :DUQLQJDERXWLQWHUQDOVRIWZDUHSUREOHPLQWKHGDWDEDVH$QDO\VLV FRQWLQXHV,IWKHSUREOHPSHUVLVWVUHVWDUWWKHZRUNVWDWLRQ5HIHUWRVHFWLRQ F &$112723(1'$7$%$6(8, ,QWHUQDOVRIWZDUHSUREOHPWRKDQGOHWKHGDWDEDVH5HVWDUWWKHZRUNVWDWLRQ 5HIHUWRVHFWLRQ F :521*'$7$)520'$7$%$6(8, :521*'$7$)520$127+(5352&(668, ,17(51$/'$7$(55258, :521*'$7$)520$127+(5:,1'2:8, ,QWHUQDOVRIWZDUHSUREOHPLQWKHGDWDEDVH,ISUREOHPSHUVLVWVUHVWDUWWKH ZRUNVWDWLRQ5HIHUWRVHFWLRQ November 2, 2003 48953054-4081 Konelab Service Manual 6-14 Error Messages & Troubleshooting F Version I &$112723(1255($',1,8, &$112723(1255($'),/(8, :DUQLQJDERXWSUREOHPLQWKHFRQILJXUDWLRQILOWHURUWHPSHUDWXUHGDWD &KHFNWKHGDWDLQWKH&RQILJXUDWLRQZLQGRZ5HIHUWRVHFWLRQ5HIPDQXDO,I WKHSUREOHPSHUVLVWVFRQWDFWVHUYLFH F F 81.12:10(66$*(67$7868, 81.12:10(66$*(8, 6RIWZDUHSUREOHP5HVWDUWWKHZRUNVWDWLRQ5HIHUWRVHFWLRQ &255837('.21(/$%,1,8, :DUQLQJDERXWSUREOHPLQWKHFRQILJXUDWLRQGDWDNRQHODELQL&KHFNWKH GDWDLQWKH&RQILJXUDWLRQZLQGRZ5HIHUWRVHFWLRQ5HIPDQXDO .21(/$%,1,),/(&5($7(' .21(/$%,1,),/(83'$7(':,7+'()$8/79$/8(6 .21(/$%,1,),/(&5($7()$,/(' .21(/$%,1,),/(83'$7()$,/(' 7KHXVHULVLQIRUPHGDERXWWKHFRQILJXUDWLRQGDWDNRQHODELQLDFWLRQV F F 3RVVLEOHFDXVHV 6RIWZDUHSUREOHPLQWKH&RQILJXUDWLRQGDWD NRQHODELQL 5HVWDUWWKHZRUNVWDWLRQ5HIHUWRVHFWLRQ ,167580(177<3(0,60$7&+%(7:((1'% $1'.21(/$%,1, 6HOHFWWKHFRUUHFWLQVWUXPHQWW\SHIURP6WDUW3URJUDPV,QVWUXPHQW VHOHFWLRQ F 127(128*+)5((63$&(21+$5'',6. 6HOHFW6WDUW3URJUDPV:LQGRZV17([SORUHUDQGGHOHWHXQQHFHVVDU\ILOHV )UHHDWOHDVW0E F /$1*8$*(0,60$7&+%(7:((18,352&(66$1' .21(/$%,1, 7RFRQWLQXHXVLQJWKH.RQHODESURJUDPILUVWH[LWIURPLWE\VHOHFWLQJ)) LQWKH0DQDJHPHQWZLQGRZ7KHQVHOHFWWKHFRUUHFWODQJXDJHIURP6WDUW 3URJUDPV/DQJXDJHVHOHFWLRQ)LQDOO\VWDUWWKH.RQHODESURJUDPDJDLQE\ FOLFNLQJWKHNRQHODE±LFRQ 86(5,17(5)$&((55250(66$*(X X0($167+((5525180%(5 6RIWZDUHSUREOHP$QDO\VLVFRQWLQXHV Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting F 6-15 /$%25$725<,1)250$7,21 0$1$*$0(176<67(0/,06 :521*'$7$)520$127+(5352&(66/,06 ,QWHUQDOVRIWZDUHSUREOHPLQWKHGDWDEDVH5HVWDUWWKHZRUNVWDWLRQ5HIHUWR VHFWLRQ F 6(5,$//,1(3$5$0(7(5(5525/,06 &KHFNWKHVHULDOLQWHUIDFHSDUDPHWHUVLQWKH&RQILJXUDWLRQZLQGRZ5HIHU WRVHFWLRQ5HIPDQXDO F :521*6(5,$/3257/,06 &KHFNWKHVHULDOLQWHUIDFHSDUDPHWHUVLQWKH&RQILJXUDWLRQZLQGRZ5HIHU WRVHFWLRQ5HIPDQXDO :5,7((5525/,06 75$160,66,21(5525/,06 0(66$*(%8))(5(5525/,06 F 3RVVLEOHFDXVHV 5($'(5525/,06 F 3RVVLEOHFDXVHV 6<1&+521,=$7,21(5525/,06 F 3RVVLEOHFDXVHV ([WHUQDOFRPSXWHUKDVUHFHLYHGWKHGDWDEXWWUDQVPLVVLRQKDVEHHQGHWHFWHGDV LQFRUUHFW (JHOHFWURQLFPDOIXQFWLRQVRIWZDUHHUURU LQLWLDOLVDWLRQHUURURUSRZHUIDLOXUH &KHFNWKHFDEOHFRQQHFWLRQ,IWKHSUREOHPSHUVLVWVFDOO VHUYLFH 7KHDQDO\VHUKDVUHFHLYHGWKHGDWDEXWWUDQVPLVVLRQKDVEHHQUHFRJQLVHGDVLQFRUUHFW (JHOHFWURQLFPDOIXQFWLRQVRIWZDUHHUURU LQLWLDOLVDWLRQHUURURUSRZHUIDLOXUH &KHFNWKHFDEOHFRQQHFWLRQ,IWKHSUREOHPSHUVLVWVFDOO VHUYLFH 7KHDQDO\VHUUHFHLYHGDGDWDUHFRUGZKLOHLWZDVH[SHFWLQJDQ$&.FKDUDFWHURULW UHFHLYHG$&.1$.ZKLOHH[SHFWLQJDGDWDUHFRUG (JIDXOW\FDEOHHOHFWURQLFPDOIXQFWLRQVRIWZDUH HUURU &KHFNWKHFDEOHFRQQHFWLRQ,IWKHSUREOHPSHUVLVWVFDOO VHUYLFH $GDWDUHFRUGLVDVWULQJRIDQ\FKDUDFWHUVEHJLQQLQJZLWK DQGHQGLQJZLWK 'KH[RUDVWULQJRIDQ\FKDUDFWHUVZKRVHOHQJWKH[FHHGVWKHVL]HRILQSXWEXIIHU FXUUHQWO\ November 2, 2003 48953054-4081 Konelab Service Manual 6-16 Error Messages & Troubleshooting Version I &20081,&$7,217,0(287/,06 F 3RVVLEOHFDXVHV (5525:+(1'2,1*'$7$%$6(23(5$7,21/,06 ([WHUQDOFRPSXWHUGLGQRWDQVZHULQWKHDOORZHGWLPH F (JIDXOW\FDEOHHOHFWURQLFPDOIXQFWLRQRUZURQJ LQLWLDOLVDWLRQGDWD &KHFNWKHFDEOHFRQQHFWLRQ,IWKHSUREOHPSHUVLVWVFDOO VHUYLFH :DUQLQJDERXWLQWHUQDOVRIWZDUHSUREOHPLQWKHGDWDEDVH$QDO\VLV FRQWLQXHV,IWKHSUREOHPSHUVLVWVUHVWDUWWKHZRUNVWDWLRQ5HIHUWRVHFWLRQ /,067<3(0,60$7&+%(7:((1/,06352&(66$1' .21(/$%,1, F 7RFRQWLQXHXVLQJWKH.RQHODESURJUDPILUVWH[LWIURPLWE\VHOHFWLQJ ))LQWKH0DQDJHPHQWZLQGRZ7KHQVHOHFWWKHFRUUHFW/,06SURFHVVIURP 6WDUW3URJUDPVOLPVVHOHFWLRQ)LQDOO\VWDUWWKH.RQHODESURJUDPDJDLQE\ FOLFNLQJWKHNRQHODE±LFRQ /,06(55250(66$*(X X0($167+((5525180%(5 6RIWZDUHSUREOHP$QDO\VLVFRQWLQXHV Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting 6-17 (55250(66$*(6&20,1*)520 7+(,167580(17 63& ,17(51$/3& ,17(51$/'$7$(5525,17(51$/3& ,17(51$/3&(552586('72208&+7,0( ,17(51$/3&(5525&$11276(1'&$10(66$*( F 3RVVLEOHFDXVHV 6RIWZDUHHUURULQWKHLQWHUQDO3&$QRWKHUHUURUPHVVDJHGHWDLOVWKHDFWXDOSUREOHP HJQHHGOHHUURU 7KHDQDO\VHUKDVIDOOHQEHKLQGWKHWLPHWDEOH,WUHFRYHUVDXWRPDWLFDOO\ 7KHLQWHUQDO3&FDQQRWJHWWKHPHVVDJHWRWKHERDUG$QDO\VLVZLOOVWRS 6RIWZDUHSUREOHP 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ %URNHQ3&&$1ERDUGRUEURNHQUHFLSLHQWERDUG &DOOVHUYLFH F ,17(51$/3&(552581(;3(&7('12'(X%227 X0($167+(%2$5'180%(5 3RVVLEOHFDXVHV 6RIWZDUHSUREOHP 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ %URNHQERDUG &DOOVHUYLFH )(('%$&.(5525:+(1,1,7,$/,=,1* F 3RVVLEOHFDXVHV 3HUIRUPZDWHUZDVK)LQWKH,QVWUXPHQWDFWLRQVZLQGRZEHIRUHFRQWLQXLQJ7KLV PXVWEHGHILQLWHO\GRQHZKHQ.RQHODELVFRQQHFWHGWRWKHDXWRPDWLRQFRQYH\RUDQG .867,LVLQµQRWLQXVH¶VWDWH 0HFKDQLFDOREVWDFOH &KHFNWKDWWKHUHDUHQRPHFKDQLFDOREVWDFOHVWR VWRSIUHHPRYHPHQW 7RRORRVHFRJJHGEHOWRUEURNHQIHHGEDFNVHQVRU RUGDPDJHGPRWRUGULYLQJERDUG ±5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 0,;(51275811,1*3523(5/< F 3RVVLEOHFDXVHV 7KLVHUURUPHVVDJHLVIRU.RQHODEDQGPHDQLQJWKDWQHHGOHLVQRWPL[LQJ SURSHUO\$QDO\VLQJLVVWRSSHG $QREVWDFOHGHWHFWHG 5HPRYHWKHREVWDFOH3UHVV67$57WRFRQWLQXH DQDO\VLV 'DPDJHGRSWRRSWRFDEOHPRWRUGULYLQJERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH November 2, 2003 48953054-4081 Konelab Service Manual 6-18 Error Messages & Troubleshooting F Version I 0$',63(16(50,;(5,1,7,$/,=$7,21)$,/(' 3RVVLEOHFDXVHV $QREVWDFOHGHWHFWHG 5HPRYHWKHREVWDFOH3HUIRUPZDWHUZDVK)LQ WKH,QVWUXPHQWDFWLRQVZLQGRZEHIRUHFRQWLQXLQJ :DWHUZDVKPXVWEHGHILQLWHO\GRQHZKHQ.RQHODE LVFRQQHFWHGWRWKHDXWRPDWLRQFRQYH\RUDQG .867,LVLQµQRWLQXVH¶VWDWH3UHVV67$57WR FRQWLQXHDQDO\VLV 'DPDJHGRSWRRSWRFDEOHPRWRUGULYLQJERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH F 5($*(176$03/(5(*,67(5,1,7,$/,=$7,21)$,/(' 3RVVLEOHFDXVHV 0HFKDQLFDOREVWDFOH 2SHQWKHFRYHUDQGFKHFNLIHJVRPHUHDJHQW YHVVHOVDPSOHFXSLVLQFRUUHFWO\DWWDFKHG3HUIRUP ZDWHUZDVK)LQWKH,QVWUXPHQWDFWLRQVZLQGRZ EHIRUHFRQWLQXLQJ:DWHUZDVKPXVWEHGHILQLWHO\ GRQHZKHQ.RQHODELVFRQQHFWHGWRWKHDXWRPDWLRQ FRQYH\RUDQG.867,LVLQµQRWLQXVH¶VWDWH 5HDJHQW6DPSOHGLVNLQFRUUHFWO\ORFDWHG &KHFNWKHORFDWLRQRIWKHUHDJHQWVDPSOH GLVNDQGUHDWWDFK5HIHUWRVHFWLRQ3HUIRUP ZDWHUZDVK)LQWKH,QVWUXPHQWDFWLRQVZLQGRZ EHIRUHFRQWLQXLQJ:DWHUPXVWEHGHILQLWHO\GRQH ZKHQ.RQHODELVFRQQHFWHGWRWKHDXWRPDWLRQ FRQYH\RUDQG.867,LVLQµQRWLQXVH¶VWDWH 'DPDJHGRSWRRSWRFDEOHPRWRUGULYLQJERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH F &89(77(386+(5,1,7,$/,=$7,21)$,/(' 3RVVLEOHFDXVHV 0HFKDQLFDOREVWDFOH &KHFNLIVRPHREVWDFOHFDQEHIRXQG5HIHUWR VHFWLRQ3HUIRUPZDWHUZDVK)LQWKH ,QVWUXPHQWDFWLRQVZLQGRZEHIRUHFRQWLQXLQJ 'DPDJHGRSWRRSWRFDEOHRUGDPDJHGIXVHLQWKH PRWRUGULYLQJERDUGRUGDPDJHGPRWRUGULYLQJ ERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ,I SUREOHPSHUVLVWVFDOOVHUYLFH F ,1&8%$725,1,7,$/,=$7,21)$,/(' 3RVVLEOHFDXVHV &XYHWWHUHPDLQHGLQWKHFXYHWWHSDWK &KHFNWKHLQFXEDWRU5HIHUWRVHFWLRQ 3HUIRUPZDWHUZDVK)LQWKH,QVWUXPHQWDFWLRQV ZLQGRZEHIRUHFRQWLQXLQJ 7KHFXYHWWHDUPFRJJHGEHOWLVEURNHQRUGDPDJHG RSWRRSWRFDEOHPRWRUGULYLQJERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting 6-19 ),/7(5',6.,1,7,$/,=$7,21)$,/(' F 3RVVLEOHFDXVHV &$1&$5'127)281' F 3RVVLEOHFDXVHV 'DPDJHGRSWRRSWRFDEOHPRWRUGULYLQJERDUGRU PHFKDQLFDOREVWDFOHVIRUWKHPRYHPHQWHJORRVHQ ILOWHU 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 7KLVHUURUPHVVDJHLVIRU.RQHODE,QVWUXPHQWVWD\Vµ1RWLQXVH¶VWDWXV F /RRVHFRQWDFWLQFDEOHEURNHQ&$1FDUGLQVLGHWKH ZRUNVWDWLRQ¶V3& &DOOVHUYLFH &89(77($50,1,7,$/,=$7,21)$,/(' 0($685(0(176$03/(5($*(17&+$11(/ 7KHFXYHWWHZDVWHFRPSDUWPHQWLVIXOO (PSW\WKHFXYHWWHZDVWHFRPSDUWPHQWDQG DOVRWKHFXYHWWHH[LWFKDQQHO 7KHFXYHWWHDUPFRJJHGEHOWLVEURNHQRU GDPDJHGRSWRRSWRFDEOHRUWKHFKRUGRIRSWR KDVEHQWGRZQRUGDPDJHGPRWRUGULYLQJERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 3RVVLEOHFDXVHV &$1,1,7,$/,=$7,21)$,/85( F 3RVVLEOHFDXVHV &$11275(&(,9(3$&.(7)520,167580(17 6/,48,'/(9(/'(7(&7,21(5525 7KLVHUURUPHVVDJHLVIRU.RQHODE,QVWUXPHQWVWD\Vµ1RWLQXVH¶VWDWXV 6RIWZDUHSUREOHP ±5HVWDUWWKHZRUNVWDWLRQ5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH &RPPXQLFDWLRQIDXOWEHWZHHQWKHZRUNVWDWLRQDQGWKHDQDO\]HU7\SLFDOO\FRPLQJ ZKHQ.RQHODEKDVEHHQVZLWFKHGRII5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ *) F /LTXLGGHWHFWHGIDOVHO\DERYHWKHVXUIDFH$QDO\VLVVWRSV5HVWDUWWKH DQDO\]HU,IWKHSUREOHPSHUVLVWVFDOOVHUYLFH &RQFHUQLQJ .RQHODE DQGL F &89(77(/2$'(5,1,7,$/,=$7,21)$,/(' 3RVVLEOHFDXVHV $QREVWDFOHGHWHFWHG 5HPRYHWKHREVWDFOHLILWLVVHHQLQWKHFXYHWWH ORDGHU3UHVV67$57WRFRQWLQXHDQDO\VLV 7KHFRJJHGEHOWLVEURNHQRUGDPDJHGRSWR RSWRFDEOHPRWRUGULYLQJERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH *) Electronic or ground cable error November 2, 2003 48953054-4081 Konelab Service Manual 6-20 Error Messages & Troubleshooting &RQFHUQLQJ .RQHODE DQGL F Version I &89(77(/2$'(5,1,7,$/,=$7,21)$,/(' /$7&+&89(77(029(5&89(77(386+(5 527$7,1*81,7 3RVVLEOHFDXVHV $QREVWDFOHGHWHFWHG 5HPRYHWKHREVWDFOHLILWLVVHHQLQWKHFXYHWWH ORDGHU3UHVV67$57WRFRQWLQXHDQDO\VLV 7KHFRJJHGEHOWLVEURNHQRUGDPDJHGRSWR RSWRFDEOHPRWRUGULYLQJERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH .867,',63(16(5+,7$12%67$&/(:+,/( ',63(16,1*)52075$&. 'LVSHQVLQJFRQWLQXHVIURPWKHQH[WVDPSOH F F 3RVVLEOHFDXVHV :URQJSRVLWLRQLQJRIWKHWXEH7KHWXEHLVGLUHFWHGWR FKHFNLQWKHDXWRPDWLRQOLQHDQGWKHXVHUKDVWRLQVHUW LWDJDLQWRWKHV\VWHPRUWR.RQHODE 6$03/(',63(16(56$03/(0,;(5 5($*(17',63(16(55($*(170,;(5 ,6(',63(16(50$',63(16(50,;(5 .867,',63(16(5+,7$12%67$&/( 3RVVLEOHFDXVHV 3UREH0L[HULVEHQW ±&KHFNWKHVWUDLJKWQHVVRIWKHSUREHPL[HUDQG WKDWLWKDVQRWIDVWHQHGLQWRWKHGLVSHQVHU VPL[HU V FRYHU7RFKDQJHWKHSUREHPL[HUUHIHUWRVHFWLRQV DQG5HIPDQXDO3HUIRUPZDWHUZDVK )LQWKH,QVWUXPHQWDFWLRQVZLQGRZEHIRUH FRQWLQXLQJ7KLVPXVWEHGHILQLWHO\GRQHZKHQ .RQHODELVFRQQHFWHGWRWKHDXWRPDWLRQFRQYH\RU $QREVWDFOHGHWHFWHG ±5HPRYHWKHREVWDFOH3HUIRUPZDWHUZDVK)LQ WKH,QVWUXPHQWDFWLRQVZLQGRZEHIRUHFRQWLQXLQJ 7KLVPXVWEHGHILQLWHO\GRQHZKHQ.RQHODELV FRQQHFWHGWRWKHDXWRPDWLRQFRQYH\RU3UHVV 67$57WRFRQWLQXHDQDO\VLV 3URJUDPPDEOHDGMXVWPHQWVKDYHEHHQFKDQJHG ±5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting F 6-21 6(*0(17/2$'(5','127029(&255(&7/< 3RVVLEOHFDXVHV (JWKHXVHUKDVRSHQHGWKHVHJPHQWFRYHUZKLOH WKHVHJPHQWORDGHUKDVEHHQPRYLQJ7KHVHJPHQW ORDGHUVWRSV 0RYHWKHVHJPHQWORDGHUPDQXDOO\WRWKHORZHU SRVLWLRQDQGUHERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ $QREVWDFOHGHWHFWHG 5HPRYHWKHREVWDFOH0RYHWKHVHJPHQWORDGHU PDQXDOO\WRWKHORZHUSRVLWLRQDQGUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ 'DPDJHGRSWRRSWRFDEOHPRWRUGULYLQJERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH F &89(77(/2$'(5','127029(&255(&7/< 3RVVLEOHFDXVHV $QREVWDFOHGHWHFWHG 5HPRYHWKHREVWDFOH3UHVV67$57WRFRQWLQXH DQDO\VLV 'DPDJHGRSWRRSWRFDEOHPRWRUGULYLQJERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH &89(77(&+(&.)281'$',57<&89(77( 7KHRSWLFDOTXDOLW\RIHYHU\FXYHWWHLVFKHFNHGEHIRUHXVH F 3RVVLEOHFDXVHV &89(77(-$00(',1/2$'(5 F 3RVVLEOHFDXVHV 'LUW\FXYHWWHRUEDGRSWLFDOTXDOLW\RIDFXYHWWH (PSW\WKHFXYHWWHORDGHUDQGUHORDGLWFDUHIXOO\ZLWK FOHDQ.RQHODEFXYHWWHV5HVWDUWDQDO\VLV &XYHWWHVQRWSURSHUO\SODFHGLQWKHORDGHU 2SHQWKHFRYHURIWKHFXYHWWHORDGHU(PSW\WKH ORDGHUPDQXDOO\5HILOOLW 'DPDJHGFXYHWWHLQWKHORDGHU 5HPRYHGDPDJHGFXYHWWH 'DPDJHGFXYHWWHLQWKHLQFXEDWRU 5HPRYHGDPDJHGFXYHWWH5HIHUWRVHFWLRQ ,167580(17$'-8670(17),/((5525 F 3RVVLEOHFDXVHV &ORVHVFRQQHFWLRQWRWKHLQVWUXPHQW F &RUUXSWHGDGMXVWPHQWILOH 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 12'(X6(17:521*'$7$ X0($167+(%2$5'180%(5 6RIWZDUHSUREOHP3UHVV6WDUWWRFRQWLQXH,ISUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ November 2, 2003 48953054-4081 Konelab Service Manual 6-22 Error Messages & Troubleshooting F Version I ,17(51$/3&,62872)0(025< 6RIWZDUHSUREOHP3UHVV6WDUWWRFRQWLQXH,ISUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ F F 7(03(5$785(2872)5$1*(6$03/(5(*,67(5 5($*(175(*,67(50($685(0(17&+$11(/ ,1&8%$725,6(%/2&.6$03/(&+$11(/ 5($*(17&+$11(/ 3RVVLEOHFDXVHV %URNHQWKHUPLVWRUWKHUPDOUHVLVWRUWKHUPLVWRUFDEOH 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 12'(X6(17$:521*0(66$*( X0($167+(%2$5'180%(5 6RIWZDUHSUREOHP3UHVV6WDUWWRFRQWLQXH,ISUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ 12'(X','127%227 X0($167+(%2$5'180%(5 &ORVHVFRQQHFWLRQWRWKHLQVWUXPHQW F 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ,IWKHSUREOHPSHUVLVWVIRUWKH VDPHERDUGFDOOVHUYLFH 6$03/(',63(16(56$03/(0,;(5 5($*(17',63(16(55($*(170,;(5 ,6(',63(16(50$',63(16(50,;(5 .867,',63(16(5+,7$12%67$&/( &255(&7('$8720$7,&$//< $XWRPDWLFDOO\SHUIRUPHGFRUUHFWLRQ7KLVLVVHHQZKHQµ6KRZDOOPHVVDJHV¶LVRQLQ WKH0HVVDJHVZLQGRZ 12'(X','1275(6321' X0($167+(%2$5'180%(5 &ORVHVFRQQHFWLRQWRWKHLQVWUXPHQW F 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ,IWKHSUREOHPSHUVLVWVIRUWKH VDPHERDUGFDOOVHUYLFH Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting F 6-23 6$03/(',63(16(56$03/(0,;(5 5($*(17',63(16(55($*(170,;(5 ,6(',63(16(5.867,',63(16(5 ,1,7,$/,=$7,21)$,/(' 3RVVLEOHFDXVHV $QREVWDFOHGHWHFWHG 5HPRYHWKHREVWDFOH3HUIRUPZDWHUZDVK)LQ WKH,QVWUXPHQWDFWLRQVZLQGRZEHIRUHFRQWLQXLQJ :DWHUZDVKPXVWEHGHILQLWHO\GRQHZKHQ.RQHODE LVFRQQHFWHGWRWKHDXWRPDWLRQFRQYH\RUDQG .867,LVLQµQRWLQXVH¶VWDWH3UHVV67$57WR FRQWLQXHDQDO\VLV 'DPDJHGRSWRRSWRFDEOHPRWRUGULYLQJERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH F 6$03/(',/87,2192/80((5525',/5$7,26 7HVWDSSHDUVLQWKH0DLQZLQGRZWRWKH,QYDOLGWHVWVOLVWZLWKWKHFRPPHQW LQYDOLGSDUDPHWHU7KHDQDO\VHULVQRWDEOHWRSHUIRUPWKHGLOXWLRQGHILQHGE\WKH XVHU9ROXPHJRHVRYHUWKHFHOOOLPLWµO&KHFNWKHGLOXWLRQUDWLRVDQG GLVSHQVLQJYROXPHVXVHGLQWKHWHVWLQWKH7HVWGHILQLWLRQDQG7HVWIORZZLQGRZV 5HIHUILUVWWRWKHVHFWLRQ5HIPDQXDODERXWGLVSHQVLQJ ,6(6$03/(5($*(176<5,1*(,1,7)$,/(' F 3RVVLEOHFDXVHV ,17(51$/62)7:$5((5525,17(51$/3& ,17(51$/62)7:$5((5525,17(51$/3& F 7RRVWLIIPHFKDQLFVRUGDPDJHGRSWRRSWRFDEOH PRWRUGULYLQJERDUG ±3HUIRUPZDWHUZDVK)LQWKH,QVWUXPHQWDFWLRQV ZLQGRZEHIRUHFRQWLQXLQJ7KLVPXVWEHGHILQLWHO\ GRQHZKHQ.RQHODELVFRQQHFWHGWRWKHDXWRPDWLRQ FRQYH\RU3UHVV6WDUWWRFRQWLQXHDQDO\VLV,ISUREOHP SHUVLVWVUHERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ,I WKLVGRHVQ¶WKHOSFDOOVHUYLFH 6RIWZDUHSUREOHP3UHVV6WDUWWRFRQWLQXH,IWKHSUREOHPSHUVLVWVUHERRW WKHLQVWUXPHQW5HIHUWRVHFWLRQ 1RWHWKDWLQ.RQHODEWKHUHLVQRLQWHUQDO3&7KLVVRIWZDUHHUURULQ.RQHODE PHDQVHUURULQWKDWSDUWRIZRUNVWDWLRQ¶VVRIWZDUHZKLFKLVFRQWUROOLQJLQVWUXPHQW &89(77()(7&+)$,/('V326X VPHDQVPHDVXULQJUHDJHQWRUVDPSOHFKDQQHO SRVXPHDQVWKHLQFXEDWRUSRVLWLRQ 7KLVLVVHHQZKHQ 6KRZDOOPHVVDJHV LVRQLQWKH0HVVDJHVZLQGRZ1RDFWLRQLV QHHGHGXQWLOWKHHUURUPHVVDJH ([LWIDLOHG5HPRYHFXYHWWHIURPLQFXEDWRU V DSSHDUV F November 2, 2003 3RVVLEOHFDXVHV 'DPDJHGFXYHWWH 5HPRYHGDPDJHGFXYHWWH5HIHUWRVHFWLRQ +RRNLQWKHFXYHWWHDUPLVQRWRN &KHFNWKHKRRN5HIHUWRVHFWLRQ 48953054-4081 Konelab Service Manual 6-24 Error Messages & Troubleshooting Version I 5($*(175(*,67(56$03/(5(*,67(5,1&8%$725 326,7,21&255(&7('$8720$7,&$//< $XWRPDWLFDOO\SHUIRUPHGFRUUHFWLRQ7KLVLVVHHQZKHQ 6KRZDOOPHVVDJHV LVRQLQ WKH0HVVDJHVZLQGRZ 5($*(175(*,67(56$03/(5(*,67(5,1&8%$725 )(('%$&.(5525 3HUIRUP6WDUWXSWRFRQWLQXH F 0HFKDQLFDOREVWDFOH &KHFNWKDWWKHUHDJHQWUHJLVWHU VDPSOHUHJLVWHULQFXEDWRUFDQPRYHIUHHO\ 7RRORRVHFRJJHGEHOWRUEURNHQIHHGEDFN VHQVRURUGDPDJHGPRWRUGULYLQJERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 3RVVLEOHFDXVHV ,6(',63(16(55($*(17',63(16(5 6$03/(',63(16(5',63(16(5326,7,21 &255(&7('$8720$7,&$//< $XWRPDWLFDOO\SHUIRUPHGFRUUHFWLRQ7KLVLVVHHQZKHQ 6KRZDOOPHVVDJHV LVRQLQ WKH0HVVDJHVZLQGRZ F ,6(',63(16(55($*(17',63(16(5 6$03/(',63(16(5',63(16(5)(('%$&.(5525 3RVVLEOHFDXVHV 0HFKDQLFDOREVWDFOH &KHFNWKDWWKHGLVSHQVHUFDQPRYHIUHHO\ 3HUIRUPZDWHUZDVK)LQWKH,QVWUXPHQWDFWLRQV ZLQGRZEHIRUHFRQWLQXLQJ7KLVPXVWEHGHILQLWHO\ GRQHZKHQ.RQHODELVFRQQHFWHGWRWKHDXWRPDWLRQ FRQYH\RU 7RRORRVHFRJJHGEHOWRUEURNHQIHHGEDFNVHQVRU RUGDPDJHGPRWRUGULYLQJERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting 6-25 6$03/(72$,5%281'$5<127)281',6( F 3RVVLEOHFDXVHV 7KHOLTXLGGHWHFWRULQWKH,6(EORFNGRHVQRWILQGWKHOLTXLGDLUERXQGDU\ 6KRUW,6(&$/ &KDQJHDQHZEDJRI,6(&$/$VNFDOLEUDWLRQ LQWKH&DOLEUDWLRQ4&VHOHFWLRQZLQGRZDQG UHTXHVW $GG,6(&$/ LQWKH5HDJHQWVZLQGRZ /RRVHFRQWDFWEHWZHHQHQGVOLFHVDQGOLTXLG GHWHFWLRQZLUHV 2SHQWKHFRYHURI,6(GLVSHQVLQJDUPDQGHQVXUH WKDWWKHFRQQHFWLRQVDUHWLJKW /HDNDJHRUFORWWLQJLQWKHQHHGOHRULQWKHWXEH 5HIHUWRVHFWLRQ /RFDWHWKHOHDNDJHRUFORWWLQJDQGUHPRYHWKH SUREOHP /LTXLGGHWHFWLRQLVQRWZRUNLQJ 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH &89(77(6(1625&$/,%5$7,21)$,/('5($*(17 6$03/(&+$11(/ $QDO\VLVFDQEHFRQWLQXHG F 3RVVLEOHFDXVHV )$,/('72)(7&+&89(77()520/2$'(5 F 3RVVLEOHFDXVHV 'DPDJHGFXYHWWHLQWKHLQFXEDWRULQ.RQHODERULQ WKHORDGHULQ.RQHODERUGLUW\RUEURNHQFXYHWWH VHQVRU 3HUIRUP6WDUWXS,ISUREOHPSHUVLVWVFDOOVHUYLFHWR FKHFNWKHVLWXDWLRQ &XYHWWHVQRWSURSHUO\SODFHGLQWKHORDGHU 2SHQWKHFRYHURIFXYHWWHORDGHU(PSW\WKH ORDGHUPDQXDOO\5HILOOLW 'DPDJHGFXYHWWHLQWKHORDGHU 5HPRYHGDPDJHGFXYHWWH +RRNLQWKHFXYHWWHDUPLVQRWRN &KHFNWKHKRRN5HIHUWRVHFWLRQ 3RRUSURJUDPPDEOHDGMXVWPHQWRUWKHZURQJ PHFKDQLFDOKHLJKWRIWKHFXYHWWHIHHGHURUWKH PHFKDQLFVRIWKHFXYHWWHDUPGRHVQ WZRUN SURSHUO\ 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH F 6<5,1*(66+28/'%($'-867('$'-8670(17 352*5$0 6HOHFW$GMXVWPHQWSURJUDPLQWKH,QVWUXPHQWDFWLRQVZLQGRZDQGOHWWKH DQDO\VHUSHUIRUP 6\ULQJH]HURSRVLWLRQ $GMXVWPHQWLVPDGHDXWRPDWLFDOO\ F November 2, 2003 :25.67$7,216(17:521*'$7$ 6RIWZDUHSUREOHP3UHVV6WDUWWRFRQWLQXH 48953054-4081 Konelab Service Manual 6-26 Error Messages & Troubleshooting &RQFHUQLQJ .RQHODE DQGL 6$03/(5($*(17',/8(173803,1,7)$,/(' F 3RVVLEOHFDXVHV 12&89(77()25:$7(5%/$1. F Version I 7RRVWLIIPHFKDQLFVRUGDPDJHGRSWRRSWRFDEOH PRWRUGULYLQJERDUG ±3HUIRUPZDWHUZDVK)LQWKH,QVWUXPHQWDFWLRQV ZLQGRZEHIRUHFRQWLQXLQJ7KLVPXVWEHGHILQLWHO\ GRQHZKHQ.RQHODELVFRQQHFWHGWRWKHDXWRPDWLRQ FRQYH\RU3UHVV6WDUWWRFRQWLQXHDQDO\VLV,ISUREOHP SHUVLVWVUHERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ,I WKLVGRHVQ¶WKHOSFDOOVHUYLFH 'DPDJHGFXYHWWHLQWKHLQFXEDWRU ±3HUIRUP6WDUWXS 3RVVLEOHFDXVHV ,17(51$/3&(55250(66$*(X X0($167+((5525180%(5 6RIWZDUHSUREOHP$QDO\VLVFRQWLQXHV (55250(66$*(6&20,1*)520 7+(,167580(17 612'(6 XPHDQVWKHERDUG QXPEHU %227 %227X(5525520&+(&.680 %227X(55255$0&+(&.680 %227X(5525),/(&+(&.680 %227X(552581$%/(72:5,7(((3520 %227X(55250&$&.1275(&(,9(' %227X(5525127,1&211(&7('02'( %227X(5525,//(*$/'2:1/2$'$''5(66 %227X(552581(;3(&7('67$572) $33/,&$7,21 %227X(552581.12:1&200$1' &ORVHVFRQQHFWLRQWRWKHLQVWUXPHQW F 3RVVLEOHFDXVHV %URNHQERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH %22712'((55250(66$*(X X0($167+((5525180%(5 6RIWZDUHSUREOHP$QDO\VLVFRQWLQXHV Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting XPHDQVWKHERDUG QXPEHU 6-27 02725 02725X(5525,1&255(&712'(7<3( F 3RVVLEOHFDXVHV 02725X(5525:521*$&7,21 02725X(5525:521*&200$1' &ORVHVFRQQHFWLRQWRWKHLQVWUXPHQW F 7KHERDUGLVLQDZURQJSRVLWLRQRUWKHERDUGKDVEHHQ FRQILJXUHGZURQJ 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 6RIWZDUHSUREOHP3UHVV6WDUWWRFRQWLQXH,IWKHSUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ 02725X(5525$'&219(57(5 F 3RVVLEOHFDXVHV $'FRQYHUWHULVQRWZRUNLQJ %URNHQERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 02725X)(('%$&.(5525'(9,&(+$6%((1 029(' 7KHXVHULVZDUQHGWKDWWKHGHYLFHKDVEHHQPRYHGPDQXDOO\$QDO\VLVFRQWLQXHV 02725X29(5&855(17(5525 F 3RVVLEOHFDXVHV 02725X'(&2'((5525 F %URNHQFDEOHPRWRUERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 6RIWZDUHSUREOHP3UHVV6WDUWWRFRQWLQXH,IWKHSUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ 02725X(5525,//(*$/&21),*85$7,21 &ORVHVFRQQHFWLRQWRWKHLQVWUXPHQW F 6RIWZDUHSUREOHP5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ,ISUREOHP SHUVLVWVFDOOVHUYLFH F 02725X(5525&$10(66$*(29(5)/2: 6RIWZDUHSUREOHP3UHVV6WDUWWRFRQWLQXH,ISUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ 02725(55250(66$*(X X0($167+((5525180%(5 6RIWZDUHSUREOHP$QDO\VLVFRQWLQXHV November 2, 2003 48953054-4081 Konelab Service Manual 6-28 Error Messages & Troubleshooting Version I 3+272 3+2720(7(5(5525,1&255(&712'(7<3( F 3RVVLEOHFDXVHV &ORVHVFRQQHFWLRQWRWKHLQVWUXPHQW F 7KHERDUGLVLQDZURQJSRVLWLRQRUWKHERDUGKDVEHHQ FRQILJXUHGZURQJ ±5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 3+2720(7(5(5525:521*&200$1' 3+2720(7(5(5525$'&219(57(5127 &$/,%5$7(' 6RIWZDUHSUREOHP3HUIRUP6WDUWXS 3+2720(7(5(5525&+233(5,6127029,1* 3+2720(7(5(5525722/2:&+233(563((' 3+2720(7(5(5525722+,*+&+233(563((' F 3RVVLEOHFDXVHV 3+2720(7(5(5525&+233(51275811,1* F %URNHQFDEOHLQWKHFKRSSHUPRWRURUWKHFKRSSHU PRWRUGRHVQ WZRUN ±5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 6RIWZDUHSUREOHP3HUIRUP6WDUWXS,IWKHSUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ 3+2720(7(5(55250($685(0(177,0(287 F 3RVVLEOHFDXVHV 3+2720(7(5(5525,//(*$/3$5$0(7(5 F *$,1 %URNHQ3+272ERDUG ±5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 6RIWZDUHSUREOHP3HUIRUP6WDUWXS 3+2720(7(5(55256863,&,2866,*1$/*$,1 3+2720(7(5(55256863,&,2865()(5(1&( 7KHDGMXVWPHQWRIODPSYROWDJHFDQQRWEHGRQHLQDFHUWDLQZDYHOHQJWK Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting F 6-29 3RVVLEOHFDXVHV :URQJO\LQVWDOOHGODPS &KHFNWKHLQVWDOODWLRQ5HIHUWRVHFWLRQ 5HIPDQXDO %URNHQODPS 5HSODFHWKHODPS5HIHUWRVHFWLRQ5HI PDQXDO %URNHQ3+276,*RU3+275()RU3+272 ERDUGVRUFDEOHV 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 3+2720(7(5(5525$'%86<6,*1$/127)281' 3+2720(7(5(55250($685(0(176<1& F 3RVVLEOHFDXVHV 3+2720(7(5(5525/$03,62)) 3+2720(7(5(552562)7:$5((5525 3+2720(7(5(5525&+233(5&21752/ F %URNHQ3+272ERDUG ±5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 6RIWZDUHSUREOHP5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ 3+2720(7(5(5525722/2:6,*1$/5(68/7 3+2720(7(5(5525722+,*+6,*1$/5(68/7 3+2720(7(5(5525722/2:5()(5(1&( 5(68/7 3+2720(7(5(5525722+,*+5()(5(1&( 5(68/7 F 3RVVLEOHFDXVHV :URQJO\LQVWDOOHGODPS &KHFNWKHLQVWDOODWLRQ5HIHUWRVHFWLRQ 5HIPDQXDO %URNHQODPS 5HSODFHWKHODPS5HIHUWRVHFWLRQ5HI PDQXDO %URNHQ3+276,*RU3+275()RU3+272 ERDUGVRUFDEOHV 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 3+2720(7(5:$51,1*126,*1$/ 3+2720(7(5(5525,//(*$/&21),*85$7,21 7KHZDUQLQJWKDWQRVLJQDOGHWHFWHGIRUVRPHUHTXHVWHJWKHDEVRUEDQFHLVVRKLJK 7KHUHVXOWLVWXUQHGWRPDQXDODFFHSWDQFH F 6RIWZDUHSUREOHP5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ,ISUREOHP SHUVLVWVFDOOVHUYLFH F November 2, 2003 3+2720(7(5(5525,//(*$/&200$1' 6RIWZDUHSUREOHP3HUIRUP6WDUWXS 48953054-4081 Konelab Service Manual 6-30 Error Messages & Troubleshooting 3+2720(7(5(5525,11(5$'&219(57(5 F 3RVVLEOHFDXVHV 3+2720(7(5/$03,6%52.(1 F Version I 7KH3+272ERDUGLVEURNHQ ±5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 5HSODFHWKHODPS5HIHUWRVHFWLRQ5HIPDQXDO 3+2720(7(5(55251(*$7,9(5()(5(1&( 5(68/7 F 3RVVLEOHFDXVHV :URQJO\LQVWDOOHGODPS &KHFNWKHLQVWDOODWLRQ5HIHUWRVHFWLRQ 5HIPDQXDO %URNHQODPS 5HSODFHWKHODPS5HIHUWRVHFWLRQ5HI PDQXDO %URNHQ3+276,*RU3+275()RU3+272ERDUGV RUFDEOHV 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH F 3+2720(7(5(5525&$10(66$*(29(5)/2: 6RIWZDUHSUREOHP3UHVV6WDUWWRFRQWLQXH,ISUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ 3+2720(7(5(55250(66$*(X X0($167+((5525180%(5 6RIWZDUHSUREOHP$QDO\VLVFRQWLQXHV Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting 6-31 ,6( ,6(12'((5525,1&255(&712'(7<3( F 3RVVLEOHFDXVHV &ORVHVFRQQHFWLRQWRWKHLQVWUXPHQW F 7KHERDUGLVLQDZURQJSRVLWLRQRUWKHERDUGKDVEHHQ FRQILJXUHGZURQJ 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH ,6((5525722/2:'90'(7(&7('V ,6((5525722+,*+'90'(7(&7('V V0($167+((/(&752'( 61$0( 3RVVLEOHFDXVHV /RRVHFRQWDFWEHWZHHQDQHOHFWURGHSLQDQGDQ HOHFWURGHFDS 3UHVVIURPWKHVLGHVRIWKHFDSRIWKHVLJQDOZLUH 'LUW\HOHFWURGH :DVKZLWKZDVKLQJVROXWLRQLQ6WDQGE\DQGJLYH,6( 3ULPHVROXWLRQLQ6WDUWXS $JHGHOHFWURGH &KDQJHWKHHOHFWURGH5HIHUWRVHFWLRQ5HI PDQXDO 3RLVRQHGHOHFWURGH :DVKH[WHQVLYHO\ZLWKVHUXP ,IDOOVOLFHVJLYHWRRORZRUWRRKLJK'90PRVW SUREDEO\ILOOLQJVROXWLRQLVPLVVLQJIURPWKHUHIHUHQFH HOHFWURGH )LOOWKHUHIHUHQFHHOHFWURGH&KHFNWKHHOHFWURGHSLQ DQGFKDQJHLIQHHGHG5HIHUWRVHFWLRQ5HI PDQXDO 'DPDJHGUHIHUHQFHHOHFWURGHDOOVOLFHVJLYHWRRORZ RUWRRKLJK'90 &KDQJHDQHZUHIHUHQFHHOHFWURGH5HIHUWRVHFWLRQ 5HI0DQXDO 'DPDJHG,6($03ERDUGRUFDEOH 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH ,6(12'((55250($685(0(177,0(287 F 3RVVLEOHFDXVHV ,6(12'((552512,216&21),*85(' F (OHFWURQLFRUVRIWZDUHSUREOHP :KHQ 5XQQLQJ PHVVDJHKDVGLVDSSHDUHGSUHVV 67$57WRFRQWLQXH,IWKHSUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ ,QFDVHUHERRWLQJLVQRWKHOSLQJFDOOVHUYLFH 6RIWZDUHSUREOHP5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH November 2, 2003 48953054-4081 Konelab Service Manual 6-32 Error Messages & Troubleshooting F F Version I ,6(12'((5525/,48,''(7(&7251275811,1* 6RIWZDUHSUREOHP5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,6(12'((5525/,48,''(7(&7257,0(287 3RVVLEOHFDXVHV /RRVHFRQWDFWEHWZHHQDQHOHFWURGHSLQDQGDQ HOHFWURGHFDS 3UHVVIURPWKHVLGHVRIWKHFDSRIWKHVLJQDOZLUH 'LUW\HOHFWURGH :DVKZLWKZDVKLQJVROXWLRQLQ6WDQGE\DQGJLYH,6( 3ULPHVROXWLRQLQ6WDUWXS $JHGHOHFWURGH &KDQJHWKHHOHFWURGH5HIHUWRVHFWLRQ5HI PDQXDO 3RLVRQHGHOHFWURGH :DVKH[WHQVLYHO\ZLWKVHUXP )LOOLQJVROXWLRQLVPLVVLQJIURPWKHUHIHUHQFH HOHFWURGH )LOOWKHUHIHUHQFHHOHFWURGH&KHFNWKHHOHFWURGHSLQ DQGFKDQJHLIQHHGHG5HIHUWRVHFWLRQ5HI PDQXDO 'DPDJHGUHIHUHQFHHOHFWURGH &KDQJHDQHZUHIHUHQFHHOHFWURGH5HIHUWRVHFWLRQ 5HIPDQXDO 'DPDJHG,6($03,6(ERDUGRUFDEOH 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH ,6(12'((55250($685(0(177,0(287 F 3RVVLEOHFDXVHV ,6(12'((5525:521*&200$1' ,6(12'((5525,//(*$/3$5$0(7(5 F (OHFWURQLFRUVRIWZDUHSUREOHP :KHQ 5XQQLQJ PHVVDJHKDVGLVDSSHDUHGSUHVV 67$57WRFRQWLQXH,IWKHSUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ ,QFDVHUHERRWLQJLVQRWKHOSLQJFDOOVHUYLFH 6RIWZDUHSUREOHP3HUIRUP6WDUWXS,IWKHSUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ ,6(12'((55256(/)7(67,6($'*5281' ,6(12'((55256(/)7(67,6($'5()(5(1&( ,6(12'((55256(/)7(67/,48,''(7(&725 ,6(12'((55256(/)7(67/,48,''(7(&725 F 3RVVLEOHFDXVHV ,6(12'((5525,//(*$/&21),*85$7,21 F 'DPDJHG,6($03,6(ERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 6RIWZDUHSUREOHP5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting 6-33 ,6(12'((5525&$10(66$*(29(5)/2: F 6RIWZDUHSUREOHP3UHVV6WDUWWRFRQWLQXH,ISUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ ,6(12'((55250(66$*(X X0($167+((5525180%(5 6RIWZDUHSUREOHP$QDO\VLVFRQWLQXHV XPHDQVWKHERDUG QXPEHU ,1287 ,212'(X(5525,1&255(&712'(7<3( &ORVHVFRQQHFWLRQWRWKHLQVWUXPHQW F 3RVVLEOHFDXVHV 7KHERDUGLVLQDZURQJSRVLWLRQRUWKHERDUGKDVEHHQ FRQILJXUHGZURQJ ±5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH V&20081,&$7,21(5525 V7,0(287 V&20081,&$7,21(5525 F 3RVVLEOHFDXVHV 7KHEDUFRGHUHDGHULVEURNHQRUGDPDJHGFDEOH FRQQHFWLRQRUFDEOHRU,2ERDUG ±5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH ,212'(X(5525%$5&2'(5($'(5 &21),*85$7,21 F 6RIWZDUHSUREOHP5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH ,212'(X(5525,//(*$/3$5$0(7(5 F 6RIWZDUHSUREOHP3UHVV6WDUWWRFRQWLQXH,IWKHSUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ ,212'(X(55256(16256(/)7(67 6RPHVHQVRULVJLYLQJDSRRUVLJQDOIRUDPRPHQW F 3RVVLEOHFDXVHV 6RIWZDUHSUREOHP 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH ,212'(X(5525:521*&200$1' F 6RIWZDUHSUREOHP3UHVV6WDUWWRFRQWLQXH,IWKHSUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ November 2, 2003 48953054-4081 Konelab Service Manual 6-34 Error Messages & Troubleshooting Version I ,212'(X(5525$'&219(57(57,0(287 F 6RIWZDUHHOHFWURQLFSUREOHP 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 3RVVLEOHFDXVHV ,212'(X(5525,//(*$/&21),*85$7,21 F 6RIWZDUHSUREOHP5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH ,212'(X(5525&$10(66$*(29(5)/2: F 6RIWZDUHSUREOHP3UHVV6WDUWWRFRQWLQXH,ISUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ ,212'((55250(66$*(X X0($167+((5525180%(5 6RIWZDUHSUREOHP$QDO\VLVFRQWLQXHV XPHDQVWKHERDUG QXPEHU 7(03 7(0312'(X(5525,1&255(&712'(7<3( &ORVHVFRQQHFWLRQWRWKHLQVWUXPHQW F 3RVVLEOHFDXVHV 7KHERDUGLVLQDZURQJSRVLWLRQRUWKHERDUGKDVEHHQ FRQILJXUHGZURQJ 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 7(0312'(X(5525,11(5$'&219(57(5 F 3RVVLEOHFDXVHV 7KH7(03ERDUGLVEURNHQ 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 7(0312'(X(5525722/2:6833/<92/7$*( 7(0312'(X(5525722+,*+6833/<92/7$*( F 3RVVLEOHFDXVHV $SRZHUIDLOXUHKDVRFFXUUHGDQGWKHLQVWUXPHQWLV ZRUNLQJZLWKEDWWHULHV7KHYROWDJHRIEDWWHULHVLV WRRORZ ±:DLWXQWLOWKHPDLQVKDYHUHWXUQHG5HERRWWKH LQVWUXPHQW%DWWHULHVDUHFKDUJHGDXWRPDWLFDOO\ $QDFFLGHQWDOGLVWXUEDQFHLQWKHVXSSO\YROWDJHRI LQVWUXPHQW ±5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ 7(0312'(X(5525)86(%52.(1 F 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ,ISUREOHPSHUVLVWVFDOO VHUYLFH Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting 6-35 +($7,1*5(6,67256+257&,5&8,7V +($7,1*5(6,67256+257&,5&8,7V V0($167+(326,7,21(*,1&8%$725 F 3RVVLEOHFDXVHV %URNHQUHVLVWRURUFDEOH 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH +($7,1*5(6,6725:,5(%52.(1V +($7,1*5(6,6725:,5(%52.(1V V0($167+(326,7,21(*,1&8%$725 F 3RVVLEOHFDXVHV %URNHQUHVLVWRURUFDEOH 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 7(0312'(X(55257+(50,672592/7$*(6 ,WLVXVXDOWKDWDOVRWKHHUURUPHVVDJHLVRFFXUULQJDWWKHVDPHWLPH F 3RVVLEOHFDXVHV 7KHWKHUPLVWRUVKRUWFLUFXLWV 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 7(0312'(X(5525:521*&200$1' 7(0312'(X(5525,//(*$/3$5$0(7(5 F 6RIWZDUHSUREOHP3HUIRUP6WDUWXS,IWKHSUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ +($7,1*5(6,672529(5&855(17V +($7,1*5(6,672529(5&855(17V V0($167+(326,7,21(*,1&8%$725 F 3RVVLEOHFDXVHV %URNHQUHVLVWRURUFDEOH 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 7(0312'(X81.12:1(5525 6RIWZDUHSUREOHP$QDO\VLVFRQWLQXHV F 7+(50,6725(5525V 7+(50,6725(5525V 7+(50,6725(5525V 7+(50,6725(5525V 7+(50,6725(5525V 7+(50,6725(5525V V0($167+(326,7,21(*,1&8%$725 3RVVLEOHFDXVHV 7KHWKHUPLVWRUZLUHLVEURNHQ 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 7(0312'(X(5525,//(*$/&21),*85$7,21 F 6RIWZDUHSUREOHP5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH November 2, 2003 48953054-4081 Konelab Service Manual 6-36 Error Messages & Troubleshooting Version I 7(0312'(X(5525$'&219(57(5(5525 7(0312'(X(5525$'&219(57(5(5525 7(0312'(X(5525$'&219(57(5(5525 F 'DPDJHG7(03ERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 3RVVLEOHFDXVHV 7(0312'(X(5525&$10(66$*(29(5)/2: F 6RIWZDUHSUREOHP3UHVV6WDUWWRFRQWLQXH,ISUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ 7(0312'((55250(66$*(X X0($167+((5525180%(5 6RIWZDUHSUREOHP$QDO\VLVFRQWLQXHV 32:&$1 32:&$112'((5525,1&255(&712'(7<3( &ORVHVFRQQHFWLRQWRWKHLQVWUXPHQW F 3RVVLEOHFDXVHV 7KHERDUGLVLQDZURQJSRVLWLRQRUWKHERDUGKDVEHHQ FRQILJXUHGZURQJ 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 32:&$112'((5525$'&219(57(5127 5811,1* 32:&$112'((5525$'&219(57(57,0(287 F 3RVVLEOHFDXVHV 6RIWZDUHHOHFWURQLFSUREOHP 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 32:&$112'((552595()5$1*( F 3RVVLEOHFDXVHV 7KHUHIHUHQFHYROWDJHRIWKH32:&$1ERDUGLV GDPDJHG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 32:&$112'((5525&22/,1*)86(%52.(1 F 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ,ISUREOHPSHUVLVWVFDOO VHUYLFH 7+(50,67256+257&,5&8,7V 7+(50,6725:,5(%52.(1V V0($16&22/,1*2%-(&76$03/(255($*(17 ',6. F Konelab Service Manual 3RVVLEOHFDXVHV 48953054-4081 %URNHQWKHUPLVWRURUFDEOH 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH November 2, 2003 Version I Error Messages & Troubleshooting 6-37 3(/7,(529(5&855(17V V0($16&22/,1*2%-(&76$03/(255($*(17 ',6. F 3RVVLEOHFDXVHV %URNHQ3HOWLHURUFDEOH 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 32:&$112'((5525%$77(5</2$',1* F 3RVVLEOHFDXVHV 'DPDJHGFDEOHVLQWKHEDWWHU\RUGDPDJHG32:&$1 ERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 32:&$112'((5525:521*&200$1' 32:&$112'((5525,//(*$/3$5$0(7(5 F 6RIWZDUHSUREOHP3HUIRUP6WDUWXS,IWKHSUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ 32:&$112'((5525&$1%8692/7$*( 32:&$112'((5525&$1%8692/7$*( F :DUQLQJDERXWDYROWDJHHUURULQWKH&$1EXV5HERRWWKHLQVWUXPHQW 5HIHUWRVHFWLRQ,ISUREOHPSHUVLVWVFDOOVHUYLFH %$77(5<92/7$*(,6722/2: F 3RVVLEOHFDXVHV $SRZHUIDLOXUHKDVRFFXUUHGDQGWKHLQVWUXPHQWLV ZRUNLQJZLWKEDWWHULHV7KHYROWDJHRIEDWWHULHVLVWRR ORZ$QDO\VLVLVVWRSSHGLQDFRQWUROOHGPDQQHU :DLWXQWLOWKHPDLQVKDYHUHWXUQHG5HERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ%DWWHULHVDUHFKDUJHG DXWRPDWLFDOO\ 3(/7,(5:,5(%52.(1 F 3RVVLEOHFDXVHV %URNHQ3HOWLHU 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 32:&$112'((552532:)$,/6,*1$/,6$&7,9( :URQJLQIRUPDWLRQRISRZHUIDLOXUH F 3RVVLEOHFDXVHV /RRVHFDEOHFRQQHFWLRQEURNHQ32:&$1ERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 32:&$112'((55255(/$<&217$&7,6%52.(1 F November 2, 2003 3RVVLEOHFDXVHV 48953054-4081 5HOD\FRQWDFWRIEDWWHU\LVEURNHQ 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH Konelab Service Manual 6-38 Error Messages & Troubleshooting Version I 32:&$112'((5525%$77(5<)86(25&$%/(,6 %52.(1 F 3RVVLEOHFDXVHV %DWWHU\IXVHRUFDEOHLVEURNHQ 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 32:&$112'((5525%$77(5<&+$5*,1* '2(61 7:25. F 3RVVLEOHFDXVHV %DWWHULHVDUHRXWRIFRQGLWLRQEURNHQ32:&$1ERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 32:&$112'((5525%$77(5<,6%52.(1 F 3RVVLEOHFDXVHV %DWWHULHVDUHRXWRIFRQGLWLRQEURNHQ32:&$1ERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 32:&$112'((5525992/7$*(,6722/2: F 3RVVLEOHFDXVHV %URNHQFDEOH32:&$1ERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 32:&$112'((5525,//(*$/&21),*85$7,21 F 6RIWZDUHSUREOHP5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 32:&$112'((5525992/7$*(,6722/2: F 3RVVLEOHFDXVHV %URNHQFDEOH32:&$1ERDUG 5HERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ ,ISUREOHPSHUVLVWVFDOOVHUYLFH 32:(5)$,/85(%$77(5,(6$5(6:,7&+('21 )RUWKHXVHULQIRUPDWLRQ3RZHUIDLOXUHKDVVWDUWHGDQGEDWWHULHVKDYHEHHQVZLWFKHG RQ 32:(5)$,/85(,629(5 )RUWKHXVHULQIRUPDWLRQ3RZHUIDLOXUHLVRYHU 32:&$112'((5525&$10(66$*(29(5)/2: F 6RIWZDUHSUREOHP3UHVV6WDUWWRFRQWLQXH,ISUREOHPSHUVLVWVUHERRWWKH LQVWUXPHQW5HIHUWRVHFWLRQ 32:&$112'((55250(66$*(X X0($167+((5525180%(5 6RIWZDUHSUREOHP$QDO\VLVFRQWLQXHV Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting 6-39 (55250(66$*(6&20,1*)520 5(325765HSRUW :521*'$7$)520$127+(5352&(665(3257 F ,QWHUQDOVRIWZDUHSUREOHPLQWKHGDWDEDVH,IWKHSUREOHPSHUVLVWVUHVWDUWWKH ZRUNVWDWLRQDQGUHERRWWKHLQVWUXPHQW5HIHUWRVHFWLRQ (5525:+(1'2,1*'$7$%$6(23(5$7,21 5(3257 F :DUQLQJDERXWLQWHUQDOVRIWZDUHSUREOHPLQWKHGDWDEDVH$QDO\VLV FRQWLQXHV,IWKHSUREOHPSHUVLVWVUHVWDUWWKHZRUNVWDWLRQDQGUHERRWWKHLQVWUXPHQW 5HIHUWRVHFWLRQ &200$1'%8))(5(55255(3257 6$03/(%8))(5(55255(3257 3$7,(17%8))(5(55255(3257 F 6RIWZDUHSUREOHP,IWKHSUREOHPSHUVLVWVUHVWDUWWKHZRUNVWDWLRQDQGUHERRW WKHLQVWUXPHQW5HIHUWRVHFWLRQ (5525,15(3257,1,),/( F 6RPHSUREOHPLQ6SHFLDOUHSRUWIRUPDW5HIHUWRVHFWLRQ5HIPDQXDO 5HSRUWIRUPDWV&KHFN\RXURZQUHSRUWIRUPDWZLWK)\RXFDQVHWDOOWRGHIDXOW IRUPDWDQGVWDUWWRIRUPDWWKHUHSRUWDJDLQ 1235,17(5,167$//(' :DUQLQJGXULQJVZLWFKLQJRQWKDWWKHSULQWHUGULYHUVDUHPLVVLQJ F ,QVWDOOWKHSULQWHUZKHQDQDO\VLQJLVQRWJRLQJRQ 5(3257(55250(66$*(X X0($167+((5525180%(5 6RIWZDUHSUREOHP$QDO\VLVFRQWLQXHV November 2, 2003 48953054-4081 Konelab Service Manual 6-40 Error Messages & Troubleshooting Version I 5(0('<352&('85(6 5(67$57,1*7+(:25.67$7,21 $1'5(%227,1*7+(,167580(17 F F 7RUHVWDUWWKHZRUNVWDWLRQ ([LWIURPWKH.RQHODESURJUDPLQWKH0DQDJHPHQWZLQGRZZLWK)) 6KXWGRZQWKHFRPSXWHUWKHEXWWRQ6WDUW6KXWGRZQLQWKHOHIWFRUQHURI WKHZLQGRZ F F 5HVWDUWWKHFRPSXWHU 6WDUWWKH.RQHODESURJUDP6WDUW3URJUDPVFOLFNWKHNRQHODELFRQ 7RUHERRWWKHLQVWUXPHQW F 6ZLWFKRIIWKHPDLQVE\WXUQLQJWKHPDLQVNH\WRWKH2))SRVLWLRQDWWKH UHDURIWKHDQDO\VHU F 6ZLWFKRQWKHDQDO\VHU .RQHODE.867,HTXLSSHGZLWKWKHORZFXUUHQWVZLWFK 6ZLWFKLQJRII ,QFDVH\RXKDYH.RQHODE.867,DQG\RXFDQQRWUHDFKWKHPDLQSRZHUVZLWFKDW UHDURIWKHDQDO\VHURSHQWKHOHIWIURQWGRRUDQGORFDWHWKHORZFXUUHQWVZLWFKWXUQLW LQWKHVWDQGE\VHWWLQJDQGXQSOXJWKHPDLQVFDEOHWRWXUQWKHSRZHUWRWDOO\RII :KHQWKHORZFXUUHQWVZLWFKLVLQWKHVWDQGE\VHWWLQJRQO\WKHERDUGVRIDQDO\VHU DQGWKHLQWHUQDO3&DUHSRZHUHGRII ± ,I\RXWDNHWKHPDLQVFDEOHRIIZKHQWKHORZFXUUHQWVZLWFKLVRQWKHEDFNXS EDWWHULHVRIWKHLQVWUXPHQWDUHWXUQHGRQ Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting 6-41 :$51,1*7KHORZ FXUUHQWVZLWFKGRHVQRW WXUQSRZHUWRWDOO\RII <RXFDQERRWWKHLQWHUQDO3&E\WXUQLQJWKHORZFXUUHQWVZLWFKLQWKHVWDQGE\ VHWWLQJDQGZDLWLQJDWOHDVWRQHPLQXWHEHIRUHWXUQLQJLWRQ 6ZLWFKLQJRQ :LWK.RQHODE.867,RSHQWKHOHIWIURQWGRRUORFDWHWKHORZFXUUHQWVZLWFKDQG WXUQLW21,7RJHWWKHDQDO\VHUZRUNLQJERWKWKHORZFXUUHQWVZLWFKDQGWKHPDLQ SRZHUVZLWFKDWWKHUHDURIWKHDQDO\VHUPXVWEHRQ November 2, 2003 48953054-4081 Konelab Service Manual 6-42 Error Messages & Troubleshooting Version I 5(029,1*$&89(77()520 7+(,1&8%$725 )LJXUH:KHQUHPRYLQJFXYHWWHVIURPWKHLQFXEDWRULQ.RQHODERSHQ WKHZKROHWRSFRYHUDQGVXSSRUWLWZLWKDEHDULQJURG,Q.RQHODEDQG LVRQO\QHFHVVDU\WRRSHQWKHXSSHUFRYHU F :DLWXQWLODQDO\VLVLVFRPSOHWH:LWK.RQHODEDQGLVHOHFW)0DQXDO FXYHWWHH[LWLQWKH,QVWUXPHQWDFWLRQVZLQGRZWRUHPRYHWKHFXYHWWHWRWKHKROHLQ LQFXEDWRU VZDOO2SHQWKHFRYHURIWKHDQDO\VHU5HIHUWR)LJXUH F ,Q.RQHODELDQGLUHPRYHWKHLQFXEDWRUFRYHUVFUHZV5HPRYH DFXYHWWH7KHUHDUHVSULQJVLQWKHVHSDUDWLRQZDOOVRIWKHLQFXEDWRUVORWV3UHVVLQJ WKHURXQGHQGRIWKHVSULQJPD\KHOSOLIWLQJWKHFXYHWWHIURPWKHLQFXEDWRU ,Q.RQHODEDQGLWKHUHLVQRQHHGWRRSHQWKHLQFXEDWRU VFRYHUVEHFDXVHWKH FXYHWWHLVGLUHFWHGWRWKHKROHLQWKHLQFXEDWRU VZDOO5HPRYHDFXYHWWH F F F Konelab Service Manual &KHFNWKHKRRNRIWKHFXYHWWHDUPIRUYLVLEOHGDPDJHRUREVWUXFWLRQV 5HDWWDFKWKHFRYHUVRIWKHLQFXEDWRULQ.RQHODELDQGL &ORVHWKHFRYHURIWKHDQDO\VHU 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting ,167$//,1*7+(6$03/( 5($*(17',6. %HFDUHIXOWKH GLVSHQVHULVPRYLQJ ZKHQ\RXWRXFKWKH FRYHUV:DLWXQWLOWKH GLVSHQVHULVEDFNLQLWV SRVLWLRQ 6-43 .RQHODEDQG 6$03/(',6. 7RGHWDFKWKHGLVN F F 7DNHWKHFDOFWUOVDPSOHGLVNFRYHUDZD\DQGOLIWWKHUHGVHJPHQWFRYHURII /LIWWKHVHJPHQWGLVNXSDQGRXW 7RDWWDFKWKHGLVN F /RFDWHWKHVHJPHQWGLVNLQWRWKHGLVNFRPSDUWPHQWVRWKDWWKHSRVLWLRQLQJ SLQDOLJQVZLWKWKHKROHLQWKHPLGGOHRIWKHVHJPHQWGLVN F 2SHQWKH67$7LQVHUWFRYHUDWWDFKWKHVHJPHQWFRYHULQLWVSRVLWLRQFORVH WKH67$7LQVHUWFRYHU F %HFDUHIXOWKH GLVSHQVHULVPRYLQJ ZKHQ\RXWRXFKWKH FRYHU:DLWXQWLOWKH GLVSHQVHULVEDFNLQLWV SRVLWLRQ 6HWWKHFDOFWUOGLVNFRYHULQLWVSRVLWLRQ 5($*(17',6. 7RGHWDFKWKHGLVN F F 7DNHWKHFRYHUDZD\ /LIWWKHUHDJHQWGLVNXS 7RDWWDFKWKHGLVN F $WWDFKWKHUHDJHQWGLVNLQWRWKHGLVNFRPSDUWPHQWVRWKDWWKHSRVLWLRQLQJ SLQDOLJQVZLWKWKHKROHLQWKHPLGGOHRIWKHUHDJHQWGLVN F 2SHQWKHUHDJHQWLQVHUWFRYHUDWWDFKWKHUHDJHQWFRYHULQLWVSRVLWLRQFORVH WKHUHDJHQWLQVHUWFRYHU November 2, 2003 48953054-4081 Konelab Service Manual 6-44 Error Messages & Troubleshooting Version I .RQHODE 5($*(17',6. 7RGHWDFKWKHUHDJHQWGLVN F F 7DNHWKH\HOORZFRYHUDZD\ /LIWWKHUHDJHQWGLVNXSZLWKWKHKDQGOH 7RDWWDFKWKHUHDJHQWGLVN F /RFDWHWKHUHDJHQWGLVNLQWRWKHGLVNFRPSDUWPHQWVRWKDWWKHSRVLWLRQLQJ SLQDOLJQVZLWKWKHKROHLQWKHPLGGOHRIWKHUHDJHQWGLVN F 2SHQWKHUHDJHQWLQVHUWFRYHUDWWDFKWKHUHDJHQWFRYHULQLWVSRVLWLRQFORVH WKHUHDJHQWLQVHUWFRYHU )LJXUH:KHQGHWDFKLQJWKHVDPSOHGLVNLQ.RQHODERSHQWKHZKROH GLVSHQVLQJFRYHU7KHUHLVDEHDULQJURGWRNHHSWKHFRYHUXS 6$03/(',6. 7RGHWDFKWKHVDPSOHGLVN F 2SHQWKHFRYHURIWKHDQDO\VHU5HIHUWR)LJXUH7DNHWKH\HOORZ UHDJHQWFRYHURIIDQGOLIWWKHUHDJHQWGLVNZLWKWKHKDQGOH F Konelab Service Manual ,QWKHPLGGOHRIWKHVDPSOHGLVNWKHUHDUHVL[VFUHZVWRRSHQ 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting 6-45 7RDWWDFKWKHVDPSOHGLVN F F 5HSODFHWKHVL[VFUHZVLQWKHPLGGOHRIWKHVDPSOHGLVN 5HSODFHWKHUHDJHQWGLVNVRWKDWWKHSRVLWLRQLQJSLQDOLJQVZLWKWKHKROHLQ WKHPLGGOHRIWKHUHDJHQWGLVN2SHQWKHUHDJHQWLQVHUWFRYHUDWWDFKWKHUHDJHQW FRYHULQLWVSRVLWLRQFORVHWKHUHDJHQWLQVHUWFRYHU F 5HSODFHWKHDQDO\VHUFRYHU ,6(/($.$*(25&/277,1* ,IWKHDQDO\VHUVHQGVDPHVVDJH 6DPSOHWRDLUERXQGDU\QRWIRXQG,6( WKHUH FDQEHDFORWRUOHDNLQWKHWXEHRUFORWLQWKH,6(GLVSHQVLQJQHHGOH )LJXUH&RYHURIWKH,6(GLVSHQVHUDUP &/27,17+(78%( F 2SHQWKHFRYHURIWKH,6(GLVSHQVHUDUP7KHFRYHULVKLQJHGVRLWLVHDV\ WRWXUQRSHQ F &KHFNYLVXDOO\WKHQHHGOHWXEH,IWKHUHLVDFORWGHWDFKWKHQHHGOHWXEHIURP WKHHQGVOLFHRIWKH,6(EORFNDQGWKHRWKHUHQGRIWKHWXEHIURPWKHQHHGOH5RWDWH WKHWXEHLQWKHILQJHUVDQGSUHVVJHQWO\,IQHFHVVDU\VTXHH]HVRPH,6(&$/ZLWK DV\ULQJHLQWRWKHWXEH&KHFNWKDWWKHFORWGLVDSSHDUV F &RQQHFWWKHWXEHEDFNWKHRWKHUHQGRIWKHWXEHWRWKHHQGVOLFHRIWKH,6( EORFNDQGWKHRWKHUHQGRIWKHWXEHWRWKHHQGRIWKHQHHGOH &/27,17+(1(('/( F F 7RUHPRYHDFORWSXVKDSLHFHRIPHWDOZLUHWKURXJKWKHQHHGOH 3HUIRUP6WDQGE\WRZDVKWKHQHHGOH ,IWKHSUREOHPSHUVLVWVFKDQJHWKHQHHGOH7KHQHHGOHSDFNHWLQFOXGHVDOVRWKHQHHGOH WXEH5HIHUWRVHFWLRQ5HIPDQXDO November 2, 2003 48953054-4081 Konelab Service Manual 6-46 Error Messages & Troubleshooting Version I 5(&29(5,1*)520.RQHODE '$7$%$6()$,/85( 6\PSWRPVRISRVVLEOH.RQHODEGDWDEDVHIDLOXUH $IWHUVWDUWLQJWKH.RQHODESURJUDP'%HUURUPHVVDJHVLQWKHPDLQZLQGRZRI .RQHODEIRUH[DPSOH´1RWHVWGDWD5+´ '%EDFNXSVKRXOGEHGRQH HDFKWLPHDIWHUFKDQJLQJ WHVWSDUDPHWHUVRU FDOLEUDWLQJWRSUHYHQWORVV RIHQWHUHGGDWDLQFDVHRID '%IDLOXUH '%EDFNXSVGRQHZLWK SUHYLRXV.RQHODEVRIWZDUH YHUVLRQVDUHQRWFRPSDWLEOH ZLWKWKHFXUUHQWYHUVLRQ 7DNHD'%EDFNXSDIWHU VRIWZDUHXSGDWH7KLV DSSOLHVRQO\WRPDMRU YHUVLRQXSGDWHVOLNH[! [[![ .RQHODE'%FDQ127EH UHVWRUHGE\RQO\FRS\LQJWKH GDWDEDVHILOHWRWKHFRUUHFW ORFDWLRQ8VHUHVWRUH SURFHGXUHVORFDWHGLQWKH .RQHODE'DWDEDVH 0DQDJHPHQWIROGHU1RWH WKDW.RQHODESURJUDPPXVW 127EHUXQQLQJZKLOH SHUIRUPLQJWKHVHGDWDEDVH SURFHGXUHV ´'%HUURU´GLDORJVZKHQHQWHULQJIRUH[DPSOHWKH7HVWGHILQLWLRQZLQGRZQRGDWD IURP'%GLVSOD\HG 5HSHDWLQJ.RQHODESURJUDPFUDVKHVRUPDOIXQFWLRQWKLVGRHVQRWDOZD\VLPSO\D '%IDLOXUH F )ROORZWKHOLVWXQWLOWKHGDWDEDVHZRUNV 5HVWRUHWKHODWHVWDXWRPDWLF'%EDFNXS7KH.RQHODE'%EDFNXSLVGRQH DXWRPDWLFDOO\HYHU\WLPHWKHXVHUVHOHFWV´&OHDUGDLO\ILOHV´7KLVZLOOPHDQORVV RIGDWDFKDQJHGDIWHUSUHYLRXV´&OHDUGDLO\ILOHV´ ([LWWKH.RQHODESURJUDP 6HOHFW´5HVFXHVDYHG'%´IURP6WDUW±3URJUDPV±.RQHODE'DWDEDVH 0DQDJHPHQW 5HVWDUWWKH.RQHODESURJUDP 5HVWRUHEDFNXSGRQHE\´6DYH'%´RU´6DYH'%WR&'´RU´6DYH'%WR GLVNHWWH´ ´5HVWRUHVDYHG'%´RU´5HVWRUH'%IURP&'´RU´5HVWRUHIURPGLVNHWWH´6HH SUHYLRXV 5HLQVWDOO.RQHODE'%ILOHVDQG.RQHODEGHIDXOWGDWDEDVH ´5HVWRUH%DVLF'%´6HHSUHYLRXV ,IWKH'%ZRUNVDIWHUWKLVWU\DJDLQWRUHVWRUHVRPHEDFNXSVHHSRLQWVDQG 5HLQVWDOOWKH.RQHODEVRIWZDUHIURP&' ,I\RXPRGLI\WKHZRUNVWDWLRQKRVWQDPH +RVWQDPHRIWKHZRUNVWDWLRQLVLQFOXGHGLQWKH'%FRQILJXUDWLRQVRLWFDQQRWEH FKDQJHGZLWKRXWWDNLQJFDUHRIWKHFXUUHQWGDWDEDVH ,I\RXZDQWIRUVRPHVSHFLDOUHDVRQWRPRGLI\WKHKRVWQDPH 6DYHWKH'%EHIRUHDQ\PRGLILFDWLRQV 0RGLI\WKHKRVWQDPH 5XQ5HVWRUH%DVLF'% 5HVWRUHWKHVDYHG'% Konelab Service Manual 48953054-4081 November 2, 2003 Version I Error Messages & Troubleshooting 6-47 ',63(16(50,;(5326,7,2162) .RQHODE$1' 7KHSDUDPHWHULQHUURUPHVVDJHV¶[[GLVSHQVHUPL[HUKLWDQ REVWDFOH¶LVWKHGLVSHQVHUPL[HUSRVLWLRQDVIROORZV 3KLGULYHOHYHOSRVLWLRQ 5HVWLQJSRVLWLRQ :DVKSRVLWLRQ ([WUDZDVKSRVLWLRQ :DVWHSRVLWLRQ :DVKSRVLWLRQRQUHDJHQWVLGH ([WUDZDVKSRVLWLRQRQUHDJHQWVLGH :DVWHSRVLWLRQRQUHDJHQWVLGH 1HHGOHFKHFNSRVLWLRQ 2XWHUVHJPHQWULQJVDPSOHFXS ,QQHUVHJPHQWULQJVDPSOHFXS 6WDWULQJVDPSOHFXS 6WGFWUOULQJ 2XWHUVHJPHQWULQJVDPSOHWXEH ,QQHUVHJPHQWULQJVDPSOHWXEH 6WDWULQJVDPSOHWXEH 5HDJHQWSODWHSRVLWLRQ &XYHWWHSRVLWLRQ &XYHWWHSRVLWLRQ &XYHWWHSRVLWLRQ &XYHWWHSRVLWLRQ &XYHWWHSRVLWLRQ &XYHWWHSRVLWLRQ &XYHWWHSRVLWLRQ &XYHWWHSRVLWLRQ &XYHWWHSRVLWLRQ &XYHWWHSRVLWLRQ &XYHWWHSRVLWLRQ &XYHWWHSRVLWLRQ &XYHWWHSRVLWLRQLQUHDJHQWGLVSHQVLQJ &XYHWWHSRVLWLRQLQUHDJHQWGLVSHQVLQJ &XYHWWHSRVLWLRQLQUHDJHQWGLVSHQVLQJ &XYHWWHSRVLWLRQLQUHDJHQWGLVSHQVLQJ &XYHWWHSRVLWLRQLQUHDJHQWGLVSHQVLQJ &XYHWWHSRVLWLRQLQUHDJHQWGLVSHQVLQJ &XYHWWHSRVLWLRQLQUHDJHQWGLVSHQVLQJ &XYHWWHSRVLWLRQLQUHDJHQWGLVSHQVLQJ &XYHWWHSRVLWLRQLQUHDJHQWGLVSHQVLQJ &XYHWWHSRVLWLRQLQUHDJHQWGLVSHQVLQJ &XYHWWHSRVLWLRQLQUHDJHQWGLVSHQVLQJ &XYHWWHSRVLWLRQLQUHDJHQWGLVSHQVLQJ .867,VHJPHQWULQJRXWHUULQJ .867,VHJPHQWULQJ .867,VHJPHQWULQJ .867,VHJPHQWULQJ .867,VHJPHQWULQJLQQHUULQJ .867,VDPSOHWUDQVIHUOLQHSRVLWLRQ November 2, 2003 48953054-4081 Konelab Service Manual 6-48 Konelab Service Manual Error Messages & Troubleshooting 48953054-4081 Version I November 2, 2003 Version I Boards 7-1 Section 7 Boards 7.1 CAN Bus..................................................................................................... page 7-3 7.1.1 CAN Hardware .......................................................................... page 7-3 7.1.2 CAN Timing ............................................................................... page 7-5 7.2 CANBIAS 3 ................................................................................................ page 7-5 7.2.1 CANBIAS3 Led Diagnostics ...................................................... page 7-7 7.3 CONN1-6 and CONN1-8 ........................................................................... page 7-1 7.4 INOUT3 ..................................................................................................... page 7-9 7.5 ISE3 and ISEAMP1 ................................................................................... page 7-11 7.6 LED1-1, LED1-2 and LED1-3 .................................................................... page 7-13 7.7 MB1-3 and MB1-9 ..................................................................................... page 7-14 7.8 MOTOR3 ................................................................................................... page 7-16 7.9 PCCAN1 .................................................................................................... page 7-18 7.10 PCCAN3 .................................................................................................. page 7-19 7.11 PHOTO3, PHOTSIG1 and PHOTREF1 .................................................. page 7-20 7.12 POWCAN3 .............................................................................................. page 7-20 7.12.1 Powcan3 Led Diagnostics of the Can Bus .............................. page 7-25 7.13 SURF1 ..................................................................................................... page 7-26 7.14 TEMP3 .................................................................................................... page 7-27 November 2, 2003 48953054-4081 Konelab Service Manual 7-2 Konelab Service Manual Boards 48953054-4081 Version I November 2, 2003 Version I Boards 7-3 In this chapter first is explained the CAN bus used in Konelab and after that in sections 7.2 - 7.14 boards in alphabetical order. Refer also to the cable chart in chapter 3. 7.1 CAN Bus Konelab uses the CAN (Controller Area Network) bus to integrate many micro controller nodes into one communication network inside an instrument. This CAN bus follows the Bosch CAN Standard 1.0. CAN bus used in Konelab is using RS-485 type transceivers in each node connected to a twin cable, and running at bit rate of 615 kbit/s. 7.1.1 CAN Hardware The essential hardware components of a CAN node for communication on the CAN bus are shown in the figure below. µC CAN controller Node ID XTAL1 16 MHz RS-485 transceiver TX1 TX0 EN RX0 RX1 R D A B CAN bus connector 30 Ω 30 Ω CANA CANB 1.4 V The micro controller (µC) reads the node identifier (Node ID) from mother board coding depending on the node board situation. Then the µC initializes the CAN controller chip, after which the node starts communication through the CAN bus. The CAN controller is an Intel 82527. A standard RS-485 transceiver chip of type "75176" is used as the physical interface to the CAN bus wires. However, the RS-485 transceiver chip should have a fast transmitter enable (EN) operation; for example, a Texas Instruments SN75ALS176 and a National Semiconductor DS96176 are suitable. The CAN controller transmits the serial bit stream of a CAN message on its TX1 pin. The initialisation prepares the output driver such that the TX1 has inverted polarity. The RS-485 transceiver is used in a special way (not the standard RS-485 way) to make the two required CAN bus states: "dominant" and "recessive". The TX1 signal is connected to the EN (enable) input of the transceiver, enabling the RS-485 transmitter to drive the data D at its input to the differential outputs A and B when EN is high, or disabling the transmitter by putting its outputs into the high impedance state when EN is low. The data input signal D of the RS-485 transmitter is grounded to hold it at constant D=0 (low). The transceiver bus signals A and B are connected through protective 30 W series resistors to the CAN bus connector. At this point the CAN bus signals are labelled CANA and CANB. A comparator in the receiver section of the RS-485 transceiver monitors the A and B pins, and outputs the received signal at the R pin as digital data (low/high) to the receive pin RX0 of the CAN controller. The receive pin RX1 of the CAN controller is held at a constant voltage RX1 = 1.4 V, providing a reference voltage to the receive input comparator of the CAN controller. The CAN signal representation at different points is given in the following tables. November 2, 2003 48953054-4081 Konelab Service Manual 7-4 Boards Version I The node itself is sending a CAN message: Logic CAN state TX1 R and RX0 Dominant or 0 1 0 (RX0 < RX1) Recessive or 1 0 1 (RX0 > RX1) RS-485 transmitter Enabled (EN=1), A=0, B=1 Disabled (EN=0) CAN bus voltages CANA < CANB CANA > CANB The node is receiving a CAN message from another node in the CAN network: Logic CAN state TX1 R and RX0 Dominant or 0 Recessive or 1 0 0 (RX0 < RX1) 0 1 (RX0 > RX1) RS-485 transmitter Disabled (EN=0) Disabled (EN=0) CAN bus voltages CANA < CANB CANA > CANB In a CAN network, the CANA and CANB signals of each node are parallel connected to a twin cable, as shown below. The network cable is terminated by 121 W resistors at both ends. Special electronics in the CAN bias block pulls the CAN bus to a proper recessive state when no node transmits a dominant signal, and provides protection against transient over voltages. Thanks to the separate CAN bias block, the CAN nodes themselves do not need an arrangement (usually a system of pull-up and pull down resistors) to effect the recessive state bus voltages. CAN node ID 0 CAN node ID 1 ... CAN node ID 126 POWCAN3 CAN node ID 124 CAN bias PCCAN1 CAN node for Master CANA 121 Ω 121 Ω CANB The network is 'a single master' -based system where the master-node sends commands to other network nodes. All nodes are constantly 'listening to' the message traffic and intercept messages based on the 11-bit CAN-message identifier included in every CAN-message. There may be up to 127 different nodes in the system besides the master node itself. Each node has an ID-number (node ID range: 0…126) of its own. This node ID forms a part of the CAN-message identifier. By including the node ID in the message identifier the master is able to address each network node (node ID) separately. Konelab Service Manual 48953054-4081 November 2, 2003 Version I Boards 7-5 7.1.2 CAN Timing The CAN bus in Konelab operates at a bit rate of 615.4 kbit/s. This bit rate corresponds to the bit time of 1.625 µs. The CAN controller is clocked from a 16 MHz clock signal at its XTAL1 input. This frequency is divided by two in the clock generator of the CAN controller, the resulting 8 MHz giving a system cycle of 0.125 µs. This system cycle is further multiplied by a baud rate prescaler to get the fundamental CAN bit timing cycle, known as the time quantum tQ (or BTL cycle, or tSCL) in the CAN terminology. The baud rate prescaler is determined by the corresponding bits loaded into the Bus_Timing_Register_0 of the CAN controller at initialisation. For the KICAN bus timing, the prescaler is set to 1, so that tQ = 0.125 µs. The other timing parameters in the Bus_Timing_Register_1 are set such that the bit time takes 13 time quanta, or 13ÞtQ = 1.625 µs, giving the bit rate of 615.4 kbit/s. 7.2 CANBIAS 3 CANBIAS3 is a support board for the CAN (Bosch Controller Area Network) bus. It contains a biasing circuit, an over voltage protection circuit and a bus signal diagnostics block for the CAN bus. CANBIAS3 is used in board racks especially in analysers that don't have internal PC (Konelab 20). In addition to CAN support it has mixer dc motor filtering and signal splitting for the RS232 from INOUT3. Refer to the cable chart in section 3. The basic job of the bias circuit is maintaining a proper voltage difference between CANA and CANB lines both in recessive (passive) and dominant (active) states.The biasing current of 15 mA with a 30W series resistor at the RS-485 driver outputs makes the recessive and dominant state voltages equal and at the optimum of 0,9V. The lines of the CAN bus are protected against over voltage transients by the transient absorbers D16 - D17 and the diodes D5 - D8. This provides sufficient protection to the system against a live board insertion with wrong order of cable connectors. However, the board whose connectors are changed in wrong order is out of protection. Power Supply The CANBIAS3 board is powered by a single supply voltage. From this voltage the board generates all other internal voltages it needs. November 2, 2003 48953054-4081 Konelab Service Manual 7-6 Boards Version I XP 7 Short leg lyhyt jalka 13 +-1 1 Revisiotarran paikka juotospuolella. Place for revision sticker. on the solder side. 48413448-4172 A Figure 7-1 THE COMPONENT LAYOUT OF CANBIAS3 Konelab Service Manual 48953054-4081 November 2, 2003 Version I Boards 7-7 7.2.1 CANBIAS3 Led Diagnostics DOM RES XP 7 CANBIAS3 STATUS LEDS DC The status of the CAN bus can be verified by 3 LEDs on the board. The LEDs are of bicolour type capable of showing green, red or orange light. The LED logic is made to get an easily interpreted indication: in OK condition LEDs are always green. In fault cases LED is red or orange, but other colour may shortly flash. Just after turning power on LEDs can be red without any faults. LED colours: HIGH - RED, OK - GREEN, LOW - ORANGE OK LOW HIGH OK HIGH LOW DOM red grn or LOW RES red grn or OK DC red grn or HIGH Most common situations. Check first the DC LED column, then RES LED column and finally the least important DOM LED column. (DOM LED blinks for bootrequest). CONDITION OF THE CAN BUS Suggested reason for failure. RS driver damage means that one board is not OK. OK, no communication X OK, communication noticed X too few termination resistors or CAN bus/wire is broken X too many termination resistors X perhaps 3 termination resistors (= 1 too much) CAN wires short circuited together continuous dominant state bus disturbance (see below) * X RS-driver damage, CAN wire short circuit to gnd or +28V rack wire failure, no communication X RS-driver damage, CAN wire short circuit to gnd X X or +28V rack wire failure, communication noticed X X RS-driver damage, no communication X X RS-driver damage, communication noticed X X +28V power supply failure Led is off , X X Led is on along to the CAN communication (blinks for bootrequest) X ,etc. Two colours for one led indicates alternative led colours * Bus disturbance (especially if it isn't continuous) may come from contact problems in the CAN connector of one node, from very heavy communication (many arbitrations) or from a disturbing (damaged) node. November 2, 2003 48953054-4081 Konelab Service Manual 7-8 7.3 Boards Version I CONN1-6 and CONN1-8 CONN1 is a connector board for cables. CONN1-6 is for six pin connectors and CONN 1-8 is for eight pin connectors. 1 7 1 XP1 7 CONN1 boards situate in Konelab 60i e.g. in the mixer arms, between cables 143 and 144 from the INOUT board in the cuvette unit, between cables 135 and 136 in the front latch, between cables 141 and 142 in the cuvette pusher, between cables 61 and 62, 59 and 60, 205 and 206, 229 and 207 in the INOUT board in the sample storage, between cables 64 and 65 in the INOUT board in the reagent storage, between cables 17 and 18, 23 and 24, 20 and 21 in the INOUT board in the incubator and dispensing units, between cables 4 and 242 in the measurement channel, between cables 77 and 241 in the lamp house. Refer to the cable chart in section 3. XP2 Figure 7-2 THE COMPONENT LAYOUT OF CONN1-6 XP1 XP2 Figure 7-3 THE COMPONENT LAYOUT OF CONN1-8 Konelab Service Manual 48953054-4081 November 2, 2003 Version I 7.4 Boards 7-9 INOUT3 INOUT3 is an intelligent input / output (I/O) control board. It fulfils high level commands received from MASTER via CAN bus. The board's CAN bus and power is wired and pcb id-number selected via motherboard. The board can be divided into basic functions as follows: • Micro controller & CAN environment for real-time control. • Inputs of motion limit switches (reflective opto sensors, slotted optical switches mechanical (micro switches etc.)) that do not necessarily have to be connected to the appropriate motor controller (MOTOR3). • Level detector inputs of waste & water containers (analogue inputs) the signal is needed since the user must be alerted of the need to add water to or empty a container. • User panel interface - for LEDs that are needed to indicate when the user can add cuvettes, samples etc. • RS232 interface for bar code reader that are embedded in the analyser for automated reagent and sample entry. Note that RS232 interface does not provide ±12V for bar code reader, +5V supply is not intended to laser bar code readers (max continuous current 0,3A). Note that capacitive liquid level detection (needles) is done with the SURF1 board, interfaced to the MOTOR3 board and position feedback encoder input is interfaced only on the MOTOR3 board. November 2, 2003 48953054-4081 Konelab Service Manual 7-10 Boards Version I Figure 7-4 THE COMPONENT LAYOUT OF INOUT3 Konelab Service Manual 48953054-4081 November 2, 2003 Version I 7.5 Boards 7-11 ISE3 and ISEAMP1 ISE3 and ISEAMP1 boards belong to ISE unit of Konelab models 60i and 30i. The ISE3 board is an intelligent board including the micro controller to control different processes and the CAN interface for data transfer. ISE3 board's CAN bus and power is wired and pcb id-number selected via motherboard. The ISEAMP board has preamplifiers, a multiplexer and a differential amplifier. It also performs liquid detection. The ISE board processes the amplified signals coming from the ISEAMP board. It has a 20-bit A/ D converter. Furthermore the ISE board controls and measures the liquid detection. Signal proceeding: A/D converting: Voltage range: Linearity: Liquid detection: Differential outputs for signal and voltage reference from the ISEAMP board to the A/D converter. Sequentially, one SD-type A/D converter is measuring channels multiplexed in the preamplifier. -200…+635 mV at electrodes -2.5 …+ 2.5 V at ISE3 input At least 16 bits (total error referred to the electrode max 15 µV) Measurement of 1 kHz alternating voltage, the result is A/D converted. Impedance limit is fitted according to the block. MOTOR boards are controlling the syringe and the pump of the ISE unit. The TEMP board is controlling incubation. Figure 7-5 THE COMPONENT LAYOUT OF ISEAMP1 November 2, 2003 48953054-4081 Konelab Service Manual 7-12 Boards Version I Figure 7-6 THE COMPONENT LAYOUT OF ISE3 Konelab Service Manual 48953054-4081 November 2, 2003 Version I 7.6 Boards 7-13 LED1-1, LED1-2 and LED1-3 LED1 board is for LEDs used in the analyser. LED1-1 is for one bicolour LED. LED1-1 is used in the STAT insert cover and in the reagent insert cover. LED1-2 is for two LEDs. LED1-2 is used in the segment insert cover and in the cuvette loader. LED1-3 is similar to LED1-2 (except green and red are vice versa) and used in the cuvette loader in Konelab 20. To see the positions of LED boards refer to cable chart page 3-24. XP2 D3 12 +-1 XP3 XP1 Short leg Figure 7-7 THE COMPONENT LAYOUT OF LED1-1 XP2 D1 C XP3 XP1 D2 12 +-1 Cathode Figure 7-8 THE COMPONENT LAYOUT OF LED1-2 AND LED1-3 November 2, 2003 48953054-4081 Konelab Service Manual 7-14 7.7 Boards Version I MB1-3 and MB1-9 The motherboard MB1 is a two-layer board placed in the electronic rack back panel. It is holding the power supply +28V and the CAN bus connection and ID-selection of boards. In the beginning of ID, 4 bits are according to the motherboard number and at the end of ID, 4 bits are according to the position of the board. CAN bus connectors are in the both end of the board. The board has no terminal resistors for the CAN bus. The three slot motherboard is named as MB1-3 and respectively the nine slot motherboard is named as MB1-9. Figure 7-9 THE COMPONENT LAYOUT OF MB1-3 Konelab Service Manual 48953054-4081 November 2, 2003 Version I Boards 7-15 Figure 7-10 THE COMPONENT LAYOUT OF MB1-9 November 2, 2003 48953054-4081 Konelab Service Manual 7-16 7.8 Boards Version I MOTOR3 The MOTOR3 board is an intelligent motor control board for one stepper motor. Its micro controller fulfils specified commands received from master via CAN bus. CAN bus and power wired and pcb id-number selected via motherboard. Interface for - 3 (optical or other) limit switches (OPB 980 series), - one 2-channel incremental opto encoder for position feedback purposes, e.g. HEDS-5000 series or interface for liquid surface detector board (SURF1). Motor control characteristics SW controlled motor drive, basic use: bipolar, two phase drive. Motor types: Stepper motors Motor range: 2 º 100 W, up to 2 A / phase (under certain conditions) +28 VDC Motor drive resolution: up to 500 (m)steps / step (depending on motor type) Motor drive velocity: up to 5000 pulses / s Motor wiring: 4 or 8 wire motors, parallel or series connection Konelab Service Manual 48953054-4081 November 2, 2003 Version I Boards 7-17 Figure 7-11 THE COMPONENT LAYOUT OF MOTOR3 November 2, 2003 48953054-4081 Konelab Service Manual 7-18 7.9 Boards Version I PCCAN1 The PCCAN1 board is a CAN board connected to the mother board of the internal PC with 8 bit ISA bus connection. The internal PC is the master of Konelab analyser. The PCCAN1 board is in the other end of the CAN bus and connected to it. When the message is coming from the CAN bus there is the INT tag in the CAN driver which interrupts the PC. The PCCAN1 board has a terminal resistance of 120 W for the CAN bus and it is shielded against the voltage disturbances caused by connections of boards in the CAN bus. Figure 7-12 THE COMPONENT LAYOUT OF PCCAN1 Konelab Service Manual 48953054-4081 November 2, 2003 Version I 7.10 Boards 7-19 PCCAN3 The PCCAN3 card is a PCI-bus based add-on card for PC-computer, that is used for CAN (Controller Area Network) protocol data communication. The card consists of PCI-bus target interface (Xilinx FPGA with LogiCORE PCI32), Intel Full-CAN controller (82527), and CAN physical layer driver circuit (75176). Figure 7-13 THE COMPONENT LAYOUT OF PCCAN3 November 2, 2003 48953054-4081 Konelab Service Manual 7-20 7.11 Boards Version I PHOTO3, PHOTSIG1 and PHOTREF1 The PHOTO3 board is an intelligent board for controlling the photometer. It includes the micro controller to control different processes and the CAN interface for data transfer. The photometric functions provided by the PHOTO3 electronics include a lamp power supply, a chopper motor drive, and light detector signal conditioning with AD conversion. Different wavelengths for absorbance measurements are selected by moving the corresponding interference filter into the filter location in the light path. Because the filter wheel, along whose periphery the filters lie, is rotated by a stepper motor, the filter change function is provided by its own stepper motor drive node. The PHOTO3 lamp power supply is a regulated voltage source for the photometer lamp, designed to drive a halogen lamp with 6 V nominal voltage and 20 W power consumption. The chopper motor driver is meant to drive a DC motor that rotates a light chopper disk. The chopping frequency is specified at fCHOP = 200 Hz, and is determined by the reference frequency (2 fCHOP = 400 Hz) input to the phase detector in the ASIC. Refer to block diagram below. To connect the optics of the photometer to the PHOTO3 board there are two preamplifiers for detectors: PHOTSIG1 for the signal detector and PHOTREF1 for the reference detector. POWER ADDRESS / DATA BUS -CSCAN µC ASIC Chip Select ADDRESS / DATA CAN Osc EEPROM -CSCAN -RD -WR -RD, -WR, ALE Port P1 Clock Divider 1 -CSRAM -ADREADH -ADREADL -CSRAM -RD, -WR Gain Register RAM 12 MHz MOTOK LAMPCURR ADBUSY CHOPSYNCD Clock Divider 2 ACH4 ACH5 PWM HSI0 HSI1 HSO0 HSO1 Channel Select Register 400 Hz 3 MHz LPWM ADINH ADCAL Phase Detector Delay Register Delay 3 MHz ADINH CHOPSYNCD ADC Timing PHASEDETOUT ADIN0 ADSAMPLE ADCLK CHOPSYNCD LPWM LPWM LAMPCURR LAMP POWER MOTOK CHOPSYNC LAMPCURR T U O T E D E S A H P ADBUSY CHS ADCAL PGA LPF MOTOK ADIN0 ADIN1 MUX CHOPPE MOTOR R DRIVER ADBUSY ADC Data Buffer OPTOSWITC INPUT H CHOPSYNC CHR PGA LPF Figure 7-14 THE BLOCK DIAGRAM OF PHOTO3 Konelab Service Manual 48953054-4081 November 2, 2003 Version I Boards R7 R8 7-21 R9 R1 C5 R2 R12 R16 R15 R3 R13 R4 R5 R6 U1 U2 U3 R17 C5 R11 R14 C4 R10 C2 R18 + C3 + C1 L1 L2 JUMPER JP2 JP1 XP1 TP1 TP2 Figure 7-15 THE COMPONENT LAYOUT OF PHOTSIG1 R7 R8 R9 R2 R12 R16 R15 R3 R13 R4 R5 C5 R1 R6 U1 U2 U3 R17 C5 R11 R14 C4 R18 + C3 L1 R10 C2 + C1 L2 JP2 XP1 TP1 JP1 TP2 Figure 7-16 THE COMPONENT LAYOUT OF PHOTREF1 November 2, 2003 48953054-4081 Konelab Service Manual 7-22 Boards Version I 1 1 Solder together. R106 The middle pin (GDN) of LC1 .must be as short as possible. LC1 Cut pins 5 and 6 of XP8. Figure 7-17 THE COMPONENT LAYOUT OF PHOTO3 Konelab Service Manual 48953054-4081 November 2, 2003 Version I 7.12 Boards 7-23 POWCAN3 POWCAN3 is an intelligent power supply management and CAN bus support board. It fulfils high level commands received from MASTER via CAN bus.The board can be divided into basic functions as follows: • Micro controller & CAN environment for real-time control. • Power supply ±5V and ±12V for Master PC motherboard and ±15V for CAN biasing circuit. • CAN bus biasing (status state feeds through CAN bus to Master, status indication also by LED which is needed when CAN bus transfer fails) and CAN bus protection. • Battery management: back up battery charging, back up battery management, +28V during power fail and status of power supply to Master. • Cooling unit: two control channels with one thermistor per channel, switched mode control for output current (switched mode current drive for peltiers). Controlling cooling on/off, temperature set value and temperature measured value. Diagnosing thermistor fail and output fail. November 2, 2003 48953054-4081 Konelab Service Manual 7-24 Boards Version I 1 1 1 1 1 1 Figure 7-18 THE COMPONENT LAYOUT OF POWCAN3 Konelab Service Manual 48953054-4081 November 2, 2003 Version I Boards 7-25 7.12.1 Powcan3 Led Diagnostics of the Can Bus The status of the CAN bus can be verified by 9 LEDs on the POWCAN3 board. - DC_HIGH, DC_OK and DC_LOW signals indicate the average voltage of the CAN bus. - RES_HIGH, RES_OK and RES_LOW form the recessive state status. - DOM_HIGH, DOM_OK and DOM_LOW form the dominant state status. The most common situations of the CAN bus are listed below. In the table "1" means that this LED is lit. "X" means that this LED may be on or off. Leds in the table are in the same order than on the POWCAN3 board. Check first the appropriate table area according to the DC LEDs group, then for RES LEDs group and finally for the least important group DOM LEDs. '20 +,*+ '20 2. '20 /2: 5(6 +,*+ 5(6 2. 5(6 /2: '& +,*+ '& 2. '& /2: UHG JUHHQ UHG UHG JUHHQ UHG UHG JUHHQ UHG ; ; ; ; ; ; &21',7,21 2) 7+(&$1%86 6XJJHVWHGUHDVRQIRUIDLOXUH 2.QRFRPPXQLFDWLRQ 2.FRPPXQLFDWLRQQRWLFHG WRRIHZWHUPLQDWLRQUHVLVWRUVRU &$1EXVZLUHLVEURNHQ WRRPDQ\WHUPLQDWLRQUHVLVWRUV SHUKDSVWHUPLQDWLRQUHVLVWRUV &$1ZLUHVVKRUWFLUFXLWHGWRJHWKHU FRQWLQXRXVGRPLQDQWVWDWH EXVGLVWXUEDQFHVHHEHORZ 56GULYHUGDPDJH&$1ZLUHVKRUW FLUFXLWWRJQGRU9UDFNZLUH IDLOXUHQRFRPPXQLFDWLRQ 56GULYHUGDPDJH&$1ZLUHVKRUW FLUFXLWWRJQGRU9UDFNZLUH IDLOXUHFRPPXQLFDWLRQQRWLFHG 56GULYHUGDPDJHQR FRPPXQLFDWLRQ 56GULYHUGDPDJHFRPPXQLFDWLRQ QRWLFHG 9SRZHUVXSSO\IDLOXUH *) Bus disturbance (especially if it isn't continuous) may come from contact problems in the CAN connector of one node, from very heavy communication (many arbitrations) or from a disturbing node. Especially when status LEDs indicate DC LOW or DC HIGH it is good to measure the voltages of CANA and CANB signals by multimeter. Normally CANA is about +2,9V and about CANB +2,1V. Short circuits to ground are easy to find this way. In many fault conditions CAN communication is possible with an increased amount of errors. However, if any fault is observed some action must be taken. November 2, 2003 48953054-4081 Konelab Service Manual 7-26 7.13 Boards Version I SURF1 SURF1 is a board on the dispenser arm intended for liquid surface detection. It utilises a method where a capacitance change causes amplitude modulation in the RC-circuit to which the dispenser needle belongs. The capacitance change is caused by the needle hitting the liquid surface thus facing a different dielectric constant. The analog signal is conducted to the MOTOR3 board where it is converted to digital. Functions of the board include: • liquid surface detection of the dispenser arm for sample, reagent and washing • connection for the measurement thermistor and heating resistor for ISE dispenser arm temperature control • dispenser arm safety switch interface Figure 7-19 THE COMPONENT LAYOUT OF SURF1 Konelab Service Manual 48953054-4081 November 2, 2003 Version I 7.14 Boards 7-27 TEMP3 TEMP3 is an intelligent temperature controller board. It contains a CAN bus interface for communication with the analyser central processor and a micro controller for taking care of both the external communication and drive functions for 2 PWM (pulse width modulation) channels. The board's CAN bus and power is wired and pcb id-number selected via motherboard. • Two channels for temperature control used in the incubator , in the measurement channel and in the ISE arm. • Six thermistor inputs for temperature control loops and other measurement. • Optional connection for driving Peltiers via additional board. • Diagnostic features for thermistor and heating elements open or short circuits. November 2, 2003 48953054-4081 Konelab Service Manual 7-28 Boards Version I XP6, C6, C68 ei kalusteta, not used Figure 7-20 THE COMPONENT LAYOUT OF TEMP3 Konelab Service Manual 48953054-4081 November 2, 2003 Version I Spare Parts & Consumables Section 8 8-1 Spare Parts & Consumables 8.1 Spare Parts........................................................................................................... 8-3 8.2 Units ..................................................................................................................... 8-4 8.3 PC-Boards ............................................................................................................ 8-4 8.4 Motors................................................................................................................... 8-5 8.5 Cables .................................................................................................................. 8-5 8.6 Service Accessories ............................................................................................. 8-5 8.7 Instructions for Motors and Belts .......................................................................... 8-6 8.8 List of Accessories and Consumables.................................................................. 8-7 8.9 Contents of the Kits .............................................................................................. 8-9 8.10 Adjusting Tool Set for Konelab ........................................................................... 8-11 8.11 Recommended parts of Service-Pack for all Konelab models............................ 8-12 November 2, 2003 48953054-4081 Konelab Service Manual 8-2 Konelab Service Manual Spare Parts & Consumables 48953054-4081 Version I November 2, 2003 Version I Spare Parts & Consumables 8-3 63$5(3$576 &2'( November 2, 2003 ,7(0 %DUFRGHUHDGHU %HOWGLVSPHDVFKDQQHOPP %HOWGLVSPRWRUXQLWILLURWDWXQLWPP %HOWGLVS0RWRUXQLW<PP %HOWGULYLQJXQLWLQFXEXQLWPP %HOWFXY3XVKHUPP %HOWLQFXEDWRUXQLWPP %HOWPHDVXUHPHQWFKDQQHOPP %HOWPRYHUXQLWPP &RYHUPDLQ &RYHUPDLQ &RYHUPDLQ &XYHWWHDUP &XYHWWHDUP )DQ'&9: )HHGEDFNVHQVRUZLWKKROGHU )LEHURSWLFVPPNXVWL )LEHURSWLFVPP )XVH$ )XVH$ *DVF\OLQGHU1 *DVF\OLQGHU1 ,QWHUI)LOWHUQP ,QWHUI)LOWHUQP ,QWHUI)LOWHUQP ,QWHUI)LOWHUQP ,QWHUI)LOWHUQP ,QWHUI)LOWHUQP ,QWHUI)LOWHUQP ,QWHUI)LOWHUQP ,QWHUI)LOWHUQP ,QWHUI)LOWHUQP ,QWHUI)LOWHUQP ,QWHUI)LOWHUQP ,QWHUI)LOWHUQP 3HOWLHUWKHUPLVWRUVHWUHDJHQWWUD\ 3HOWLHUWKHUPLVWRUVHWVDPSOHWUD\ 6XUIDFHGHWHFWRU'LOXHQW 6XUIDFHGHWHFWRUZDVWH :DVKLQJXQLWGLVSHQVHU 48953054-4081 .O ; .O ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; .O ; ; ; ; ; ; .867, ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; Konelab Service Manual 8-4 Spare Parts & Consumables Version I 81,76 &2'( ,7(0 &KDQQHOGLVSHQVLQJXQLW &KDQQHOPHDVXULQJXQLW &RROLQJXQLW &XYHWWHIHHGHUXQLW &XYHWWHORDGHUXQLW &XYHWWHPDJD]LQH &XYHWWHPRYHUXQLW &XYHWWHSXVKHUXQLW &XYHWWHURWDWLRQXQLW 'LVSPRWRUXQLWZLWKRXWIHHGEDFN VHQVRU ,QFXEDWRUGLVN ,QFXEDWRUXQLW ,QWHUQDO3&NLW 3RZHUXQLW: 3RZHUXQLW: 3RZHUXQLW: 6\ULQJHXQLW 6\ULQJHXQLW .O .O ; ; ; ; ; ; ; ; ; .O ; ; .867, ; ; ; ; ; ; ; ; ; ; ; ; ; .O .O ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; 3&%2$5'6 &2'( Konelab Service Manual ,7(0 &$1%,$6 &211(&7,21%2$5' &211(&7,21%2$5' ,1287 ,6( ,6($03 /(' 0%$ 0%$ 02725 3+272 3+275() 3+276,* 32:&$1 685)$ 7(03 48953054-4081 .O ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; .867, ; November 2, 2003 Version I Spare Parts & Consumables 8-5 027256 &2'( ,7(0 )0,µOSXPS 0RWRU$ 0RWRU$ 0RWRU$GRXEOHVKDIW 0RWRU$ 0RWRU'&FKRSSHU 0RWRUODWFK 0RWRUPL[HU 0RWRUPL[HU 0RWRUSRZHUPD[ 3HULVWDOWLFSXPS 3HULVWDOWLFSXPS .O ; ; ; ; ; ; ; .O ; ; ; ; ; ; .O ; ; ; ; ; ; ; ; ; ; ; ; .O .O ; ; ; ; ; ; ; .867, ; ; ; &$%/(6 WKHUPLVWRUQRWLQFOXGHG &2'( ,7(0 ([WHQVLRQIRUODWFKPRWRUPP ([WHQVLRQIRURSWRPP ([WHQVLRQIRURSWRPP *URXQGZLUHPP +HDWLQJEORFNFDEOH,6( +HDWLQJGLVSPHDVFKDQQHOV +HDWLQJIRLOUHVLVWRU +HDWLQJLQFXEDWRUXQLW ,6($03²,6( 0,;(5²02725 2SWRFDEOHPP 2SWRGLVSHQVHUWLOW 2SWRPL[HU 2SWRUHIOHFWLYHVHQVRU 2SWRZLGHFDEOHPP 685)02725 685)02725&$1%,$6 685)027257(03,6( 7(03)RLOUHVLVWRUFDEOH 7KHUPLVWRUPP .O ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; .867, ; ; ; ; ; ; 6(59,&($&&(6625,(6 &2'( November 2, 2003 ,7(0 $GMXVWLQJWRROVHW /LWKLXPJUHDVHJ /XEULFDWLRQRLOVLOLFRQPO 6LOLFRQSDVWHIRUSHOWLHUVJ 48953054-4081 Konelab Service Manual 8-6 Spare Parts & Consumables Version I ,16758&7,216)25027256 $1'%(/76 027256 %(/76 Konelab Service Manual 0RWRU$ 'LVSHQVHU0L[HUPRWRUXQLW<YHUWLFDO ,QFXEDWRUXQLW 0HDVXULQJFKDQQHO &XYHWWHPRYHU &XYHWWHSXVKHU $// .. ..ZLWKRXWIHHGEDFN . . 0RWRU'6$ 'LVSHQVHU0L[HUPRWRUXQLW),,KRUL]RQWDO 0HDVXULQJFKDQQHO )LOWHUZKHHO $// .;WDQG.ZLWKIHHGEDFN $// 0RWRU$ 6HJPHQWORDGHU 0HDVXULQJFKDQQHO 3HULVWDOWLFSXPS 'LVSHQVLQJFKDQQHO .. . .. . 0RWRU$ 'ULYLQJXQLW5HDJHQW6DPSOHGLVN ,QFXEDWRUGLVN $// . 0RWRU3RZHUPD[ 5RWDWLRQXQLW 6\ULQJHXQLW . .. %HOWPP 0RYHUXQLW . %HOWPP ,QFXEDWRUXQLW .DQG. %HOWPP 0HDVXULQJFKDQQHO .DQG. %HOWPP 'ULYLQJXQLW5HDJHQW6DPSOHGLVN ,QFXEDWRUGLVN $// . %HOWPP 'LVSHQVLQJFKDQQHOV 0HDVXULQJFKDQQHO . . %HOWPP 'LVSHQVHU0L[HUPRWRUXQLW<YHUWLFDO $// %HOWPP 'LVSHQVHUPRWRU0L[HUXQLW),,KRUL]RQWDO 5RWDWLRQXQLW $// . %HOWPP &XYHWWHSXVKHUXQLW . 48953054-4081 November 2, 2003 Version I Spare Parts & Consumables 8-7 /,672)$&&(6625,(6$1' &21680$%/(6 November 2, 2003 &2'( 67$57830$,17(1$1&(.,76 6WDUWXSNLWIRU.ODQG 6WDUWXSNLWIRU.O ,6(6WDUWXSNLW1D.&OIRU.OLDQGL ,6(6WDUWXSNLW1D.&OIRU.OL 0RQWKV0DLQWHQDQFHNLWIRU.RQHODEDQGL 0RQWKV0DLQWHQDQFHNLWIRU.RQHODEDQGL 0RQWKV0DLQWHQDQFHNLWIRU.RQHODEDQGL 0RQWKV,6(&RPSOHWHWXELQJIRU.OL 0RQWKV,6(&RPSOHWHWXELQJIRU.OLDQGL 0RQWKV0DLQWHQDQFHNLWIRU.RQHODEDQGL 0RQWKV0DLQWHQDQFHNLWIRU.RQHODEDQGL 0RQWKV0DLQWHQDQFHNLWIRU.RQHODEDQGL 0RQWKV,6('LVSHQVHUNLWIRU.OL 0RQWKV,6('LVSHQVHUNLWIRU.OLDQGL 0RQWKV.867,0DLQWHQDQFHNLW ,QVWUXPHQWDFFXUDF\WHVWLQJNLW ,6(RSWLRQNLWIRU.ODQG.O ,6(RSWLRQNLWIRU.O &2'( &21680$%/(6 $FU\OLFPXOWLFHOOFXYHWWH[SFV )0,3XPSWXEHV 'LOXHQWDQGZDVKWXEHVIRU.RQHODE 'LOXHQWDQGZDVKWXEHVIRU.RQHODE 'LOXHQWDQGZDVKWXEHVIRU.RQHODE 'UDLQZDVWHWXEHVIRU.O 'UDLQZDVWHWXEHVIRU.ODQG +DORJHQODPS(0&PRGHO ,6(&RPSOHWHWXELQJIRU.OL ,6(&RPSOHWHWXELQJIRU.OLDQGL .867,&RPSOHWHWXELQJ 0L[LQJSDGGOH 'LVSHQVLQJQHHGOHUHDJHQWVDPSOH 'LVSHQVLQJQHHGOH,6( 'LVSHQVLQJQHHGOH.867, 3LVWRQIRUOV\ULQJH 3XPSWXEHIRU.RQHODE,6(:DVKSFV 3XPSWXEH39&[JUH\JUH\ 3XPSWXEH,60$35(1([OLODFOLODF 5HDJHQWERWWOHPOSFV 5HDJHQWYHVVHOPOSFV 5HDJHQWYHVVHOPOSFV 6DPSOHFXSPOSFV 6DPSOHFXSPOSFV 6HJPHQWKROGHU.867,SF 6\ULQJHOJULSIL[IRU.O 48953054-4081 Konelab Service Manual 8-8 Spare Parts & Consumables 6\ULQJHOIRU.ODQG :DVWHGLOXHQWFDQLVWHUSF &2'( $&&(6625,(6 $GDSWHUVIRUPOUHDJHQWWXEHVSFV 6RIWZDUHIRUZRUNVWDWLRQDQGLQWHUQDO3& 3ULQWHU(SVRQ/; 3ULQWHUFDEOHP 2QOLQHFDEOHP 3LFNXSWRROIRUVDPSOHFXSV 3LFNXSWRROIRUSULPDU\WXEHV 5HDJHQWGLVNSRV 6DPSOHVHJPHQWIRUDQGPOWXEHV 6DPSOHVHJPHQWIRUPOWXEHV 6DPSOHVHJPHQWIRU.867, 6DPSOHGLVNIRUPOWXEHV %DUFRGHODEHOVIRUVDPSOHVHJPHQWVDQGVDPSOHGLVN 7RROIRUWXEHSRVLWLRQLQJ &2'( (/(&752'(6 5HIHUHQFHHOHFWURGH .0DLQWHQDQFHIUHHPLFURYROXPHHOHFWURGH 1D0DLQWHQDQFHIUHHPLFURYROXPHHOHFWURGH /L0DLQWHQDQFHIUHHPLFURYROXPHHOHFWURGH &D0DLQWHQDQFHIUHHPLFURYROXPHHOHFWURGH S+0DLQWHQDQFHIUHHPLFURYROXPHHOHFWURGH &O0DLQWHQDQFHIUHHPLFURYROXPHHOHFWURGH (QGVOLFHVLQDQGRXW &2'( ,6(62/87,216 ,6(&DOLEUDWRUVROXWLRQ[PO ,6(&DOLEUDWRUVROXWLRQV[PO[PO ,6(&DOLEUDWRUVROXWLRQ[PO :DVKLQJVROXWLRQ[PO 5HIHUHQFHHOHFWURGHVROXWLRQPO Konelab Service Manual 48953054-4081 Version I November 2, 2003 Version I Spare Parts & Consumables 8-9 &217(1762)7+(.,76 67$5783.,7IRU.O $FU\OLFPXOWLFHOOFXYHWWH[SFV 6DPSOHFXSPOSFV 5HDJHQWERWWOHPOSFV +DORJHQODPS 3XPSWXEH,6(:DVK :DVKLQJVROXWLRQ[PO SF SF SF SF SFV SFV 67$5783.,7IRU.O $FU\OLFPXOWLFHOOFXYHWWH[SFV 6DPSOHFXSPOSFV 5HDJHQWERWWOHPOSFV +DORJHQODPS 3XPSWXEH,60$35(1([OLODFOLODF :DVKLQJVROXWLRQ[PO SF SF SF SF SF SFV ,6(67$5783.,71D.&OIRU.OL 5HIHUHQFHHOHFWURGH .0DLQWHQDQFHIUHHPLFURYROXPHHOHFWURGH 1D0DLQWHQDQFHIUHHPLFURYROXPHHOHFWURGH &O0DLQWHQDQFHIUHHPLFURYROXPHHOHFWURGH ,6(&DOLEUDWRUVROXWLRQ[PO ,6(&DOLEUDWRUVROXWLRQV[PO[PO 3XPSWXEH,6(:DVK :DVKLQJVROXWLRQ[PO SF SF SF SF SF SF SFV SF ,6(67$5783.,71D.&OIRU.OLDQGL 5HIHUHQFHHOHFWURGH .0DLQWHQDQFHIUHHPLFURYROXPHHOHFWURGH 1D0DLQWHQDQFHIUHHPLFURYROXPHHOHFWURGH &O0DLQWHQDQFHIUHHPLFURYROXPHHOHFWURGH ,6(&DOLEUDWRUVROXWLRQ[PO ,6(&DOLEUDWRUVROXWLRQV[PO[PO 3XPSWXEH39&[*UH\*UH\ 3XPSWXEH,60$35(1([OLODFOLODF :DVKLQJVROXWLRQ[PO SF SF SF SF SF SF SF SF SF 0217+60$,17(1$1&(.,7)25.21(/$%$1' L 'LOXHQWDQGZDVKWXEHV SF November 2, 2003 0217+60$,17(1$1&(.,7)25.21(/$%$1' L 'LOXHQWDQGZDVKWXEHV SF 0217+60$,17(1$1&(.,7)25.21(/$%$1' L 'LOXHQWDQGZDVKWXEHV SF 48953054-4081 Konelab Service Manual 8-10 Spare Parts & Consumables Version I 0217+6,6(&RPSOHWHWXELQJIRU.RQHODEL ,6(7XELQJNLWIRU.OL 0217+6,6(&RPSOHWHWXELQJIRU.RQHODELDQGL 0217+60$,17(1$1&(.,7)25.21(/$% $1'L 6\ULQJHOJULSIL[ 'LVSHQVLQJQHHGOHUHDJHQWVDPSOH 'LOXHQWDQGZDVKWXEHV 'UDLQZDVWHWXEHV +DORJHQODPS SF SF SF SF SF 0217+60$,17(1$1&(.,7)25.21(/$% $1'L 6\ULQJHO 'LVSHQVLQJQHHGOHUHDJHQWVDPSOH 'LOXHQWDQGZDVKWXEHV 'UDLQZDVWHWXEHV +DORJHQODPS 0L[LQJSDGGOH SF SF SF SF SF SF 0217+60$,17(1$1&(.,7)25.21(/$% $1'L 6\ULQJHO 'LVSHQVLQJQHHGOHUHDJHQWVDPSOH 'LOXHQWDQGZDVKWXEHV 'UDLQZDVWHWXEHV +DORJHQODPS 0L[LQJSDGGOH SFV SFV SF SF SF SFV 0217+6,6(0$,17(1$1&(.,7IRU.RQHODEL ,6(&RPSOHWHWXELQJNLW 'LVSHQVLQJQHHGOH,6( SF SF 0217+6,6(0$,17(1$&(.,7IRU.RQHODELDQG L ,6(&RPSOHWHWXELQJ 'LVSHQVLQJQHHGOH,6( 6\ULQJHO SF SF SF 0217+6.867,0$,17(1$1&(.,7 'LVSHQVLQJQHHGOH.867, 7XELQJNLW.867, SF SF ,167580(17$&&85$&<7(67,1*.,7 $FFXUDF\6ROXWLRQNLW $FFXUDF\WHVWSURFHGXUH±GHVFULSWLRQ SF SF Konelab Service Manual 48953054-4081 November 2, 2003 Version I Spare Parts & Consumables 8-11 $'-867,1*722/6(7)25 .21(/$% 2UGHULQJFRGH LQFOXGHVRQHSLHFHRIWKHIROORZLQJLWHPV &URVVKDLUFXYHWWHFRGH IRUPHDVVDPSOHUHDJXQLWDUPPHFKDQLFDOKHLJKW DGMXVWPHQW 0HWDOFXYHWWHFRGH IRUFXYHWWHDUPLQFXEDWRUFXYORDGHUPHFKDQLFDO DGM )HHOHUJDXJHPPFRGH EHWZHHQLQFXEFXYORDGHUEDFNZDOODQGFXYHWWH &XYHWWHORDGHUPHFKDQLFDODGMXVWLQJWRRO FRGHIRU.RQHODEL 5HIOHFWLQJRSWRDGMXVWPHQWWRRO FRGH November 2, 2003 48953054-4081 Konelab Service Manual 8-12 Spare Parts & Consumables Version I 5HFRPPHQGHGSDUWVRIVHUYLFHSDFN IRUDOO.RQHODEPRGHOV ,QFOXGLQJ,6(DQG.867,PRGHOV WXEHVQHHGOHVSDGGOHVV\ULQJHVHWFQRWLQFOXGHG6HHDFFHVVRULHV FRQVXPDEOHVOLVW 3$576 &XYHWWHDUP.. &XYHWWHDUP. '&PRWRU&+233(5 )HHGEDFNVHQVRUZLWKKROGHU 0RWRUODWFK. 0RWRUPL[HU.. 2SWLFDOILEHUPP ...XVWL 3HOWLHUWKHUPLVWRUVHWUHDJHQWWUD\. 3HOWLHUWKHUPLVWRUVHWVDPSOHWUD\. 6XUIDFHGHWHFWRUGLOXHQW &$%/(6 *URXQGZLUHPP (WKHUQHW&DQFDEOHZRUNVWDWLRQNRQHODE ([WHQVLRQFDEOHIRUPRWRUPP ([WHQVLRQFDEOHIRUPRWRUPP ([WHQVLRQFDEOHIRURSWRPP ([WHQVLRQFDEOHIRURSWRPP +HDWFDEOHPHDVGLVSFKDQQHO. WKHUPLVWRUQRWLQFOXGHG +HDWFDEOHLQNXE.. WKHUPLVWRUQRWLQFOXGHG 7HPS)RLOUHVLVWRUFDEOHLQNXEGLVN. WKHUPLVWRUQRWLQFOXGHG ,6($03,6( 0L[HUDUPPRWRU 2SWRUHIOHFWLYH 2SWRGLVSHQVHWLOW 2SWRPL[HU 2SWRFDEOHPP 2SWRZLGHFDEOHPP 6XUIPRWRUFDQELDV. 6XUIPRWRU.. 6XUIPRWRUWHPS,6( 7KHUPLVWRUPP Konelab Service Manual 48953054-4081 November 2, 2003 Version I Spare Parts & Consumables 8-13 %2$5'6 &RQQHFWLRQERDUG &RQQHFWLRQERDUG &$1%,$6 ,1287 ,6( ,6($03 02725 3+272 3+2725() 3+2726,* 32:&$1 685)$ 7(03 $&&(6625,(6 /XEULFDWLRQRLOVLOLFRQ 6LOLFRQSDVWH /LWKLXPJUHDVHJ November 2, 2003 48953054-4081 Konelab Service Manual 8-14 Konelab Service Manual Spare Parts & Consumables 48953054-4081 Version I November 2, 2003 Version I Installation Instructions 9-1 Section 9 Installation Instructions 9.1 Unpacking............................................................................................................. page 9-3 9.2 Location ................................................................................................................ page 9-4 9.3 Set Up................................................................................................................... page 9-5 9.4 Workstation........................................................................................................... page 9-7 9.4.1 Preparing for Use a New Dell PC with Windows NT ............................... page 9-7 9.4.2 Workstation Configuration ....................................................................... page 9-9 9.4.2.1 General ........................................................ page 9-9 9.4.2.2 Installing Network......................................... page 9-9 9.4.2.3 Set Regional Settings .................................. page 9-10 9.4.2.4 Set Up Display ............................................. page 9-10 9.4.2.5 Adjust Display .............................................. page 9-10 9.4.2.6 Set Up Printer .............................................. page 9-11 9.4.2.7 Checking Available Display Memory............ page 9-12 9.5 Konelab Software Installation ............................................................................... page 9-12 9.5.1 Installing Konelab and Objectivity/DB...................................................... page 9-12 9.5.2 Create User Konelab ............................................................................... page 9-13 9.5.3 Setting Konelab Application .................................................................... page 9-13 9.5.4 Login as User Konelab ............................................................................ page 9-13 9.5.5 Set Regional Settings.............................................................................. page 9-13 9.6 Konelab Configuration .......................................................................................... page 9-14 9.6.1 LIMS Configuration.................................................................................. page 9-16 9.7 ISE Set Up............................................................................................................ page 9-18 9.7.1 Material.................................................................................................... page 9-18 9.7.2 Installation ............................................................................................... page 9-19 9.8 How to Tailor Tests............................................................................................... page 9-24 November 2, 2003 48953054-4081 Konelab Service Manual 9-2 Konelab Service Manual Installation Instructions 48953054-4081 Version I November 2, 2003 Version I Installation Instructions 9-3 813$&.,1* .RQHODEDQGLWVDFFHVVRULHVDUHVKLSSHGLQWKUHHFRQWDLQHUVRQHLQFOXGHVWKH DQDO\VHUWKHRWKHU3&DQGWKHWKLUGRQHWDEOHIRUWKH3& Þ&KHFNWKHSDFNDJHIURPWKHRXWVLGHIRUSRVVLEOHGDPDJHVGXULQJWUDQVSRUWDWLRQ &RQWDFW\RXUDJHQWLQFDVHWKHUHDUHDQ\GDPDJHV 7UDLQHG.RQHODERU.RQHODE VGLVWULEXWRUSHUVRQQHOVKRXOGXQSDFNWKHDQDO\VHU Þ&KHFNWKHFRQWHQWVRIWKHSDFNDJHDQGWKHVKLSSLQJOLVW Þ&KHFNWKHHTXLSPHQWDFFRUGLQJWRWKHUHFHSWLRQUHSRUWV )RUVDIHRSHUDWLRQDIWHUXQSDFNLQJ $OOHOHFWULFDOHTXLSPHQWLV SRWHQWLDOO\GDQJHURXV1HYHU UHPRYHDQ\FRPSRQHQWRU FRYHUIURPWKHDQDO\VHU XQOHVVGLUHFWHGWRGRVR F &ORVHWKHOHIWSDQHOVHHQIURPWKHIURQWRIWKHDQDO\VHULQ.RQHODEZLWK DVFUHZVRWKDWWKHXVHUFDQQRWRSHQLW7KHVFUHZPXVWEHIDVWHQHGIURPGRZQ XQGHUVHHILJXUH F $WWDFKWKHPHWDOSODWHZLWKVFUHZVWRWKHOHIWVLGHRI.RQHODEDQG EHORZWKHODPSKRXVHMXVWLQVLGHWKHOHIWVLGHSDQHOVHHQIURPWKHIURQWRIWKH DQDO\]HU 'XHWRWKHDQDO\]HUSDFNDJLQJWKHVLGHSDQHODQGWKHPHWDOSODWHFDQQRWEHDWWDFKHG DWWKHIDFWRU\ 6FUHZ )LJXUH&ORVHWKHOHIWVLGHRIWKHDQDO\]HUVIRUWKHHOHFWULFLW\VDIH November 2, 2003 48953054-4081 Konelab Service Manual 9-4 Installation Instructions Version I /2&$7,21 $OZD\VGLVFRQQHFWWKHOLQH FRUGEHIRUHUHPRYLQJWKH DQDO\VHUSDQHOV9ROWDJH SUHVHQWLQWKHDQDO\VHU PD\SURGXFHDVHYHUH SHUKDSVHYHQDIDWDO HOHFWULFDOVKRFN 7KHORFDWLRQRIWKHLQVWUXPHQWVKRXOGVDWLVI\WKHIROORZLQJFULWHULD 'LPHQVLRQVDQGZHLJKWRIWKHDQDO\]HU .RQHODE .RQHODE .RQHODE :LGWK FP FP FP 'HSWK FP FP FP +HLJKW FP FP FP :HLJKW NJ NJ NJ ,WLVQHFHVVDU\WROHDYHDVSDFHRIFPEHWZHHQWKHUHDURIWKHDQDO\]HUDQGWKH ZDOO 2QO\RQHSRZHUFRQQHFWLRQDQGFRQQHFWLRQWRWKHZRUNVWDWLRQLVQHHGHG$Q\RWKHU FRQQHFWLRQVHJZDWHUGUDLQLQJDLURUJDVSUHVVXUHDUHXQQHFHVVDU\5HIHUWR )LJXUH 7KLVDQDO\]HULVGHVLJQHGWR EHJURXQGHGWKURXJKWKHOLQH FRUGIRUVDIHRSHUDWLRQ7R HQVXUHFRQWLQXRXVVDIHW\RI WKHRSHUDWLRQSHUVRQQHOWKH DQDO\]HUPXVWEHFRQQHFWHG WRDQHOHFWULFDORXWOHWWKDWKDV DQHIIHFWLYHJURXQG FRQQHFWLRQ,I\RXDUHLQDQ\ GRXEWDVWRWKHVDIHW\RI\RXU HOHFWULFDOVXSSO\V\VWHP FRQVXOWDTXDOLILHG HOHFWULFLDQ 3RZHUUHTXLUHPHQWV .RQHODE .RQHODE .RQHODE 9± +]± N9$ 9± +]± N9$ 9± +]± N9$ .RQHODEDQGKDYHSRZHUIDLOXUHVHFXULW\EDWWHU\EDFNXSIDFLOLW\ 2SHUDWLQJFRQGLWLRQV $PELHQWWHPSHUDWXUH°& KXPLGLW\QRQFRQGHQVLQJ ,19,752 ',$*1267,& ,167580(17 6KLHOGZKHUHDUHWKHLQVWUXPHQW V W\SHDQGVHULDOQXPEHUFRGHIXVH DQGPDLQVLQIRUPDWLRQ 0DLQVNH\ ,21 2)) :RUNVWDWLRQ (WKHUQHWFDEOH 0DLQVFDEOH )LJXUH7KHUHDURIWKHLQVWUXPHQW Konelab Service Manual 48953054-4081 November 2, 2003 Version I Installation Instructions 9-5 6(783 %HIRUHFRQQHFWLQJWKHPDLQSRZHUSOXJGRWKHIROORZLQJ Þ9LVXDOO\LQVSHFWWKHLQVWUXPHQWIURPWKHRXWVLGHDQGLQVLGHIRUVKLSSLQJGDPDJHV Þ 6WXG\XVHULQVWUXFWLRQVFDUHIXOO\ F 5HPRYHWKHFXVKLRQVRIIRDPHGSODVWLFSODFHGXQGHUGLVSHQVHUVDQG PL[HUV ,QVWDOOSXPSWXEHVLQ.RQHODEDQG $WWDFKWKHWXEHWR ILWWLQJV &ROODU 1RWFKHV 6HWWKHWXEHWRWKH VWHHULQJUROOHUDQGURWDWH WKHSXPSFORFNZLVH/HW WKHURWDWLRQRIWKHSXPS IHHGWKHWXEHGRQRW VWUHWFKLW /LIWWKHFROODULQWR QRWFKHV &KHFNWKDWWKHWXEHLV RQHYHU\VWHHULQJUROOHU 5RWDWHWKHSXPSWR FKHFNWKHZDWHUIHHG )LJXUH,QVWDOODWLRQRIWKHSXPSWXEH ,QVWDOOWKHFXYHWWHZDVWHFRPSDUWPHQW )LJXUH7KHFXYHWWHZDVWHFRPSDUWPHQWORFDWHVLQ WKHXSSHUGUDZHURIWKHDQDO\]HUVWDQG F November 2, 2003 (QVXUHWKDWWKHUHLVDSODVWLFEDJLQWKHFXYHWWHZDVWHFRPSDUWPHQW 48953054-4081 Konelab Service Manual 9-6 Installation Instructions Version I ,QVWDOOGLVWLOOHGZDWHUDQGZDVWHZDWHUFRQWDLQHUV :DVWHZDWHUIXQQHO :DVWHZDWHUFRQWDLQHU /LTXLGVHQVRUV 5DFNIRUOLTXLGVHQVRUV ZKLOHFRQWDLQHUVDUHDZD\ 'LVWLOOHGZDWHUFRQWDLQHU )LOOHUKROH )LJXUH7KHGLVWLOOHGDQGWKHZDVWHZDWHUFRQWDLQHUVORFDWHLQWKHORZHUGUDZHURIWKH VWDQG F F F ,QVHUWWKHIXQQHOWRWKHZDVWHZDWHUFRQWDLQHU )LOOGLVWLOOHGZDWHUWRWKHGLVWLOOHGZDWHUFRQWDLQHUDQGLQVWDOOOLTXLG VHQVRUV3XULILHGZDWHUZDWHUW\SHLVSUHIHUUHG6HHUHTXLUHPHQWVXQGHU &ORVHWKHGUDZHUVORZO\DQGVLPXOWDQHRXVO\FKHFNWKDWWKHIXQQHOLV SXVKLQJWKHGURSFROOHFWRUWRWKHVLGHXQGHUWKHDQDO\]HUDERYHWKHGUDZHU 5HTXLUHPHQWVRI7\SHZDWHU !0ΩFPµPILOWHULQJSSP7'6 WRWDOGLVVROYHGVROLGVFIXPO RU Konelab Service Manual 5HVLVWLYLW\ ±0ΩFP0ΩFPVHWSRLQW 72& SSE 3DUWLFOHIUHH !µP 7'6 SSE 6LOLFDWHV SSE +HDY\PHWDOV SSE 0LFURRUJDQLVPV FIXPO 48953054-4081 November 2, 2003 Version I Installation Instructions 9-7 )LOOWKHFXYHWWHORDGHU F ,QVWDOORQHSDFNDJHRIFXYHWWHV &RQQHFWFDEOHVVZLWFKPDLQVRQ5HIHUWR)LJXUH F F &RQQHFWWKH(WKHUQHWFDEOHWRWKHUHDURIWKHLQVWUXPHQW &RQQHFWWKHPDLQVFDEOHRIWKHLQVWUXPHQWWRWKHSRZHUVXSSO\ :25.67$7,21 0LQLPXPUHTXLUHPHQWVIRU3& 3URFHVVRU &KDVVLV 0HPRU\ 9LGHRDGDSWHU 0RQLWRU )ORSS\GULYH .H\ERDUG +DUGGULYHQR +DUGGULYHQR 6RXQGFDUG &GURP 6SHDNHUV ,QWHJU1HWZRUNDGDSWHU 1HWZRUNDGDSWHU %DFNXSVROXWLRQ 2SHUDWLQJV\VWHPV 0+],QWHO3HQWLXP,,ZLWK.E&DFKH /RZ3URILOH2SWL)UDPH 0E(&&6'5$00E ,QWHJUDWHG0E$7,5DJH3URWXUER[$*3 'HOO8OWUD6FDQ'+(9,67&2 )ORSS\GULYH NH\3HUIRUPDQFHNH\ERDUG *EXOWUD'0$(,'(+DUG'ULYH 1RWLQFOXGHG ,QWHJUDWHGELW6RXQGFDUG &'5HDG:ULWH,'(6SHHG $&6 ,QWHJUDWHG&RP(WKHUQHW0ELW 1RW,QFOXGHG 1RW,QFOXGHG :LQGRZV17:RUNVWDWLRQ(QJOLVK 0LQLPXPUHTXLUHPHQWVIRUSULQWHU 7KHDFFHSWDEOHW\SHRISULQWHUGHSHQGVRQZKDWSULQWHUGULYHUVDUHIRXQGLQ:LQGRZV 173&FRQQHFWHGWR.RQHODE7KHFRQQHFWLRQVKRXOGEHDSDUDOOHOSRUWXVLQJWKH GLUHFW56&LQWHUIDFH 35(3$5,1*)2586($1(:'(//3& :,7+:,1'2:617 :$51,1*:KHQ .RQHODELV LQVWDOOHG'2127 LQVWDOO:LQGRZV17 6HUYLFH3DFN 6HUYLFH3DFN FRUUXSWV 57;5766&RQVROH DSSOLFDWLRQQHHGHG IRU.O 'HOOGHOLYHUV3&¶VZLWKDSUHLQVWDOOHG:LQGRZV17RSHUDWLQJV\VWHP7KLVVHFWLRQ GHVFULEHVKRZWRILQLVKWKH:LQGRZV17LQVWDOODWLRQ 8QSDFNWKH3&DQGFRQQHFWDOOFDEOHVDFFRUGLQJWRWKHPDQXIDFWXUH¶VJXLGH &RQQHFWWKH3&WRDQ$&RXWOHWDQGWXUQRQWKHSRZHU 7KH3&VWDUWVDXWRPDWLFDOO\6RIWZDUH6HWXS6RIWZDUH/LFHQVHVSUHVV\ :LQGRZV176HWXSDXWRPDWLF 6RIWZDUH/LFHQVH$JUHHPHQWFOLFNµ,$JUHH¶ZLWKWKHPRXVH November 2, 2003 48953054-4081 Konelab Service Manual 9-8 Installation Instructions Version I :LQGRZV176HWXSGLDORJ SUHVVQH[W JLYHQDPHDQGRUJDQL]DWLRQH[DPSOH.RQHODEXVHUQDPHRIODERUDWRU\ SUHVVQH[W UHJLVWUDWLRQ3URGXFW,GIURP&HUWLILFDWLRQRI$XWKHQWLFLW\ SUHVVQH[W $GPLQLVWUDWRU$FFRXQWSDVVZRUG.ODEV83(5 &RQILUPWKHSDVVZRUG SUHVVQH[W 1HWZRUN,QVWDOODWLRQ SUHVVQH[W /RQJDXWRPDWLFVRIWZDUHVHWXS 5HVWDUW FOLFN5(67$57LFRQZLWKWKHPRXVH %227,1* 5HDG\WRORJRQ ORJLQDV$GPLQLVWUDWRUZLWKSDVVZRUGVHWXSDWVWHS &RQYHUWKDUGGLVN'ILOHV\VWHPVWR17)6 6WDUW!3URJUDPV!$GPLQLVWUDWLYH7RROV!'LVN$GPLQLVWUDWRU SUHVV2. SUHVV< GLVNSDUWLWLRQVDSSHDURQWKHVFUHHQ LIWKHUHDUHSDUWLWLRQ(RUPRUHWKHVHPXVWEHPHUJHZLWKSDUWLWLRQ' GHOHWH'(DQGELJJHUSDUWLWLRQVDQGGHOHWHLWSDUWLWLRQBGHOHWH³<HV´ VHOHFW³JUH\ER[´ZKLFKLQGLFDWHVIUHHDUHDLQWKHKDUGGLVNVHOHFW SDUWLWLRQBFRPPLWBFKDQJHBQRZ³<HV´ VHOHFW³JUH\ER[´DQG&UHDWHBSDUWLWLRQ³2N´ VHOHFW'SDUWLWLRQBFRPPLWBFKDQJHBQRZ³<HV´ DFWLYDWHGLVNSDUWLWLRQ'E\FOLFNLQJLWZLWKPRXVH VHOHFW7RROV VHOHFW)RUPDW IURP)RUPDWGLDORJVHOHFWILOHV\VWHP17)6 FKHFNWKDWSDUWLWLRQ'LVUHDOO\DFWLYDWHGWKHERXQGDU\RI'LVDEODFNERDUGHU SUHVV6WDUW SUHVV2. )RUPDWFRPSOHWH SUHVV2. 6HOHFW7RROV 6HOHFW'ULYHBOHWWHU &KHFNWKDWWKH/HWWHUIRU&'B520LV(FKDQJHLIQRW SUHVV&ORVH H[LWDSSOLFDWLRQ &RQYHUWKDUGGLVN&ILOHV\VWHPWR17)6,WKDVWZRSRVVLELOLWLHV )LUVW6WDUW!3URJUDPV!'HOO$FFHVVRULHV!&RQYHUW&WR17)6SUHVV< 6HFRQG6WDUW!3URJUDPV!&RPPDQG3URPSW*LYHFRPPDQGFRQYHUWF )617)63UHVV< 5HERRWWKHZRUNVWDWLRQVRWKDWFRQYHUVLRQRIGLVN&FDQEHGRQHGXULQJ6WDUWXS VHOHFW6WDUW!6KXWGRZQ!5HVWDUWWKHFRPSXWHUDQGSUHVV\HV %227,1* :RUNVWDWLRQLVUHDG\IRU.RQHODEVRIWZDUHFRQILJXUDWLRQ Konelab Service Manual 48953054-4081 November 2, 2003 Version I Installation Instructions 9-9 :25.67$7,21&21),*85$7,21 *(1(5$/ )ROORZLQJVHWXSVKRXOGEHXVHGDWXVHU¶VVLWH :RUNVWDWLRQ7&3,3FRQILJXUDWLRQGRPDLQQDPHLV.RQHODEDQG,3DGGUHVV 8VHUQDPHLV.RQHODEDQGSDVVZRUG.RQHODE ,QWHUQDO3&¶V,3DGGUHVVLV ,167$//,1*1(7:25. /RJLQDV$GPLQLVWUDWRU 6HOHFW6WDUW!6HWWLQJV!&RQWURO3DQHO 6HOHFW1HWZRUN VHOHFW3URWRFROVFDUG VHOHFW$GG FKRRVHIURPOLVW7&3,33URWRFROSUHVV2. 7&3,3VHWXSDQVZHU12WR'+3& GLUHFWRU\SDWKLV&?, SUHVV&RQWLQXH '2127VHOHFW2.RU$SSO\ VHOHFW%LQGLQJVFDUG VHOHFW3URWRFROVFDUG VHOHFW7&3 VHOHFW3URSHUWLHV VHW,3DGGUHVVVXEQHWPDVN VHOHFW'16FDUGDQGVHWKRVWQDPH.RQHODE VHOHFW:LQVFDUGDQGGLVDEOH/0+267/RRNXS SUHVV$SSO\ SUHVV2. VHWXSFRPSODLQV$WOHDVWRQHRIWKHDGDSWHUFDUGVKDVDQHPSW\SULPDU\ :,16DGGUHVV'R\RXZDQWWRFRQWLQXH"$QVZHU<HVHYHU\WLPHWKLV TXHVWLRQLVDVNHG VHOHFW%LQGLQJVFDUG VHOHFW,GHQWLILFDWLRQFDUG VHOHFWFKDQJH VHWWKHQDPH.RQHODE SUHVV2. SUHVV2. VHOHFW%LQGLQJVFDUG &ORVH1HWZRUN 5HVWDUW"DQVZHU<HV %227,1* /RJLQDV$GPLQLVWUDWRU November 2, 2003 48953054-4081 Konelab Service Manual 9-10 Installation Instructions Version I 6(75(*,21$/6(77,1*6 6HOHFW6WDUW!6HWWLQJV!&RQWURO3DQHO 6HOHFWUHJLRQDOVHWWLQJV 6HOHFWFRUUHFWUHJLRQ 6HOHFW6HWDVV\VWHPGHIDXOWORFDOH 3UHVV$SSO\ 'R\RXZDQWWRUHVWDUWDQVZHU1R 6HOHFW,QSXWORFDOHV 6HOHFWFRUUHFWUHJLRQ 3UHVV6HWDVGHIDXOW 3UHVV$SSO\ 3UHVV2. 6(783',63/$< 6HOHFW6WDUW!6HWWLQJV!&RQWURO3DQHO 6HOHFWGLVSOD\ 6HOHFWVHWWLQJVFDUG 3UHVV/LVWDOOPRGHV 6HOHFWIURPOLVWE\SL[HOV7UXH&RORUZLWK KLJKHVW+HUW]YDOXHDYDLODEOHSUREDEO\+HUW] 3UHVV2. 3UHVV$SSO\ $'-867',63/$< F &RQQHFWWKHPRQLWRUNH\ERDUGPRXVHSULQWHUDQGWKHZRUNVWDWLRQDQG FRQQHFWWKHPDLQVWRWKHSRZHUVXSSO\ F $GMXVWWKHGLVSOD\RIWKHPRQLWRU$GMXVWPHQWVDUHGRQHZLWKWKHDUURZ EXWWRQVORFDWLQJEHVLGHWKHSRZHUEXWWRQRIPRQLWRU 3UHVV∆RU∇EXWWRQWRVHHWKHPHQX:LWKWKHVDPHEXWWRQV\RXFDQPRYHLQWKH PHQXOLVW2SHQWKHVHOHFWHGVXEPHQXHJZLGWKZLWK>EXWWRQ$GMXVWWKHVHOHFWHG SURSHUW\ZLWK∆RU∇EXWWRQV∆EXWWRQLQFUHDVHVDQG∇GHFUHDVHVWKHSURSHUW\$IWHU DGMXVWLQJWKHQHZVHWWLQJZLOOEHVWRUHGDXWRPDWLFDOO\0HQXGLVDSSHDUV DXWRPDWLFDOO\LQDIHZVHFRQGV)RUIXUWKHULQIRUPDWLRQVHHWKH0RQLWRU8VHU¶V *XLGHERRNOHWDQGRU&' Konelab Service Manual 48953054-4081 November 2, 2003 Version I Installation Instructions 9-11 6(78335,17(5 6HWXSSULQWHU/; 6HOHFW6WDUW6HWWLQJV3ULQWHUV 6HOHFW$GGSULQWHU 0\FRPSXWHUQH[W! /37QH[W! (SVRQ/;QH[W!QH[W! 1RWVKDUHGQH[W! ,I<RXGRQRWKDYH3&LQVWDOODWLRQ&'LQ\RXUKDQGGULYHUVFDQEHIRXQG IURP&?LIROGHU 7HVWSDJH<HV1R 6HOHFW6WDUW6HWWLQJV3ULQWHUVLIQRWVHOHFWHG 6HOHFW/;DQGFOLFNZLWKWKHULJKWPRXVHEXWWRQVRDSRSXSPHQX DSSHDUV 6HOHFW'RFXPHQWGHIDXOW 3DSHUVL]H)DQIROG[LQ 3DSHUVRXUFHWUDFWRUIHHG 3UHVV2. 6HOHFW/;DQGFOLFNZLWKWKHULJKWPRXVHEXWWRQVRDSRSXSPHQX DSSHDUV 6HOHFW3URSHUWLHV 6HOHFW'HYLFHVHWWLQJV &KDQJH7UDFWRUIHHGVHWWLQJ!)DQIROG[LQ 3UHVV2. 6HWXSSULQWHU); 6DPHSULQWHUFDQEHGHILQHGDV);7KHTXDOLW\RISULQWLQJLVSRRUHUEXWWKH VSHHGRISULQWLQJLVIDVWHUWKDQXVLQJVHWWLQJVIRU/; 6HOHFW6WDUW!6HWWLQJV!3ULQWHUVLIQRWVHOHFWHG 6HOHFW$GGSULQWHU 0\FRPSXWHUQH[W! /37QH[W! (SVRQ);QH[W!QH[W! 1RWVKDUHGQH[W! ,I<RXGRQRWKDYH3&LQVWDOODWLRQ&'LQ\RXUKDQGGULYHUVFDQ EHIRXQGIURP&?LIROGHU 7HVWSDJH<HV1R 6HOHFW6WDUW!6HWWLQJV!3ULQWHUVLIQRWVHOHFWHG 6HOHFW);DQGFOLFNZLWKULJKWPRXVHEXWWRQVRDSRSXSPHQXDSSHDUV 6HOHFW'RFXPHQWGHIDXOW 3DSHUVL]H)DQIROG[LQ 3DSHUVRXUFHWUDFWRUIHHG 3UHVV2. 6HOHFW);DQGFOLFNZLWKULJKWPRXVHEXWWRQVRDSRSXSPHQXDSSHDUV 6HOHFW3URSHUWLHV 6HOHFW'HYLFHVHWWLQJV &KDQJH7UDFWRUIHHGVHWWLQJ)DQIROG[LQ 3UHVV2. November 2, 2003 48953054-4081 Konelab Service Manual 9-12 Installation Instructions Version I 6HWXSGHIDXOWSULQWHU 6HOHFW6WDUW!6HWWLQJV!3ULQWHUVLIQRWVHOHFWHG 6HOHFW);DQGFOLFNZLWKULJKWPRXVHEXWWRQVRDSRSXSPHQXDSSHDUV FKHFNWKDW6HW$V'HIDXOWLVPDUNHGZLWKYLIQRWFOLFN6HW$V 'HIDXOW &+(&.,1*$9$,/$%/(',63/$<0(025< 6HOHFW6WDUW!3URJUDPV!$GPLQLVWUDWLYH7RROV!:LQGRZV17'LDJQRVWLFV 6HOHFW'LVSOD\FDUG 3URSHUWLHVRIDGDSWHUDQGGLVSOD\ZLOOEHVHHQ .21(/$%62)7:$5( ,167$//$7,21 :RUNVWDWLRQLVQRZUHDG\IRU.RQHODEVRIWZDUHLQVWDOODWLRQ 8VHUPXVWEH$GPLQLVWUDWRUZKHQLQVWDOOLQJ.RQHODEVRIWZDUHDVLWLVLISUHYLRXV LQVWUXFWLRQVKDYHEHHQIROORZHG2WKHUZLVHORJLQDVDQDGPLQLVWUDWRU ,167$//,1*.21(/$%$1' 2%-(&7,9,7<'% Konelab Service Manual ,QVWDOO.RQHODE&'LQWR&'GULYH :DLWZKLOHWKHGULYHFKHFNVWKHQHZ&' ,QVWDOOLQJVWDUWVDXWRPDWLFDOO\ ,ILWIRUVRPHUHDVRQGRHVQRWVWDUWDXWRPDWLFDOO\XVHUFDQVHOHFW ³VHWXSH[H´IURPWKH.RQHODEIROGHULQWKH&' ,I2EMHFWLYLW\KDVQRWEHHQ,QVWDOOLQJRI2EMHFWLYLW\'%EHJLQV 3UHVVµ,QVWDOO¶DQGµ1H[W¶VHOHFWLQJ2EMHFWLYLW\'%LQVWDOOLQJ &KDQJH³'HVWLQDWLRQGLUHFWRU\´SUHVVµ%URZVH¶ZULWHF?REM\SUHVV µ2.¶ ,QVWDOODWLRQDVNV³'R\RXZDQWGLUHFWRU\WREHFUHDWHG"´SUHVVµ<HV¶ 3UHVVµ1H[W¶ 3UHVVµ1H[W¶ 3UHVVµ1H[W¶ ,QVWDOODWLRQDVNV³'R\RXZDQWWR6HWXSWRFUHDWHDORFNVHUYHUV\VWHP GLUHFWRU\F?XVU?VSRRO?REM\"´3UHVVµ<HV¶ '21¶7UHERRWWKH3&\HWFKRRVH³1R,ZLOOUHVWDUWP\FRPSXWHUODWHU´ 3UHVVµ2.¶ 3UHVVµ([LW¶ &ORVHWKH2EMHFWLYLW\3URJUDP*URXSZLQGRZ ,I&?.RQHODEIROGHUGRHVQRWH[LVWLQVWDOOJRHVZLWKRXWTXHVWLRQV ,I&?.RQHODEIROGHUH[LVWVVHOHFW³5HLQVWDOO.RQHODE´ 3UHVV³1H[W´ &KRRVH³1R,ZLOOUHVWDUWP\FRPSXWHUODWHU´3UHVVµ2.¶ 5HPRYH&'IURP&'GULYH 48953054-4081 November 2, 2003 Version I Installation Instructions 9-13 &5($7(86(5.21(/$% 6HOHFW6WDUW!3URJUDPV!$GPLQLVWUDWLYH7RROV!8VHU0DQDJHU 6HOHFW$GPLQLVWUDWRUE\FOLFNLQJWKHQDPHZLWKWKHPRXVH 6HOHFWRSWLRQ³QHYHUH[SLUHV´IRUSDVVZRUGDQGPDNHLWWKHRQO\ DFWLYHVHOHFWLRQ 3UHVV2. &UHDWH1HZXVHU 6HOHFW8VHU!1HZ8VHU 8VHUQDPH.RQHODE )XOOQDPH.RQHODE8VHU 3DVVZRUG.RQHODE &RQILUPSDVVZRUG.RQHODE 6HOHFWRSWLRQ³3DVVZRUGQHYHUH[SLUHV´IRUSDVVZRUGDQGPDNHLW WKHRQO\DFWLYHVHOHFWLRQUHPRYHRSWLRQµ8VHUPXVWFKDQJH SDVVZRUGDWQH[WORJRQ¶ 6HOHFW2. ([LWWKHDSSOLFDWLRQ 6(77,1*.21(/$%$33/,&$7,21 1HHGHGRQO\LIODQJXDJHZLOOEHFKDQJHG ([LWIURP.RQHODE ³)0RUH´ !³)0DQDJHPHQW´ !³)0RUH´ !³)(;,7´ 6HOHFW6WDUW!3URJUDPV!.RQHODEODQJXDJHVHOHFWLRQ /DQJXDJHVHOHFWLRQFDQEHGRQHDV.RQHODEXVHU 6HOHFWODQJXDJHLIQHHGHGGHIDXOW(QJOLVK /2*,1$686(5.21(/$% 5HVWDUWWKH3& %227,1* /RJLQDV8VHU.RQHODESDVVZRUG.RQHODEWKH.RQHODE$SSOLFDWLRQVKRXOGVWDUW DXWRPDWLFDOO\ 6(75(*,21$/6(77,1*6 &KHFNLQJRIUHJLRQDOVHWWLQJVFDQEHGRQHQRZ ([LWIURP.RQHODE ³)0RUH´ !³)0DQDJHPHQW´ !³)0RUH´ !³)(;,7´ 6HOHFW6WDUW!6HWWLQJV!&RQWURO3DQHO 6HOHFWUHJLRQDOVHWWLQJV 6HOHFWFRUUHFWUHJLRQ 3UHVV$SSO\ 6HOHFW,QSXW/RFDOHVFDUG 6HOHFWFRUUHFWUHJLRQ 3UHVV6HWDVGHIDXOW 3UHVV$SSO\ 3UHVV2. November 2, 2003 48953054-4081 Konelab Service Manual 9-14 Installation Instructions Version I .RQHODE&21),*85$7,21 0DLQZLQGRZ /,06&RQILJ )) &RQILJXUDWLRQ ) &RQILJXUDWLRQ &RQILJXUDWLRQ ,QIRUPDWLRQVHHQLQWKH&21),*85$7,21ZLQGRZ Konelab Service Manual ,QVWUXPHQWW\SH 7KHLQVWUXPHQWW\SH.RQHODELVVHHQ ,6(LQXVH &RQQHFW,6(XQLWRQRURII&KDQJLQJGHPDQGV UHERRWLQJ &XYHWWHH[LWOLPLW 7KHPD[LPXPQXPEHURIXQXVHGFXYHWWHFHOOVEHIRUH WKHFXYHWWHLVDOORZHGWRGLVFDUG 0D[ZDWHUEODQN6' 7KHPD[LPXPDOORZHGOLPLWIRUZDWHUEODQNVWDQGDUG GHYLDWLRQ 5HDJHQWGLVNFKHFN 6HOHFWLIWKHUHDJHQWGLVNLVFKHFNHGRUQRW<(612 ZKHQWKHDQDO\VHULVERRWHG7KHUHDJHQWGDWDLVUHDG DQGWKHYROXPHFKHFNHGZKHQ<HVLVDQVZHUHG $XWRPDWLFVWDUW &RQQHFWDXWRPDWLFVWDUWRQ\HVRURII1R 'DWDFULWHULD 6HOHFWLIWKHGDWDLVHQWHUHGDQGDXWRPDWLFDOO\UHSRUWHG DFFRUGLQJWRSDWLHQWVRUDFFRUGLQJWRVDPSOHV6DPSOHV FDQEHVHOHFWHGZLWKRUZLWKRXWSDWLHQW:LWKRXW SDWLHQWPHDQVWKDWWKHSDWLHQWQDPHLVQHLWKHUVHHQLQ WKH6DPSOHHQWU\ZLQGRZQRULQUHSRUWV 5HVXOWDUFKLYHLQXVH 6HOHFWLIWKHUHVXOWDUFKLYHLVXVHGRUQRW,IDUFKLYHLV WDNHQRXWRIXVHWKHGDWDRILWLVORVW:KHQDUFKLYHLV WDNHQLQWRXVHLWLVUHFUHDWHGDXWRPDWLFDOO\ 48953054-4081 November 2, 2003 Version I November 2, 2003 Installation Instructions 9-15 'HIDXOWVDPSOHW\SH 6HOHFWWKHGHIDXOWVDPSOHW\SHXVHGLQ6DPSOH3DWLHQW HQWU\ 'HIDXOWUHIHUHQFHFODVV 6HOHFWWKHGHIDXOWUHIHUHQFHFODVVXVHGLQ6DPSOH 3DWLHQWHQWU\ &'5:GULYH 6HOHFWWKHGULYHZKLFKZULWLQJ&'LVXVLQJ 5HSRUWLQJW\SH 6HOHFWLIUHSRUWLQJLVPDQXDORUDXWRPDWLF 3ULQWSDFNLQJ 6HOHFWLIWKHUHSRUW VUHVXOWVDUHSDFNHGRUQRW<(6 12,I<HVLVVHOHFWHGWKHUHSRUWLQFOXGHVPRUHWKDQ RQHSDWLHQW VVDPSOH VWHVW VUHVXOWVLQRQHSDJH ,I1RLVVHOHFWHGRQHUHSRUWSDJHLQFOXGHVRQO\RQH SDWLHQW VVDPSOH VWHVW VUHVXOWV 5HVSRQVHLQFOXGHG 6HOHFWLIWKHUHVSRQVHLVLQFOXGHGLQUHSRUWVRUQRW 6SHFLDOUHSRUWLQXVH 6HOHFWLI\RXXVHWKHVSHFLDOFRQILJXUHGUHSRUW<HV RUWKHGHIDXOWRQH1R 5HSRUWRXWVLGHUHVXOW 6HOHFWLIWKHRXWVLGHUHVXOWLVUHSRUWHGDVDOLPLW V\PEROHJ/RZOLPLWRUDVDH[DFWYDOXH 0D[VDPSOHDJH 7\SHWKHPD[LPXPDOORZHGVDPSOHDJHLQKRXUVDQG PLQXWHVKKPP7KHVDPSOHLVPDUNHGµ2OG¶DQGLV QRWGLVSHQVHGLIWKHWLPHLVRYHU0D[LPXPDOORZHG WLPHFDQEHKRXUVPRQWKDQGDWOHDVWLWPXVWEH PLQXWH6DPSOHDJHFRQFHUQVDOOVDPSOHVLQWKH VHJPHQWV67$7SRVLWLRQVDQGFRPLQJWKURXJK DXWRPDWHGVDPSOHOLQH 0D[FRQWURODJH 7\SHWKHPD[LPXPDOORZHGFRQWURODJHLQKRXUVDQG PLQXWHVKKPP7KHFRQWUROVDPSOHLVPDUNHGµ2OG¶ DQGLVQRWGLVSHQVHGLIWKHWLPHLVRYHU0D[LPXP DOORZHGWLPHFDQEHKRXUVPRQWKDQGDWOHDVW LWPXVWEHPLQXWH6DPSOHDJHFRQFHUQVDOOFRQWUROV LQWKHVHJPHQWV67$7SRVLWLRQVDQGFRPLQJWKURXJK DXWRPDWHGVDPSOHOLQH7KHDJHRIFRQWUROVZKLFKDUH LQWKHIL[HGSRVLWLRQVLQWKHVDPSOHGLVNFDQQRWEH IROORZHG 0D[FDOLEUDWRUDJH 7\SHWKHPD[LPXPDOORZHGFDOLEUDWRUDJHLQKRXUV DQGPLQXWHVKKPP7KHFDOLEUDWRUVDPSOHLVPDUNHG µ2OG¶DQGLVQRWGLVSHQVHGLIWKHWLPHLVRYHU 0D[LPXPDOORZHGWLPHFDQEHKRXUVPRQWK DQGDWOHDVWLWPXVWEHPLQXWH6DPSOHDJHFRQFHUQV DOOFDOLEUDWRUVLQWKHVHJPHQWV67$7SRVLWLRQVDQG FRPLQJWKURXJKDXWRPDWHGVDPSOHOLQH7KHDJHRI FDOLEUDWRUVZKLFKDUHLQWKHIL[HGSRVLWLRQVLQWKH VDPSOHGLVNFDQQRWEHIROORZHG )LOWHUVLQXVH3RVLWLRQ 0DUNWKHLQVWDOOHGZDYHOHQJWKVEHVLGH\RXFDQVHHWKH SRVLWLRQLQWKHILOWHUZKHHO 48953054-4081 Konelab Service Manual 9-16 Installation Instructions Version I /,06FRQILJXUDWLRQ &RQILJXUDWLRQ ) /,06 &RQILJXUDWLRQ /,06 &RQILJXUDWLRQ /,063URWRFRO 7KHXVHGODERUDWRU\LQIRUPDWLRQPDQDJHPHQWSURWRFRO LQRQOLQHFRQQHFWLRQ 5HVXOWVHQGLQJFULWHULD 6HOHFWWKHUHVXOWVHQGLQJFULWHULD6DPSOH5HTXHVWLQ WKH/,06SURWRFRO ,IWKH/,06SURWRFROLV.21(2QOLQHWKHIROORZLQJILHOGLVDOVRVHHQ 1HZ2OGFKHFNLQXVH 6HOHFWLIWKHVDPSOH¶VQHZROGFKHFNLVXVHG<HVRU QRW1RGXULQJWKH/,06SURWRFRO ,IWKH/,06SURWRFROLV$670WKHIROORZLQJILHOGVDUHDOVRVHHQ Konelab Service Manual 5HVXOWVHQGLQJ 6HOHFWLIWKHUHVXOWVDUHVHQWWRWKHKRVWFRPSXWHU DXWRPDWLFDOO\RUZKHQUHTXHVWHG +RVWTXHU\LQXVH 6HOHFWLIWKHKRVWTXHU\LVXVHGRUQRWGXULQJ VDPSOHSDWLHQWHQWU\ :DLWIRUUHTXHVWV ,I+RVWTXHU\ZDVVHOHFWHGLQXVHWKHQWKHXVHUFDQVHOHFW LIUHTXHVWVDUHZDLWHGIRURUQRWGXULQJVDPSOHSDWLHQW HQWU\,I <HV WKHXVHULVZDLWLQJIRUDIWHUHQWHULQJWKH QDPHRIDQHZVDPSOHSDWLHQW2WKHUZLVHWKHXVHULV ZRUNLQJDQGUHTXHVWVDUHFRPLQJSDUDOOHO 6HQGFRQWUROUHVXOWV 6HOHFWLIFRQWUROUHVXOWVDUHVHQWWRWKHKRVWFRPSXWHURU QRW 48953054-4081 November 2, 2003 Version I Installation Instructions 9-17 6HQGFDOLEUDWRUUHVXOWV 6HOHFWLIFDOLEUDWRUUHVXOWVDUHVHQWWRWKHKRVWFRPSXWHU RUQRW 'HOD\LQVHQGLQJPV 7KHGHOD\QHHGHGEHIRUH.RQHODEVHQGVHJVDPSOHGDWD WRWKHKRVWFRPSXWHU7KHGHIDXOWYDOXHLV PLOOLVHFRQGVPLQLPXPLVDQGPD[LPXPVHFRQGV 6HULDO,QWHUIDFHSDUDPHWHUV November 2, 2003 6HULDOSRUW 6HOHFWWKHVHULDOSRUWIURPWKHSXOOGRZQPHQX $OWHUQDWLYHVDUHIURP&20WR&20 %DXGUDWH 6HOHFWWKHEDXGUDWHYDOXHVEHWZHHQDQG 'DWDELWV 7KHQXPEHURIGDWDELWVFDQEHRU 6WRSELWV 7KHQXPEHURIVWRSELWVFDQEHRU 3DULW\ 6HOHFWWKHSDULW\FKHFNLQJ,WFDQEHHYHQRURGG ,IFKHFNLQJLVQRWZDQWHGVHOHFW12 $FNWLPHRXWVHF 7KHPD[LPXPWLPHWKHUHVSRQVHLVZDLWHGIRU 48953054-4081 Konelab Service Manual 9-18 Installation Instructions Version I ,6(6HW8S 0$7(5,$/ .RQHODE0DLQWHQDQFHIUHHPLFURYROXPHHOHFWURGHVDUHUHDG\WRXVH7KHUHIHUHQFH HOHFWURGHFRQWDLQVILOOLQJVROXWLRQEDJZKLFKKDVWREHDWWDFKHGWRWKHVLGHSRUWRI WKHHOHFWURGHEHIRUHXVH 7KH\DUHFRGHGZLWKFRORXUVSRWV7KHXVHGFRORXUVDUHIROORZLQJ 1D\HOORZ &OEOXH 5HI±EURZQ .UHG S+ZKLWH &DJUHHQ /LJUH\ )RUVDPSOHGHWHFWLRQ (QGVOLFHLQ (QGVOLFHRXW *URXQGLQJZLUHEODFN ,PSHGDQFHWUDQVSDUHQW 7KHHOHFWURGHEORFNLVEXLOWXSRI.1DDQG&ORUDOWHUQDWLYHO\RSWLRQDO &D /L S+LQ.RQHODERQO\/LLVRSWLRQDOPLFURYROXPHLRQVHOHFWLYH HOHFWURGHVRQHUHIHUHQFHHOHFWURGHDQGWZRDGGLWLRQDOHQGVOLFHVIRUJURXQGLQJDQG VDPSOHGHWHFWLRQ7KHHOHFWURGHVDVZHOODVWKHHQGVOLFHVDUHFRQQHFWHGWRJHWKHU XVLQJVPDOOSRVLWLRQLQJGRZHOSLQV )LJXUH0DLQWHQDQFHIUHHHOHFWURGHEORFNZLWKLRQVHOHFWLYHHOHFWURGHV &RORXUHGVSRW (OHFWURGHSLQ (OHFWURGHFDS 3RVLWLRQLQJGRZHOSLQV (OHFWURGHFKDPEHU 2ULQJ 6DPSOHFKDQQHO )LJXUH$VLQJOHHOHFWURGH Konelab Service Manual 48953054-4081 November 2, 2003 Version I Installation Instructions 9-19 ,167$//$7,21 0$,17(1$1&()5(((/(&752'( )LJXUH)RLOEDJFRQWDLQLQJDQHOHFWURGHDQGWKHHOHFWURGH F 5HPRYHWKHIRLOEDJIURPWKHHOHFWURGHER[DQGWHDULWDWWKHVPDOOFXWWR F &KHFNWKDWWKHLQQHUILOOLQJVROXWLRQLVFRYHULQJWKHPHPEUDQH RSHQ )LJXUH+ROGLQJWKHHOHFWURGHXSULJKWJHQWO\IRUFHRXWDQ\WUDSSHGDLUIURPWKH PHPEUDQHVXUIDFHZLWKDIOLFNRIWKHZULVW'RQRWWDSWKHHOHFWURGHRQDKDUGVXUIDFH ) LOOLQ J 0 H P E U D Q H V D P S OH F K D Q Q H O )LJXUH$QHOHFWURGHFKDPEHUZKHQWKHHOHFWURGHLVUHDG\IRULQVWDOODWLRQLQWRWKH LQVWUXPHQW 7KHHOHFWURGHLVQRZUHDG\WREHLQVWDOOHG November 2, 2003 48953054-4081 Konelab Service Manual 9-20 Installation Instructions Version I 5()(5(1&((/(&752'( )LJXUHD7KH5HIHUHQFHHOHFWURGHNLW UHIHOHFWURGHVOLFHLQIRLOEDJ LQWHUQDOHOHFWURGH ODUJHRULQJIRULQWHUQDOHOHFWURGH VPDOORULQJVDVVSDUH 39&WXEHIRUILOOLQJVROXWLRQEDJ DWWDFKPHQW &KHFNWKDWWKHUHLVQR DLULQWKHWXELQJRU FKDPEHU HOHFWURGHFKDPEHUILOOLQJ VROXWLRQEDJ WRROIRUWLJKWHQLQJWKH HOHFWURGHFDS :DUUDQW\VKHHW F 5HPRYHWKHUHIHUHQFHHOHFWURGHIURPWKHIRLOEDJDQGULQVHWKHRXWHU VXUIDFHVZLWKGLVWLOOHGZDWHU)OLFNH[FHVVOLTXLGRXWRIWKHFKDPEHUVDQGZLSHWKH RXWHUVXUIDFHVGU\ F F F 3ODFHRQHODUJHRULQJRQWKHHOHFWURGHFDSLQVWDOOLWORRVHO\LQWRWKH FKDPEHUUHIHUWR)LJXUHE &RQQHFWD39&WXEHWRWKHVLGHSRUWRIWKHVOLFHVRWKDWWKHPHWDOVSULQJ IDVWHQVWKHFRQQHFWLRQUHIHUWR)LJXUHE &XWWKHWXEHRIWKH)LOOLQJ6ROXWLRQEDJWRFPOHQJWKDQGDWWDFKWKH 39&WXEHWRRSHQHQG$YRLGOHWWLQJDLUEDFNXSLQWRWKHWXELQJ*HQWO\VTXHH]H WKHEDJWRILOOWKHFKDPEHU7LJKWHQWKHHOHFWURGHFDSILUVWZLWKILQJHUVWKHQZLWK WKHWRRO Konelab Service Manual 48953054-4081 November 2, 2003 Version I Installation Instructions 9-21 )LJXUHE)LOOLQJWKHUHIHUHQFHHOHFWURGH $66(0%/,1*7+((/(&752'(6 )LJXUH7KH,6(GLVSHQVLQJDUP F 7XUQWKHFRYHURIWKH,6(GLVSHQVLQJDUPVRWKDW\RXFDQVHHWKHSRVLWLRQ RIWKHEORFN7KHFRYHULVKLQJHGVRLWLVHDV\WRRSHQ 7KHUHPXVWDOZD\VEH DQRULQJEHWZHHQWZR HOHFWURGHV November 2, 2003 F 3ODFHHOHFWURGHVDFFRUGLQJWRWKHODEHOLQWKHSODFHRIWKHEORFN9LHZHG IURPWKHIURQWRIWKHEORFNZKHQWKH,6(QHHGOHLVWRWKHOHIWWKHRUGHURIWKH HOHFWURGHVLVIURPOHIWWRULJKWHQGVOLFHZLWKWKHWUDQVSDUHQWFRGH&O5HI. 1D/L&DS+DQGHQGVOLFHZLWKWKHEODFNFRGH 3ODFHDQRULQJRQWKHOHIWVLGHRIWKHHQGVOLFHZLWKWKHEODFNFRGH(QVXUHWKDW WKHUHLVDQRULQJEHWZHHQWZRHOHFWURGHVEHIRUH\RXSUHVVWKHHOHFWURGHVVRWKDW WKHSRVLWLRQLQJGRZHOSLQVDUHDOLJQHG1RWHWKDWWKHWXEHRIWKHUHIHUHQFH HOHFWURGHPXVWEHWRZDUGV\RX 48953054-4081 Konelab Service Manual 9-22 Installation Instructions Version I 6LJQDOGHWHFWLQJDQG JURXQGLQJZLUHV 6FUHZWRDGMXVWWKHOHQJWK RIWKHEORFN 1HHGOHWXEH /HYHU 7XEHOHDGLQJWR WKHV\ULQJH )LJXUH7KHHOHFWURGHEORFNLQWKH,6(GLVSHQVLQJDUP 7KHEORFNPXVWLQFOXGH WKH1DHOHFWURGHZKHQ/L LVPHDVXUHGDQGWKH EORFNPXVWLQFOXGHS+ ZKHQ&DLVPHDVXUHG :KHQUHPRYLQJDQ HOHFWURGHEORFNIURPWKH LQVWUXPHQWGHWDFKLW IURPHQGVOLFHVDQGOHDYH WKHPLQWDFW F 3ODFHWKHHOHFWURGHEORFNEHWZHHQHQGVOLFHV7XUQWKHOHYHUVRWKDWWKH EORFNLVILUPO\LQLWVSODFH1RWHWKDWWKHUHLVDVFUHZZLWKZKLFK\RXFDQDGMXVW WKHOHQJWKRIWKHEORFN $WWDFKWKHILOOLQJVROXWLRQEDJRIWKHUHIHUHQFHHOHFWURGHWRLWVSODFH3ODFHWKH KROHRIWKHEDJWRWKHKRRNDQGWXUQWKHEDJXQGHUWKHPHWDOSODWH F &RQQHFWVLJQDOGHWHFWLQJDQGJURXQGLQJZLUHVWRWKHSLQVDWWKHWRSRIWKH EORFNHQVXULQJWKDWWKHFDSFRORXUFRUUHVSRQGVWRWKDWRIWKHVOLFH F (QVXUHWKDWWKHWXEHVDUHFRQQHFWHGIURPWKHOHIWVLGHRIWKHEORFNWRWKH QHHGOHDQGIURPWKHULJKWVLGHRIWKHEORFNWRWKHFRQQHFWRURIWKHWXEHZKLFK OHDGVWRWKHV\ULQJHWRWKH)0,SXPSLQWKH.RQHODE F 7XUQWKHFRYHURIWKH,6(GLVSHQVLQJDUPEDFN&KHFNWKDWLWLVQRW SUHVVLQJWKHWXEHV 'HILQHZKLFKHOHFWURGHVDUHLQWKHEORFN 2SHQWKH,6((OHFWURGHVZLQGRZDQGVHOHFWZKLFKHOHFWURGHVDUHLQWKHEORFN7KH ,6(WHVWKDVWREHGHILQHGLQWKH7HVWGHILQLWLRQZLQGRZ Konelab Service Manual 48953054-4081 November 2, 2003 Version I Installation Instructions 9-23 ,QVWDOO,6(&DOLEUDWRU 7KHSODFHIRUWKHEDJ /XHUORFNWRFRQQHFW,6( &DOLEUDWRUWRWKHWXEH FRPLQJIURPWKH,6( GLVSHQVLQJSXPS )LJXUH,6(&DOLEUDWRULVLQDIRLO EDJZKLFKPLQLPL]HVHYDSRUDWLRQ F &RQQHFWWKHWXEHRI,6(&DOLEUDWRUVROXWLRQWRWKHWXEHFRPLQJIURPWKH ,6(GLVSHQVLQJSXPS&RQQHFWLRQLVPDGHWXUQLQJWKH/XHUORFNWRWKH FRXQWHUSDUW F +DQJWKHEDJRQWKHKRRNVLQWKHJDWHSODFHGRQWKHOHIWVLGHRIWKH LQVWUXPHQW,QFDVHWKHLQVWUXPHQWKDVWKH.867,PRGXOHWKHJDWHLVLQIURQWRI WKHLQVWUXPHQW F $IWHUFKDQJLQJWKHEDJDVNFDOLEUDWLRQLQWKH&DOLEUDWLRQ4&VHOHFWLRQ ZLQGRZ$IWHUWKDWWKH,6(FDOLEUDWRUFDQEHIHWFKHGE\5HDJHQWV)$GG,6( &$/ *LYH,6(UHTXHVWVFKHFNFDOLEUDWLRQ 1HYHUXVHGLVWLOOHGZDWHU DVDVDPSOHZLWK,6( HOHFWURGHV 2QFH,6(&DOLEUDWRUVROXWLRQVDUHLQSODFHWRGHILQHWKHSRVLWLRQVRI&DOLEUDWRU VROXWLRQVDQGJRWRWKH&DO&WUOGHILQLWLRQZLQGRZDQG6WDUWXSKDVEHHQGRQH JLYHVRPH,6(UHTXHVWVDQGHQWHUVHUDDVVDPSOH,QVSHFWWKHGHWDLOHGFDOLEUDWLRQ UHVXOWVIRUDOOHOHFWURGHVLQWKH&DOLEUDWLRQUHVXOWVZLQGRZ ,ISUREOHPVRFFXUFKHFNWKHFRQQHFWLRQVRIHOHFWURGHVDQG&DOLEUDWRU5HFDOLEUDWH LQWKH&DOLEUDWLRQ4&VHOHFWLRQZLQGRZ :KHQFDOLEUDWLRQLVVXFFHVVIXODSUHUXQRIVHUDVKRXOGEHDQDO\VHGZLWK VXEVHTXHQWQHZFDOLEUDWLRQEHIRUHDQDO\VLQJSDWLHQWVDPSOHV &RPSOHWHWKH:DUUDQW\DQG,QVWDOODWLRQ6KHHWV &RPSOHWHWKH:DUUDQW\DQG,QVWDOODWLRQ6KHHWVLQWKH(OHFWURGH.LWRQHIRUHDFK HOHFWURGH6HSDUDWHWKHVKHHWVIURPHDFKRWKHU November 2, 2003 48953054-4081 Konelab Service Manual 9-24 Installation Instructions Version I +2:727$,/257(676 )RUHDFKWHVWFXVWRPHULVXVLQJFKHFNWKHIROORZLQJ &$/&75/'(),1,7,21 8VHDSRLQWQRWD FRPPDDVDGHFLPDO VHSDUDWRUHJLV ULJKWQRW 8QLWLVGHILQHGLQ WKH7HVWGHILQLWLRQ ZLQGRZDV5HVXOW XQLW F F Konelab Service Manual &KHFNYDOXHVDQGQDPHVRIFDOLEUDWRUV 'HILQHQDPHVRI4&VDPSOHV 48953054-4081 November 2, 2003 Version I Installation Instructions 9-25 7(67'(),1,7,21 0DNHVXUHWKDW WKHWHVWLVVHOHFWHG 7HVWLQXVH<HV F &KHFNDQGFRUUHFW 5HVXOWXQLW 1XPEHURIGHFLPDOV ,QFDVHWKHUHVXOWXQLWKDVEHHQFKDQJHGFKHFNDQGFRUUHFWDOVR 7HVWOLPLWYDOXHV 'LOXWLRQOLPLWYDOXHV 1RQOLQHDULW\OLPLWYDOXHLQFRQFHQWUDWLRQXQLW /LPLWYDOXHVIRUDQWLJHQH[FHVVFKHFNVDPSOH 5HIHUHQFHFODVVHVVKRXOGEHGHILQHGDFFRUGLQJWRWKHPHWKRGDQGXVXDO UHIHUHQFHUDQJHVXVHGLQWKHODERUDWRU\ November 2, 2003 48953054-4081 Konelab Service Manual 9-26 Installation Instructions Version I 4&3$5$0(7(56 F F 6HOHFW0DQXDOTFLQXVH<HV 6HOHFW5RXWLQH4&LQXVH<HV 'HILQH,QWHUYDODVUHTXHVWVRUWLPHOLNHKRXUV F ,QWURGXFHIRUERWKTXDOLW\FRQWUROW\SHV &RQWUROQDPH 0HDQYDOXH 6' 5XOHV Konelab Service Manual 48953054-4081 November 2, 2003 Version I Workstation Software 10-1 Section 10 Workstation Software 10.1 Konelab Folders.................................................................................................. page 10-3 10.1.1 Contents of the C:\Konelab -Folder....................................................... page 10-4 10.1.2 Contents of the C:\BIN -Folder .............................................................. page 10-5 10.2 Konelab Menus................................................................................................... page 10-6 10.2.1 Konelab Database Management ........................................................... page 10-7 10.2.1.1 Saving the Konelab Database to CD ............................. page 10-8 10.2.2 Konelab Instrument Management ......................................................... page 10-9 10.2.3 Konelab Instrument Selection................................................................ page 10-10 10.2.4 Konelab Language Selection ................................................................ page 10-11 10.2.5 Konelab LIMS Selection ........................................................................ page 10-12 10.3 Recycle BIN........................................................................................................ page 10-13 10.4 Volume Adjustment............................................................................................. page 10-14 November 2, 2003 48953054-4081 Konelab Service Manual 10-2 Konelab Service Manual Workstation Software 48953054-4081 Version I November 2, 2003 Version I Workstation Software 10-3 .RQHODEVRIWZDUHLVLQD&'520ZKLFKLVVHOIVWDUWLQJ,QFDVH\RXKDYHSUREOHPV WDNHDZD\WKH&'520IURPWKH&'520GULYHDQGSXWLWEDFN,ILWGRHVQ WKHOS WKH.RQHODEVRIWZDUHFDQEHRSHQHGE\WKHSURJUDPNRQHODE?VHWXSH[H,QVWUXFWLRQV WRLQVWDOOWKH.RQHODESURJUDPVDUHIRXQGIURPWKHIROGHU:UGLQWKH&'520 ,QVWUXFWLRQVDUHLQWKHILOHVNODELQVWGRFDQGNOZVFRQIGRF .RQHODE)2/'(56 F 7RVHHWKHIROGHUVRI.RQHODEGRXEOHFOLFNWKHLFRQ0\&RPSXWHU7KHQ GRXEOHFOLFNWKHGULYH&LFRQ )ROGHUVF?.RQHODEDQGF?REM\EHORQJWRWKH.RQHODESURJUDP7KHSURJUDPGRHVQ W ZRUNZLWKRXWWKHP 7KHUHFDQEHDOVRHJDIROGHUF?NRQHODE??H[H,WFRQWDLQVWKHILOHVRIROG .RQHODESURJUDPYHUVLRQ<RXFDQNHHSWKHROGHUSURJUDPYHUVLRQIRU WURXEOHVKRRWLQJSXUSRVHV F 'RXEOHFOLFNWKHIROGHULFRQV.RQHODEDQGREM\WRVHHWKHFRQWHQWVRIWKH IROGHUV November 2, 2003 48953054-4081 Konelab Service Manual 10-4 Workstation Software Version I &217(1762)7+(&?.RQHODE)2/'(5 7KH.RQHODEIROGHUFRQVLVWVRIIROGHUVGEH[HFRQILJWPSELQLQVWUXPHQWDQG UHVXOWV &?.RQHODE?GEIROGHU 7KHIROGHUGELQFOXGHVWKHGDWDEDVHRIXVHU7KHIROGHUPXVWLQFOXGHWKHILOHV.L .LIGEDQG.,:'%.,'%)XUWKHUPRUHWKHUHDUHIROGHUVWRVDYHDQGPDQDJHWKH GDWDEDVH &?.RQHODE?H[HIROGHU 7KHIROGHULQFOXGHV.RQHODEH[HSURJUDPVDQGILOHVYHUVLRQW[WDQGHUGDWDW[W7KH XVHULVQRWDOORZHGWRGHOHWHRUFKDQJHDQ\ILOHRIWKHIROGHU &?.RQHODE?FRQILJIROGHU 7KHIROGHULQFOXGHVILOHVNRQHODELQLXVHUWH[WW[WDQGUHSRUWLQL7KHRQO\DSSURYHG ZD\WRFKDQJHWKHILOHNRQHODELQLLVWRGRLWLQWKH&RQILJXUDWLRQZLQGRZLQWKH .RQHODESURJUDP7KHILOHXVHUWH[WW[WFRQVLVWVKHDGHUVRIUHSRUWVZKLFKWKHXVHUFDQ HGLW8VHUWH[WVDUHHGLWHGLQWKH5HSRUWIRUPDWVZLQGRZLQWKHVHFWLRQ*HQHUDO KHDGHU5HIHUWRVHFWLRQLQ5HIHUHQFHPDQXDO7KHILOHUHSRUWLQLLQFOXGHVWKH UHSRUWIRUPDWVZKLFKWKHXVHUKDVHGLWHGLQWKH5HSRUWIRUPDWVZLQGRZ &?.RQHODE?WPSIROGHU 7KHIROGHULQFOXGHVILOHVZKLFKDUHSURGXFHGGXULQJWKHXVHRI.RQHODESURJUDP )LOHVDUHPHDQWIRUVHUYLFH &?.RQHODE?ELQIROGHU 7KHIROGHULQFOXGHVILOHVIRUSURJUDPPDQDJHPHQWODQJXDJHFKDQJLQJHWF7KHXVHU LVQRWDOORZHGWRGHOHWHRUFKDQJHDQ\ILOHRIWKHIROGHU Konelab Service Manual 48953054-4081 November 2, 2003 Version I Workstation Software 10-5 &?.RQHODE?LQVWUXPHQWIROGHU 7KHIROGHULQFOXGHVIROGHUVIRULQVWUXPHQWPDQDJHPHQWHJDGMXVWPHQWYDOXHV7KH XVHULVQRWDOORZHGWRGHOHWHRUFKDQJHDQ\ILOHRIWKHIROGHU &?.RQHODE?UHVXOWVIROGHU 7KHIROGHULQFOXGHVUHVXOWILOHVWKDWDUHSURGXFHGZKHQWKHIXQFWLRQ3ULQWWRILOHLV XVHGLQWKH5HSRUWVZLQGRZ5HIHUWRVHFWLRQLQ5HIHUHQFH0DQXDO &217(1762)7+(&?ELQ)2/'(5 7KHELQIROGHULQFOXGHVILOHVZKLFKDUHQHHGHGWRPDQDJHWKHGDWDEDVH7KHXVHULV QRWDOORZHGWRGHOHWHWKHILOHV November 2, 2003 48953054-4081 Konelab Service Manual 10-6 Workstation Software Version I .RQHODE0(186 F 7RVHH.RQHODESURJUDPPHQXVFOLFNWKH6WDUWEXWWRQLQWKHOHIWFRUQHURI WKHZLQGRZDQGVHOHFW3URJUDPVIURPWKHOLVW NRQHODE F 7RVWDUW.RQHODESURJUDPFOLFNWKHNRQHODELFRQ:DLWXQWLOWKH8VHU LQWHUIDFHLVXS'RQRWVWDUWWKHSURJUDPLILWLVUXQQLQJDOUHDG\1RWHWKDWZKHQ .RQHODESURJUDPLVVWDUWHG57;5766&RQVROHDSSOLFDWLRQZLQGRZLVVHHQ '2127FORVHLW Konelab Service Manual 48953054-4081 November 2, 2003 Version I Workstation Software 10-7 .RQHODE'DWDEDVHPDQDJHPHQW 7KHPHQXLQFOXGHVIXQFWLRQVWRPDQDJHWKHGDWDEDVHLWLQFOXGHVGLIIHUHQWFRPPDQGV IRUWDNLQJDEDFNXSRIWKHGDWDEDVHDQGUHVWRULQJLW%HIRUHDQ\UHVWRUHWKHXVHU PXVW(;,7IURPWKH.RQHODESURJUDPLQWKH0DQDJHPHQWZLQGRZ7KH GDWDEDVHFDQEHFRQIXVHGLIUHVWRUHLVPDGHZKHQWKH.RQHODESURJUDPLVUXQQLQJ 6DYLQJFDQEHGRQHKHUHRULQWKH0DQDJHPHQWZLQGRZLQWKH.RQHODESURJUDP 6DYLQJUHVWRULQJPHDQVWKDWERWKURXWLQHGDWDEDVHDQGSDWLHQWDUFKLYHDUHVDYHG HLWKHUWRKDUGGLVNRUWR&'UHIHUWRVHFWLRQ2QO\URXWLQHGDWDEDVHFDQEH VDYHGWRUHVWRUHGIURPDGLVNHWWH,WLVUHFRPPHQGHGWRFOHDUWKHGDLO\ILOHVEHIRUH VDYLQJWKHURXWLQHGDWDEDVHWRDGLVN2WKHUZLVHVDYLQJFDQEHYHU\VORZDQGGHPDQG VSDFHWRRPXFK)RUWKH0DQDJHPHQWZLQGRZUHIHUWRVHFWLRQLQ5HIHUHQFH PDQXDO 7KHGHWDLOHGLQVWUXFWLRQVRIIXQFWLRQVLQWKH.RQHODE'DWDEDVHPDQDJHPHQWPHQX DUHLQWKH UHDGPH ILOH 6DYHGDWDEDVH 7DNHVDEDFNXSRIWKHFXUUHQWGDWDEDVHDQGSDWLHQWDUFKLYHRQKDUGGLVN 6DYHGDWDEDVHWR&' 7DNHVDEDFNXSRIWKHFXUUHQWGDWDEDVHDQGSDWLHQWDUFKLYHRQ&' 6DYHGDWDEDVHWRGLVNHWWH 7DNHVDEDFNXSRIWKHFXUUHQWGDWDEDVHWRDGLVNHWWHLQGULYHD7KLVRYHUZULWHVWKH SUHYLRXVGDWDEDVHLQGLVNHWWHLIWKHUHLVRQH 5HVWRUHVDYHGGDWDEDVH 5HVWRUHVWKHODWHVWGDWDEDVHEDFNXSWDNHQZLWK6DYHGDWDEDVHLIWKHUHLVRQH 5HVWRUHGDWDEDVHIURP&' 5HVWRUHVWKHGDWDEDVHEDFNXSIURPD&' 5HVWRUHGDWDEDVHIURPGLVNHWWH 5HVWRUHVWKHGDWDEDVHEDFNXSIURPDGLVNHWWHLQGULYHD&UHDWHVDXWRPDWLFDOO\D QHZSDWLHQWDUFKLYH1RWHWKDWLWGHOHWHVWKHROGRQH 5HVWRUHGHIDXOWGDWDEDVH 5HVWRUHVWKHGHIDXOWGDWDEDVHZLWK.RQHODESDUDPHWHUV5HFUHDWHVSDWLHQWDUFKLYH 5HVWRUH%DVLFGDWDEDVH 5HVWRUHVWKHEDVLFGDWDEDVHV\VWHPDQGWKHGHIDXOWGDWDEDVH5HFUHDWHVSDWLHQW DUFKLYH7KLVVKRXOGEHXVHGRQO\LIRWKHUUHVWRUHIXQFWLRQVGRQRWZRUN 8VH5HVWRUHVDYHGGDWDEDVHDIWHUWKLVWRUHVWRUHWKHODWHVWEDFNXS 5HVFXHVDYHGGDWDEDVH 5HVWRUHVWKHDXWRPDWLFGDWDEDVHDQGSDWLHQWDUFKLYHEDFNXSWDNHQDIWHUODVW&OHDU GDLO\ILOHV 5HFUHDWHSDWLHQWDUFKLYH 5HFUHDWHVSDWLHQWDUFKLYH1RWHWKDWLWGHOHWHVWKHROGRQHDOVRUHVXOWV,QWKH &RQILJXUDWLRQZLQGRZSDWLHQWDUFKLYHLVUHFUHDWHGDXWRPDWLFDOO\ZKHQLWKDVEHHQ RXWRIXVHDQGLWLVWDNHQLQWRXVHDJDLQ November 2, 2003 48953054-4081 Konelab Service Manual 10-8 Workstation Software Version I 6DYLQJWKH.RQHODEGDWDEDVHWR&' ,I\RXXVHUHZULWDEOH&'5:GLVFVQRWHWKDWWKHQHZEDFNXSILOHVUHSODFHVWKHROG RQHV We recommend to use one CD for one backup. ,I\RXXVHZULWHRQFH&'5GLVFVRQFHWKHGLVFLVIXOO\RXFDQRQO\UHVWRUH EDFNXSVIURPLW +RZWRPDNHGDWDEDVHEDFNXSXVLQJ&'5:GULYH NOTE! You must format CD-R(W) discs before you can use them. You can start the formatting by inserting a new, unformatted disc into CD-RW drive. The formatting has to be done only once for each disc. F ,QVHUWDGLVFLQWR&'5:GULYH )RUPDWWKHGLVFLIQHFHVVDU\ 7KH'LUHFW&'ZL]DUGVKRXOGDSSHDUDXWRPDWLFDOO\,IQRWVWDUW 'LUHFW&'PDQXDOO\'RXEOHFOLFNWKH&'LFRQLQWKHULJKWFRUQHURI WKHGLVSOD\EHVLGHWKHWLPH 7KHZL]DUGZLOOJXLGH\RX6HOHFW'LUHFW&'IRUPDW ±1H[W ±1H[W ±)LQLVK&'LVIRUPDWWHG ±2N F 6HOHFW)6DYH'%WR&'LQWKH0DQDJHPHQWZLQGRZRU6DYHGDWDEDVHWR &'LQWKH.RQHODE'DWDEDVHPDQDJHPHQWPHQXWRPDNHDEDFNXS ,ISUREOHPVRFFXUFKHFNLQWKH&RQILJXUDWLRQZLQGRZWKDWWKHGULYHRIWKH&'LV ULJKW F F (MHFWWKHGLVF:KHQSURPSWHGIRUVHOHFWRSWLRQ³/HDYHWKHGLVFDVLWLV«´ 6WRUHWKHGLVFLQDVDIHSODFH +RZWRUHVWRUHWKHEDFNXSIURP&' NOTE! Databases are named like Save4020.db where first two numbers (40) express the software version and two last ones (20) instrument type. Konelab Service Manual F F ,QVHUWDEDFNXSGLVFLQWR&'GULYH 6HOHFW5HVWRUH'%IURP&'IURPWKH.RQHODE'DWDEDVHPDQDJHPHQWPHQX 48953054-4081 November 2, 2003 Version I Workstation Software 10-9 .RQHODELQVWUXPHQWPDQDJHPHQW .RQHODELQVWUXPHQWPDQDJHPHQWPHQXLQFOXGHVVDYLQJDQGUHVWRULQJSRVVLELOLWLHVIRU FRQILJXUDWLRQ,WLQFOXGHVFRQILJXUDWLRQYDOXHVXVHUIRUPDWUHSRUWDQGKHDGHUVRI UHSRUWVZKLFKWKHXVHUKDVHGLWHG F 6DYLQJDQGUHVWRULQJSRVVLELOLWLHVIRUDGMXVWPHQWYDOXHVFRQFHUQVRQO\ .RQHODE'HIDXOWDGMXVWPHQWVFDQEHUHVWRUHGLQFDVHRISUREOHPVLWXDWLRQ F 8SGDWHGLVNHWWHIRUWKHLQWHUQDO3&IRU.RQHODEDQGFDQEHPDGH KHUH3XWDQHPSW\GLVNHWWHWRDGLVNGULYHDQGJLYHDFRPPDQG7KHXSWRGDWH GDWDLVORDGHG$VSDUHGLVNHWWHLVJRRGWRNHHSIRUWURXEOHVKRRWLQJSXUSRVHV November 2, 2003 48953054-4081 Konelab Service Manual 10-10 Workstation Software Version I .RQHODELQVWUXPHQWVHOHFWLRQ F ,QFDVHRIVRPHLQVWUXPHQWW\SHPLVPDWFKLWLVQHFHVVDU\WRVHOHFWWKH FRUUHFWLQVWUXPHQWIURPWKLVLQVWUXPHQWVHOHFWLRQPHQX Konelab Service Manual 48953054-4081 November 2, 2003 Version I Workstation Software 10-11 .RQHODEODQJXDJHVHOHFWLRQ F 6HOHFWWKHODQJXDJHZKLFKWKH.RQHODESURJUDPLVXVLQJIURPWKH.RQHODE ODQJXDJHVHOHFWLRQPHQX'RQRWFKDQJHWKHODQJXDJHLIWKH.RQHODESURJUDPLV UXQQLQJ F .H\ERDUG'DWH7LPH5HJLRQDOVHWWLQJVHWFDUHFKDQJHGIURP6WDUW 6HWWLQJV&RQWUROSDQHO November 2, 2003 48953054-4081 Konelab Service Manual 10-12 Workstation Software Version I .RQHODE/,06VHOHFWLRQ F Konelab Service Manual 6HOHFWWKH/,06SURWRFROIURPWKH.RQHODEOLPVVHOHFWLRQPHQX 48953054-4081 November 2, 2003 Version I Workstation Software 10-13 5(&<&/(%,1 F $OOGHOHWHGLWHPVDUHJDWKHUHGWRWKH5HF\FOH%LQ7RFOHDQWKH5HF\FOH%LQ GRXEOHFOLFNWKHLFRQWKHQVHOHFW)LOH(PSW\5HF\FOH%LQ&RQILUPWKHVHOHFWLRQ DQGFORVHWKHZLQGRZ November 2, 2003 48953054-4081 Konelab Service Manual 10-14 Workstation Software Version I 92/80($'-8670(17 9ROXPHEXWWRQ F 7RDGMXVWWKHYROXPHFOLFNWKHYROXPHLFRQLQWKHULJKWFRUQHURIWKH ZLQGRZ$FWLYDWHWKHYROXPHEXWWRQE\PRYLQJWKHFXUVRUDERYHWKHEXWWRQDQG SUHVVLQJWKHPRXVH VOHIWEXWWRQGRZQ0RYHWKHPRXVHWRDGMXVWWKHYROXPH,I \RXZDQWWKHYROXPHRIIFOLFNWRWKHVTXDUH 0XWH &ORVHWKHDGMXVWPHQWE\ FOLFNLQJHOVHZKHUHLQWKHZLQGRZ Konelab Service Manual 48953054-4081 November 2, 2003