Download Daikin MC707B Flash Streamer Air Purifier Operation Manual
Transcript
OPERATION MANUAL MODEL MC707VM-S MC707VM-W Fr om Ai rC on tro l Sy st em s PHOTOCATALYTIC AIR PURIFIER RIF Contents Features ................................................................ 1 Accessory.............................................................. 1 Tips for Appropriate Use ....................................... 1 Specification.......................................................... 1 Safety Precautions ................................................ 2 Names and Operation of each Part....................... 3 Preparation Before Operation ............................... 5 How to Operate .................................................... 7 Care and Cleaning ................................................ 8 Tips for Appropriate Use Select a place where air is circulated throughout the room. The air blows slightly slant to the right. When you want to remove house dust, setting up the air purifier in low rooms is effective. When you want to remove cigarette smoke, setting up the air purifier in high rooms is effective. Placing the air cleaner on the other side of the air conditioner will improve air circulation effect (effect of circulating air). (See the below diagram.) :KHQDLUFRQGLWLRQLQJWKHURRPIOXFWXDWLRQVLQWKHURRP temperature are controlled while cleaning the air. 3OHDVHVHOHFWIRUWKHDLUWREHVSUHDGDOORYHUWKHLQVLGH 3ODFHLQDVWDEOHSODFHZKHUHOHJVRIWKHERG\DUHVHFXUHG Failing to do so may cause shaking of the main unit. e ma Trouble Shooting................................................. 16 Features 1 Powerful deodorization Decomposition of odor with high deodorizing power. 2 Elimination of formaldehyde Airflow Ai rC on tro l Quick decomposition of formaldehyde and other molecules that arise constantly with high decomposition power of streamer discharge. (Streamer discharge fizzes but it is not abnormal.) Sy st em s Frequently asked questions ................................ 16 3 Elimination of virus and pollen Energy from streamer discharge makes decomposition power of photocatalytic titanium apatite more powerful. Powerful removal oval off pollen, mold and house tick. 4 What is streamer discharge? It is the function of quickly decomposing odor and harmful rmful gas by generating oxidative high-speed electron within the air cleaner. (It is safe because high-speed electron is generated nerated erated and disappeared within the system.) Fr om Accessory Specification Model MC707VM-S, MC707VM-W Required power supply 1ø220-240/220-230V 50/60Hz Outer dimensions 533×425×213 Rated power consumption (W) 55/55 (Turbo) Air flow rate (m /h) HH: Turbo 420/420 H : High speed 285/285 M : Standard speed 180/180 L : Low speed 120/120 LL : Quiet speed 60/60 Applicable room area – 48m2 Weight 8.7 3 Confirm that accessory parts are in n order. 1 sheet is on back of the body and 6 sheets for replacement are stored in the filter housing. Pleated filter (7 sheets) 1 / English Bio-antibody filter (1 sheet) Wireless remote controller (Coin type battery CR2025 set included) Safety Precautions 'RQRWXVHQHDUWRVRXUFHVRIKHDWVXFKDVKHDWHUV Heat can discolor and deform the casing. Keep the unit and remote control minimum 2m from WARNING If you do not follow these instructions exactly, the unit may cause property damage, personal injury or loss of life. CAUTION If you do not follow these instructions exactly, the unit may cause minor or moderate property damage or personal injury. Be sure to follow the instructions. Never touch the air purifier (including the remote controller) with a wet hand. Never cause the air purifier (including the remote controller) to get wet. <RXQJFKLOGUHQVKRXOGEHVXSHUYLVHGWRHQVXUHWKDWWKH\ GEHVXSHUYLVHGWR HVXSHUYLVH GRQRWSOD\ZLWKWKHDSSOLDQFH HDSSOLDQFH DSSOLDQFH When using pesticides sticides ides of an in indoo indoor fumigation type st Never do. WARNING 'RQRWXVHSRZHUVXSSOLHVRWKHUWKDQWKHUDWHGVXSSOLHV VXSSOLH VXSSOLHV Fire or electric shock may occur. 'RQRWGDPDJHWKHHOHFWULFDOSRZHUFRUGFRQVWUXFW FRQVWUXFW VWU LVWWKHFRUG DQ\WKLQJRUIRUFLEO\EHQGVWUHWFKRUWZLVWWKHFRUG USODFHWKHFRUG ODFHWKH 'RQRWVHWKHDY\LWHPVRQWKHFRUGRUSODFHWKHFRUG EHWZHHQLWHPV If the electrical power cord is damaged, d, fire re or electric shock may occur. %HIRUHFKDQJLQJILOWHUVFOHDQLQJWKHHTXLSPHQWRUPRYLQJLW LQJ KHHTXLSPH HTXLSPH SRZHUF H EOH H WXUQLW2))DQGXQSOXJWKHSRZHUFDEOH Working with power ON can an lead ad to fire and/or d electric shock. 'RQRWXVHWKHSRZHUFDEOHLIGDPDJHGRUORRVHLQWKHVRFNHW EOHLIGDPDJHGRU LIGDPDJHGR Using the power cable le in n anything but bu proper working condition can lead to short-circuits hort-circuits and subsequently electric shock and/or fire. e. 'RQRWXVHLQKXPLGSODFHVRUSODFHVZKLFKPLJKWEH LQKXPLGSODFHV DVEDWKURRPV ZHWVXFKDVEDWKURRPV water can lead to electric shock or damage the Contact with wate equipment. 'RQRWXVHZKHUHRLOFRPSRQHQWVVXFKDVPDFKLQHRLO DUHIORDWLQJDURXQG There is the danger of cracking, electric shock or combustion. 'RQRWZHWWKHDLURXWOHWRUWKHPDLQXQLW It may cause fire or electric shock. Fr om IXPHUHOHDVHVWRSWKHRSHUDWLRQRIWKHDLUSXULILHUWR HVWRSWKHRSHUDWLR WRSWKHRSH QRQHRIWKHFKHPLFDOLVVXFNHGLQVLGHWKHXQLW HFKHPLFDOLVVXFNH PLFDOLVV The chemical components will mical componen w accumulate inside the unit and depending physical nding ding on your phy physica condition, you may react to the irritation which iss bad for your h health. he :KHQXVHGLQFRQMXQFWLRQZLWKDKXPLGLILHUNHHSPLVW :K :KH VHGLQFRQMX HGLQF IURPEH RPE JGLUHF IURPEHLQJGLUHFWO\GUDZQLQWRWKHXQLW Mists can lead d to electric shock and/or equipment damage. 'RQRWEORFNWKHLQWDNHRURXWOHW 'RQRWE QRWE Blocked openings can reduce capacity (air will not be cleaned Block thro throughout the entire room) and/or damage the equipment. 'RQRWSODFHDQ\FRQWDLQHUVZKLFKKROGZDWHUVXFKDV JROGILVKERZOVRUIORZHUYDVHVRQRUFORVHWRWKHXQLW If water gets inside the unit, electric shock or malfunction may occur. 'RQRWZLSHZLWKEHQ]LQHRUWKLQQHURUVSUD\ZLWK LQVHFWLFLGH Such substances can cause cracking, electric shock and/or fire. ,IQRWXVLQJWKHXQLWIRUORQJSHULRGVRIWLPHXQSOXJWKHSRZHUFDEOH Dielectric breakdown can lead to leakage current and subsequently electrical shock and or short-circuit may occur causing a fire. ,IWKHSRZHUSOXJLVXQSOXJJHGEHVXUHWRKROGDQGSXOORXW WKHHQGRIWKHSRZHUSOXJZLWKRXWKROGLQJWKHSRZHUFRUG There is a chance that an electrical short or short-circuit may occur causing a fire. 'RQRWRSHUDWHZLWKDSUHILOWHURUILOWHUUHPRYHG Malfunction may occur. Ai rC on tro l 'RQRWXVHWKHSRZHUFDEOHLILWLVGDPDJHG Using a damaged power cable is extremely hazardous; if the power cord becomes damaged, you must obtain a replacement from the manufacturer or from a properly-authorized service agent. Do not attempt replacement yourself. 'RQRWGLVDVVHPEOHUHPRGHORUDWWHPSWWRVHUYLFHWKLV HTXLSPHQW Unwarranted tampering can lead to fire and/or malfunction. 'RQRWRSHUDWHZLWKZHWKDQGV Electric shock may occur. s OLJKWLQJ79VUDGLRVVWHUHRVDQGDHULDOV This unit can disturb TV pictures and generate interference. Illumination can weaken remote controller signal reception sensitivity and discolor the casing. 'RQRWXVHLQWKHSODFHRINLWFKHQIDQVRUFRRNHUKRRGIDQV Adverse conditions of use can shorten service-life of the prelilter and ion filter, as well as lead to equipment damage. 3UHYHQWFRPEXVWLEOHVKDLUVSUD\VHWFVSDUNVDQGLQFHQVH IURPEHLQJGUDZQLQWRWKHXQLW Such substances can cause fire. 'RQRWLQVHUWILQJHUVRUIRUHLJQREMHFWVLQWRWKHLQOHWRU RXWOHWRSHQLQJV Electric shock or damage may occur. There exists a danger of hands getting ting caught in the motor and causing injury. 7KHDSSOLDQFHLVQRWLQWHQGHGIRUXVHE\\RXQJFKLOGUHQ HGIRUXVHE\\RXQJ RUXVHE\\R RULQILUPSHUVRQVZLWKRXWVXSHUYLVLRQ WVXSHUYLVLRQ SHUYLVLRQ em cautions carefully. This manual classifies precautions into WARNING and CAUTION. Be sure to follow all precautions below: they are all important for ensuring safety. Sy Keep this manual where the operator can easily find them. Read this manual attentively before starting up the unit. For the reason of safety the operator must read the following CAUTION 'RQRWXVHFORVHWROLJKWLQJHTXLSPHQWZLWKLQP The reception sensitivity of the remote controller may be reduced and the color may change. 'RQRWXVHRXWGRRUVRUZKHUHH[SRVHGWRGLUHFWVXQOLJKW Direct sunlight can weaken remote controller signal reception sensitivity and discolor the casing. 'RQRWVLWRQVWDQGRQRUVKDNHWKHXQLW Malfunction may occur. 'RQRWXVHZKHQWKHXQLWLVRQLWVVLGHRUOHDQLQJ Malfunction may occur. :KHQXVLQJDQRWKHUEXUQHUDWWKHVDPHWLPHDFWLYHO\ YHQWLODWHWKHDUHD 7KLVXQLWFDQQRWUHPRYHFDUERQPRQR[LGH If the ventilation is not sufficient, carbon monoxide poisoning may occur. 'RQRWXVHLQORFDWLRQVZKHUHWKHUHLVDODUJHDPRXQWRI VRRWVXFKDVDNLWFKHQRUORFDWLRQVZKHUHWKHUH FRPEXVWLEOHJDVFRUURVLYHJDVRUPHWDOOLFGXVWLV SUHVHQW Fire or malfunction may occur. Toxic substances such as cigarettes (carbon monoxide) cannot be removed. English / 2 Names and Operation of each Part Main unit Front 6 4 8 Shock-absorbing material (cardboard) 13 12 3 5 Sy st em s Be sure to remove the shock-absorbing material before operating. (page 5.) 10 2 11 Pleated filter Rear 16 14 15 Ai rC on tro l 14 7 1 1 Front panel 2 Main unit display (page 4.) Shows operation status. 3UHILOWHUJUHHQ Fr om Removes comparatively large material erial and an dust. us 9 21 19 Stores the accessory remote controller. 16 Handle Use when moving the main unit. ZKLWH KLWH %LRDQWLERG\ILOWHUZKLWH 1HJDWLYHLRQL]DWLRQDVVHPEO\ 7 Ionized wire Small dust particles es which whic wh are captured by the pre-filter are positively charged to tthat they can be more easily absorbed by the negatively-charged pleated filter. Generates negative ions. Functions to combine positively charged toxic substances in a room and neutralize and transform them. ,IVWDWLFHOHFWULFLW\LVDSSOLHGWKHDPRXQWRIQHJDWLYHLRQV generated will be temporarily reduced. 3RZHUVXSSO\FRUGKRRN Winds the power supply cord when storing the main unit. Do not wind the cord during operation. 8 Streamer discharger 20 Power supply cord 9 Opposing pole plates 21 Wall-hang clasp attachment 3OHDWHGILOWHUIURQWZKLWHEDFNEOXH Absorbs dust particles using the principle of static electricity. 'HRGRUL]LQJFDWDO\VWEODFN Absorbs and decomposes elements which could not be removed before returning the air back to the room. Note: cannot be washed with water. 12 Filter container Six replacement pleated filters are included. 13 Ventilation fan 3 / English 20 15 Remote controller storage slot 17 Air outlet 6 Ionizing frame me 19 14 Air inlet 4 Plasma ionizer Absorbs viruses. 17 18 Main unit display 2 4 3 5 13 6 9 10 11 12 14 $XWRPDWLFRSHUDWLRQLQGLFDWRU\HOORZ QGLFDWRU\HOORZ DWRU\HOOR &OHDQPRQLWRU'XVW Detects the dirty state of the air and indicates the results. Indicator Off On Green Low Lit during automatic operation. ration. on. $LUIORZUDWHLQGLFDWRUJUHHQ FDWRUJUHHQ WRUJUHHQ (page 7.) ow rate te setting. Lit by the set airflow e lamp mp is on during dur a (The air volume automatic or manual operation.) st Air is taken in from here and the dust sensor detects the dirty state of the air. Dust 8 (page 7.) 7XUERPRGHLQGLFDWRUJUHHQ RGHLQGLFDWRUJUH QGLFDWRU g turbo mode. mode Lit during Sy $LULQWDNHIRUGXVWVHQVRU 7 15 em s 1 7 Pollen en n mode indicator indica indicato (page 7.) Litit during d ng pollen mode. mode <HOORZ Green 8 Negat Negative ega iion m mode indicator (page 7.) Red High Ai rC on tro l Indicates during negative ion operation. <HOORZ Green ,QWKHIROORZLQJFDVHRQO\WKHJUHHQOLJKWLVRQIRUWKHILUVW ILUVW 7 seconds regardless of pollution from the air. 2SHUDWLRQGLUHFWO\DIWHUVHWWLQJWKHIURQWSDQHOSODVPDLRQL]HU SODVPDLRQL]HU 2SHUDWLRQGLUHFWO\DIWHULQVHUWLQJWKHSRZHUSOXJ SOXJ OXJ <RXFDQFKDQJHVHQVLWLYLW\VHWWLQJRIWKHGXVWVHQVRUODPS XVWVHQVRUODPS HQVRUODP &OHDQPRQLWRU2GRU Detects changes to odors and indicates es s the results. Odor Indicator Green Fr om Weak Green Green Off On (page 7.) 2))WL 2))WLPHUVHWWLQJLQGLFDWRU\HOORZ 2)) Indic Indicates the set OFF timer time. Indicates the time passed as well as the remaining time after the In setting. &OHDQLQGLFDWRUUHG (pages 11, 12.) The lamp will blink for cleaning time of the plasma ionizer. 5HSODFHLQGLFDWRUUHG5HVHWEXWWRQ The lamp will be on for replacement time of the pleated filter and blink after certain time has elapsed from the turning on. * Press the reset button after replacement. (page 10.) /RFNODPS (page 7.) Lit during lock. $LULQWDNHIRURGRUVHQVRU Air is taken in from here and the odor sensor detects the odor state. 14 Receiver <HOORZ <HOORZ Receives signals from the remote controller. 2SHUDWLRQVZLWFKVWRSEXWWRQ Red Strong 5HDFWLRQVWRVXGGHQWHPSHUDWXUHKXPLGLW\FKDQJHVDQGRGRUOHVV XGG XG gas (carbon monoxide) may occur. 7KHUHPD\QRWEHDQ\UHDFWLRQIRUDXQLIRUPFDVHZLWKRXWDQ\ changes to the intensity of the odor. 7KHUHPD\EHQRUHDFWLRQWRSHWRGRUVRUJDUOLFRGRUV 'LIIHUHQWSHRSOHKDYHGLIIHUHQWVHQVLWLYLW\WRRGRUVVR\RXPD\QRW notice an odor even though the lamp is green. ,QWKHIROORZLQJFDVHRQO\WKHJUHHQOLJKWLVRQIRUWKHILUVW 1 minute and this state is regarded as the reference value of the odor sensor. 2SHUDWLRQGLUHFWO\DIWHUVHWWLQJWKHIURQWSDQHOSODVPDLRQL]HU 2SHUDWLRQGLUHFWO\DIWHULQVHUWLQJWKHSRZHUSOXJ Each time this button is pressed, the operation mode switches as shown below. * During automatic operation the airflow rate at that time will also be lit. English / 4 Preparation Before Operation Remote controller setup Remote controller Do not drop or place the remote controller in water. 5HPRWHFRQWUROOHU preparations (Damage may occur.) Do not press the remote controller buttons with sharp objects. %DWWHU\LVDOUHDG\VHWLQWKHUHPRWH controller but the remote controller cannot be used as is without first preparing it. Use the remote controller after pulling out the clear sheet from the battery cover. (Damage may occur.) The signals may not be received well of electronic lighting style fluorescent lamps (such as inverter fluorescent lamps) are in the same room. For these cases, discuss with the dealer. If other electrical device operate by the remote controller, either separate them from the remote controller or discuss with the dealer. Attaching the pleated filter 5HPRWHFRQWUROOHUVWRUDJH WARNING :KHQWKHUHPRWHFRQWUROOHULVQRW being used, you can store it in the remote controller storage slot. Sy st em s Set the filter while the power supply ly plug g is not plugged in CAUTION TION The unit must be operated ed d with a pre-filte pre-filter. 8VLQJWKHUHPRWHFRQWUROOHU operated, malfunctions may occur. If they are not set and the unit is opera %DWWHU\UHSODFHPHQW 5HPRYHWKHIURQWSDQHO IURQWSDQHO WSDQHO 3ODFH\RXUILQJHUVLQWKHLQGHQWDWLRQVRQWKHERWWRPRIWKHXQLW UILQJHUVLQWKHLQGHQW JHUVLQWKHLQG and pull forward, holdi holding on to the bottom of the panel. Front panel Ai rC on tro l 3RLQWWKHWUDQVPLWWHURIWKHUHPRWH controller towards the receiver of the main unit. If an obstruction to the signal, such as a curtain, exists, the remote controller will not operate. 7KHGLVWDQFHIURPZKLFKWKH remote controller can transmit is approximately 6m. Receiver 1. Open the cover on the rear of the remote controller towards the arrow. 2. Replace the battery with CR2025 battery. (Be sure to set the battery with the + side of the cover as shown in the figure.) 3. Close the cover to its original position. CAUTION Do this before plugging the unit into a power supply. Always install the pleated filter before running the unit. 5HPRYHWKHVKRFNDEVRUELQJPDWHULDODQGWKHQUHPRYH WKHSODVPDLRQL]HU 1) Remove the shock-absorbing material. NOTE Fr om Store the batteries where babies abiess and childr children child cannot reach them. s swallowed, owed, be ssure to contact a doctor If, by chance, a battery is immediately. When discarding batteries, atteries, ies, cover th the terminals of the batteries with tape. If mixed with other heat, explosion or combustion ther metal or batteries, b ba may occur. Bring the batteries to a nearby n electronics store, watch store or camera store to recycle them. ATTENTION Battery The included coin type battery is prepared for initial use. They will be consumed within 1 year from the manufacturing date of the air purifier. A replacement target is approximately 1 year but if the reception becomes difficult, replace the batteries with new coin type battery CR2025. Coin type battery close to the “recommended usage period” may need to be replaced soon. In order to prevent malfunctions or injuries due to leaking or explosions, be sure to remove the coin type battery when the unit will not be used for a long period of time. 5 / English Shock-absorbing material (cardboard) 2) Holding the handle, lift towards yourself and remove from the top 2 hooks. Plasma ionizer Hooks (one left and one right) $WWDFKLQJWKHELRDQWLERG\ILOWHU $WWDFKWKHSOHDWHGILOWHU 5HPRYHWKHSOHDWHGILOWHUIURPWKHEDJ 5HPRYHWKHSUHILOWHU Pleated filter The side with the three holes goes up. 5HPRYHE\SXOOLQJRXWLQIURQWZKLOHKROGLQJWKHWDEVRQWRSRIWKH pre-filter. 1) Pull out in front to remove. 3) 3) 2) 4) 2) The white side should be facing you. Pre-filter 1) Place the pleated filter holes on the 3 upper tabs of the deodorizing catalyst unit. Sy st em s $WWDFKWKHELRDQWLERG\ILOWHU Deodorizing Securing tape catalyst unit +RRNRQWKHWRSDQGERWWRPKRRNVLQVHUWLQWRWKHOHIWDQGULJKW hooks, and then secure with the tape. +RRNWKHKROHVORFDWLRQVRIWKHELRDQWLERG\ILOWHURQWKHKRRNV IWKHELRDQWLERG\IL ELRDQWLERG zer. (2 locations) of the plasma ionizer. Top hooks (2 locations) Holes (2 locations) ns) Bio-antibody filter Bio-antib 5HVWRUH 5HVWRUHWKHSUHILOWHU 5HVWR KHSU +RRNWK +RRNWKHERWWRPSDUWRIWKHSUHILOWHURQWKHERWWRPKRRNV +RRNW 2 lo loc (2 locations) of the plasma ionizer and then insert it into the left and an right hooks (4 locations). Ai rC on tro l 2) Hook the holes of the pleated filter on the bottom hooks. (2 locations) Left and right hooks (4 locations) 3) Insert the pleated filter into the left and right hooks. Fr om 4) Secure the pleated filter with th the tape. Plasma ionizer Hooks (2 locations) 5HVWRUHWKHIURQWSDQHO +RRNWKHWRSKRRNVORFDWLRQVRIWKHIURQWSDQHORQWKHJURRYHV on top of the main unit and then close the panel. Top hooks (3 locations) Top grooves (3 locations) ,QVWDOOWKHSODVPDLRQL]HULQ ODVPDLRQL]HU ODVPDLRQL]HU DOFRQILJXUD DOFRQILJXUDWLR LWVRULJLQDOFRQILJXUDWLRQ +ROGLQJWKHKDQGOHVQDSRQWRWKHXSSHUKRRNVDQGSXVKLQ KHKDQGOHVQ DVPD DVPDLR ,QVHUWWKHSODVPDLRQL]HUIXOO\ Pre-filter Hook Overhead view Front panel NOTE Securely close the panel. Failing to do so may cause activation of the safety switch and out of unit operation. Plasma ionizer NOTE Only run the unit with the pre-filter and pleated filter in place. If they are not in place, running the machine may break it. If the front and blue sides of the pleated filter are reversed, the unit’s performance will suffer. ATTENTION The bio-antibody filter is a dedicated filter to speed up virus elimination. Use it in winter when air is dry and virus is easy to grow. Change and storage (page 9.) * The air cleaning effect remains regardless of the attachment. English / 6 Preparation Before Operation 5 When you want to remove pollen 3UHVVWKH³ ´>$17,32//(1@EXWWRQ 3UHVVLQJDJDLQZLOOFDQFHO 6ZLWFKLQJWKHDLUIORZVSHHGHYHU\PLQXWHVEHWZHHQ “ ” M (Standard) and “ ” L (Low) will catch pollen before they fall on the floor. Installation of main unit To install the unit, comply with the following standards to ensure performance. 〈,ILQVWDOOHGRQDWDEOH〉〉 :KHQ\RXH[SHOQHJDWLYHLRQV 3UHVVWKH³ ´>5(/$;@EXWWRQ 3UHVVLQJDJDLQZLOOFDQFHO *HQHUDWHVQHJDWLYHLRQV 7 When you want to decide a time to stop operation Min. 100cm 3UHVVWKH³ ´>2))7,0(5@EXWWRQ (DFKWLPHLWLVSUHVVHGWKHWLPHUVHWWLQJVZLWFKHVDVVKRZQEHORZ The remaining time will be lit in the “OFF timer setting indicator”. Airflow “ 1 ” (1 hour) Min. 50cm Min. 50cm “ 4 ” (4 hour) (Cancel) HUDWLRQZLOO RQZ :KHQWKHVHWWLPHLVUHDFKHGWKHRSHUDWLRQZLOODXWRPDWLFDOO\ stop. 7KHVHWWLPHFDQEHFKDQJHGLIWKHEXWWRQLVSUHVVHGZKLOHWKH WKHEXWWRQLVSUHVVH XWWRQLVSUHV timer is operating. m s Min. 10cm “ 2 ” (2 hour) If operated outside the conditions shown below, malfunction may occur. ,QGRRUWHPSHUDWXUH& ,QGRRUKXPLGLW\RUOHVV Sy st e :KHQ\RXZDQWWRFKDQJHWKHEULJKWQHVVRIWKHSKRWR QJHWKHEULJKWQHV WKHEULJKW operation lamp and clean lean monitors monitor ATTENTION 3UHVVWKH³ ´>%5,*+71(66@EXWWRQ %5,*+71(66@EXWWR *+71(66@E (DFKWLPHLWLVSUHVVHGWKHGLVSOD\ZLOOVZLWFKDVVKRZQEHORZ UHVVHGWKHGLVSOD\Z HGWKHGLVS (Dark) (Off) ( (Standard) 2QO\VHWWR2))ZKHQ\RXDUHFRQFHUQHGDERXWOLJKWFRPLQJIURP HWWR2))ZKHQ\RXD WWR2))ZKHQ\ the main sleeping. The photo operation will ain n unit such as when wh w stop with the display going Off so if it is always Off, top op simultaneous ultaneous aneous wit the e odor odo od removal moval and a anti-bacterial performance will drop How to Operate Ai rC on tro l 9 When you want to prevent incorrect operation 9 1 2 3 5 4 6 8 7 Fr om 3UHVVWKH>212))@EXWWRQ WRQ Pressing again will stop. p. NOTE 2 When you want to automatic automatica automatically switch the airflow rate 3UHVVWKH³ ´>$872@EXWWRQ ´>$872@EX \DGMXVWVWKH \DGMXVWVWKHD $XWRPDWLFDOO\DGMXVWVWKHDLUIORZUDWHWR³ ´//4XLHW “ ” L (Low), “ ” M (S (Standard), “ ” H (high) in response to the dirty condition of the he air. 3 When you want to manually switch the airflow rate 3UHVVWKH³ ´>)$163(('@EXWWRQ (DFKWLPHLWLVSUHVVHGWKHDLUIORZUDWHVZLWFKHVDVVKRZQEHORZ allowing you to choose your desired flow. “ ” “ ” L (Low) “ ” M (Standard) “ ” H (High) 7KHVHWWLQJ³ ´//4XLHWLVDYHU\VORZDLUIORZUDWHDQGLV convenient when sleeping. :KHQ\RXZDQWWRTXLFNO\FOHDQWKHDLU 3UHVVWKH³ ´>785%2@EXWWRQ 3UHVVLQJDJDLQZLOOFDQFHO $KLJKDLUIORZUDWHZLOOTXLFNO\UHPRYHDQ\GLUWLQHVVLQWKHDLU 7KLVLVFRQYHQLHQWWRXVHZKHQFOHDQLQJ 7 / English When you want to operate the unit using WKHEXWWRQRQWKHPDLQXQLW When the remote controller is not in your hand, you can use the ³ ´>2SHUDWLRQ6ZLWFK6WRS@EXWWRQRQWKHPDLQXQLWZLWKRXWXVLQJWKH remote controller. (page 4.) 1 When operating LL (Quiet) 3UHVVWKH 3UHVVWKH³ 3UHVVWK ´>/2&.@EXWWRQIRUVHFRQGV 3UHVVLQJDJDLQIRUVHFRQGVZLOOFDQFHO 3UHVVLQ 6WRSVWKHIXQFWLRQRIWKHEXWWRQRWKHUWKDQWKH³ ´>/2&.@ 6 6WR button on the main unit and buttons on the remote controller. 7KLVPDNHVLWSRVVLEOHWRSUHYHQWFKLOGUHQIURPRSHUDWLQJWKHXQLW incorrectly. :KHQ\RXZDQWWRUHOHDVHWKHFKLOGORFNVHWWLQJVDQGWKHUHPRWH controller is not in your hand, remove the power plug once and then reinsert it and operate the unit. The unit will not operate for 3 seconds after the front panel or plasma ionizer is set or power plug is inserted even though “ ” button on the remote controller is pressed. Operation will stop for safety when the front panel is opened during operation. When an incorrect operation is performed during operation If the main unit display is abnormally on or remote controller is disabled due to thunder or radio transmission during operation, pull the power plug and then re-insert it after 3 seconds. Care and Cleaning Cleaning chart )RUFOHDQLQJUHPRYHHDFKSDUWLQWKHQXPEHURUGHU )RUUHVWRULQJHDFKSDUWIROORZWKHRSSRVLWHRUGHU CAUTION Stop operation and pull the power plug before cleaning. &OHDQLQJWKHDLULQOHWIRUWKHGXVWRGRU sensor &OHDQGXVWVFORJJHGLQ the air inlet for the dust/ odor sensor. 8VHFUHYLFHQR]]OHRID cleaner for cleaning. Air inlet for the dust sensor Air inlet for the odor sensor 1 2 5 6 3 Cleaning the front panel :LSHRIIWKHGLUWZLWKD cloth or tissue slightly soaked with water. ,QWKHFDVHRIKHDY\GLUW wipe it off with a cloth soaked with mild detergent. Sy st em s 4 CAUTION 7 1 Front panel (page 8.) Ai rC on tro l Do no n not use se e hard sponge. spo Scratch may result. WARNING D Do n not use gasoline, benzene, thinner, polishing powder, kerosene If gets dirty; wipe off o or alcohol. Crack, electric shock or fire may result. Do not rinse the main unit. Electric shock, fire or breakdown may 2 Pre-filter (page 9.) result. Once in two weeks; clean %LRDQWLERG\ILOWHU(page 9.) 1 year after opening; replace 8QZDVKDEOH 4 Plasma ionizer (pages 11, 12.) If the cleaning sign blinks; 2SSRVLQJSROHSODWHVRDN 6WUHDPHUGLVFKDUJHUVRDN ,RQL]LQJIUDPH,RQL]HGZLUHVRDN LUHV N Fr om 5 Pleated filter (page 10.)) If the replacement sign turns blinks; replace s on or blink (page 15.) (pa 'HRGRUL]LQJFDWDO\VWXQLW DO\VWXQLW VWXQLW (pag thout ut removing fr If it gets dirty, without from the main unit; vacuum 8QZDVKDEOH (page 8.) $LULQOHWIRUWKHGXVWRGRUVHQVRU RUWKHGXVW RUWKHGXVWR If clogged; vacuum cuu cuum WARNING 'XULQJPDLQWHQDQFH\RXPXVWVWRSWKHRSHUDWLRQDQG UHPRYHWKHSRZHUSOXJIURPWKHHOHFWULFDORXWOHW Electric shock or injury may occur. CAUTION 'RQRWZDVKWKHPDLQXQLWZLWKZDWHU If water gets inside the unit, electric shock or malfunction may occur. ATTENTION Be careful not to scratch the front or damage the rear protrusions of the removed IURQWSDQHO ,QSDUWLFXODUWKHUHDU protrusions function as a safety switch to turn OFF the power if the front panel is RSHQHG ,IGDPDJHGWKHXQLWZLOOQRW RSHUDWH NOTE ,IWKHIURQWSDQHOLVQRWFRUUHFWO\VHWRQWKHPDLQXQLW WKHXQLWZLOOQRWRSHUDWH WARNING Do not touch the safety switch on back of the hole on bottom of the main unit. Electric shock may result. Bottom hole English / 8 Care and Cleaning Cleaning the pre-filter NOTE It is recommended to clean the pre-filter every two weeks. Securely close the panel. Failing to do so may cause activation of 5HPRYHWKHIURQWSDQHO the safety switch and out of unit operation. /D\\RXUILQJHUWRWKH dent at bottom of the main unit, hold bottom part of the panel and then pull it up. Front panel CAUTION Do not dry at a location directly exposed to the sun. 'RQRWFOHDQZLWKZDWHUKRWWHUWKDQ& Do not burn with fire. Color changes or deformation may occur and the unit may become unusable. 5HPRYHE\SXOOLQJRXWLQ front while holding the tabs on top of the prefilter. st em Pull out in front to remove. 5HSODFLQJWKHELRDQWLERG\ILOWHU \ILOWH VKRXOGEH XOGEH 7KHELRDQWLERG\ILOWHUVKRXOGEHUHSODFHG DURXQGRQFHD\HDU s 5HPRYHWKHSUHILOWHU fi 5HPRYHWKHIURQWSDQHO(See the left figure.) 5HPRYHWKHSUHILOWHU U(See the left figure figure.) fi 5HSODFHWKHELRDQWLERG\ILOWHUZLWKQHZRQH DQWLERG\ ERG\ILOWHUZLW ILOWHU 5HPRYHDXVHGELR GELR er from m the antibody filter hooks (2 locations) ocations) on ionizer. top of the he plasma ioniz WKHKROHV HKROHV +RRNWKHKROHV 2 lo loc ons) s) of a new (2 locations) bio-anti o-an y filter filt on o the bio-antibody locations) hooks (2 lo ion on top of the plasma ionizer. Top hooks (2 locations) Holes (2 locations) Sy Pre-filter &OHDQWKHSUHILOWHU Ai rC on tro l $IWHUXVLQJDYDFXXP cleaner to remove any dust, clean with water. ,ILWLVYHU\GLUW\XVHD soft brush or a neutral cleaner to clean then dry well in the shade. Bio-antibody filter ,QVWDOOWKHSUHILOWHULQLWVRULJLQDOSRVLWLRQ , (See the left figure.) 5HVWRUHWKHIURQWSDQHO(See the left figure.) NOTE s. “Cleaning sign” may blink if any droplet remains. NOTE 5HSODFLQJWKHELRDQWLERG\ILOWHU Contact your dealer for replacement bio-antibody filter. Life of the bio-antibody filter is about 1 year after opening. If you do not use the bio-antibody filter for a long time, store it away ,QVWDOOWKHSUHILOWHULQLWVRULJLQDOSRVLWLRQ SRVLWLRQ SRVLWLRQ Fr om +RRNWKHERWWRPSDUWRI the pre-filter on the bottom hooks (2 locations) of the plasma ionizer and then insert it into the left and nd right hooks (4 locations). ations). ns). Hooks (2 locations) Left and right hooks (4 locations) Plasma ionizer 5HVWRUHWKHIURQWSDQHO +RRNWKHWRSKRRNVORFDWLRQVRIWKHIURQWSDQHORQWKHJURRYHV on top of the main unit and then close the panel. Top hooks (3 locations) Top grooves (3 locations) Hook Overhead view Front panel 9 / English from direct sunlight without opening. Replace a pleated filter 5HSODFHWKHSOHDWHGILOWHUZKHQWKH³UHSODFHLQGLFDWRU´RQWKH PDLQXQLWGLVSOD\WXUQVRQRUEOLQNV 5) Insert the pleated filter into the left and right hooks. 6) Secure the pleated filter with the tape. turn on 5HPRYHWKHIURQWSDQHO(page 9.) 5HPRYHWKHSODVPDLRQL]HU +ROGLQJWKHKDQGOHOLIWWRZDUGV\RXUVHOIDQGUHPRYHIURPWKHWRS 2 hooks. s (page 6.) 5HVWRUHWKHSODVPDLRQL]HUDQGWKHIURQWSDQHO QGWKHIURQ KHIURQ st em ,QVHUWWKHSRZHUSOXJ 3UHVVWKHUHVHWVZLWFKRQWKHPDLQXQLWGLVSOD\ RQWKHPDLQXQLW WKHPDLQX 5HSODFHDSOHDWHGILOWHUZLWKQHZRQH 1) Remove a used pleated filter. 5HPRYHDSOHDWHGILOWHUIURPWKHWDSHDWERWWRPRIWKH deodorization catalytic unit and then unhook the hooks (3 locations on top and 2 locations on bottom). Deodorizing catalyst unit Bottom h hooks (2 locations) ations Pleated Filter NOTE NO R l Replace a pleated l filter Contact your dealer for replacement pleated filter. Conta It is nnot necessary to replace a pleated filter until the replacement Ai rC on tro l Top hooks (3 locations) Sy Hooks (one left and one right) Plasma ionizer Press the reset switch with a sharp material such as a tooth pick k to acement ment turn off the replacement sign. (It will beep.) eep.)) Securing tape 2) Take out a new pleated filter (1 sheet) attach it to the eet) et) and then att atta deodorization catalytic unit. +RRNRQWRSDQGERWWRPKRRNVLQVHUWLQWROHIWDQGULJKWKRRNV RRN QVHUWLQWR HUW and then secure with the e tape. pe. ssig sign turns on or blinks. When the replacement sign turns on, replace a filter even though it is not dirty. * Apparent dirt is not proportional to filter performance. The replacement timing of the pleated filter differs depending on usage and installed place. The replacement sign turns on after a year of everyday use in a home where 10 cigarettes are smoked per day. (The replacement timing will be shorten for use in a heavily air polluted place.) Remove the plasma ionizer Fr om 3) Place the pleated filter holes es on the 3 upper tabs of the deodorizing catalyst unit. The side with the three holes goes up. The white side should be facing you. 4) Hook the holes of the pleated filter on the bottom hooks. (2 locations) CAUTION When cleaning be careful not to cut your hands on the ionizing line. (Wearing rubber gloves is safer.) 5HPRYHWKHIURQWSDQHO /D\\RXUILQJHUWRWKH dent at bottom of the main unit, hold bottom part of the panel and then pull it up. Front panel 5HPRYHWKHSUHILOWHU (page 9.) English / 10 Care and Cleaning 5HPRYHWKHELRDQWLERG\ILOWHU 5HPRYHWKHELRDQWLERG\ILOWHUIURPKRRNVORFDWLRQVDWWRSRI the plasma ionizer. Clean the plasma ionizer ,I³FOHDQLQJVLJQ´RQWKHPDLQXQLWGLVSOD\EOLQNV Top hooks (2 locations) Blink CAUTION Stop operation before cleaning and be careful not to cut your hands Bio-antibody filter with the opposing pole plate or ionizer wires. (It is safer to use rubber gloves.) +ROGLQJWKHKDQGOHOLIWWRZDUGV\RXUVHOIDQGUHPRYHIURPWKHWRS 2 hooks. Plasma ionizerr Sy st em s 5HPRYHWKHSODVPDLRQL]HU 1) Ionizing frame Hooks (one left and one right) Plasma ionizer 5HPRYHWKHRSSRVLQJSROHSODWHVDWEDFNRIWKHSODVPD LRQL]HU Be careful not to catch in the internal ionizer wires. Ai rC on tro l 2SHQWKHNQRERIWKHLRQL]HUIUDPHDQGKROGXSWKHRSSRVLQJSROH plate to remove. It is easier to remove if lifted from outside. Knob Fr om Opposing O pole plate Ionized onized wire Open 5HPRYHWKHVWUHDPHUGLVFKDUJHU VWUHDPHUG VWUHDPHUGLV ,QVHUW\RXUILQJHULQWRWKHKROHRQWRSKROHZLWK QJHUL QJHULQWRWKH th streamer discharger. then gently pull up the Streamer discharger 4) Opposing pole plates CAUTION 7KHUHDUHLRQL]HUZLUHVDWEDFNRIWKHRSSRVLQJSROH 7KHUH Ionizing frame 11 / English 2) Ionized niz wire 3) Streamer S discharger PDUNDQG SODWH:KHQDWWDFKLQJRUUHPRYLQJEHFDUHIXOQRWWRFXW SODW SOD WWKHP ³&OHDQLQJVLJQ´EOLQNVLIRSHUDWHGZKLOHWKHLRQL]HUZLUHVDUHFXW The dust elimination efficiency deteriorates while the sign is blinking. ,IWKHLRQL]HUZLUHVVKRXOGEHFXWUHSODFHPHQWLVQHFHVVDU\ Contact your dealer. Contents 1) Ionizing frame Remove each part. 2) Ionized wire (page 11.) 3) Streamer discharger 4) Opposing pole plate (page 11.) (page 11.) Vacuum dusts on the surface with a cleaner. Vacuum Caution 'RQRWUHPRYHWKHVFUHZVRQWKHLRQL]HURUVWUHDPHUGLVFKDUJHU%UHDNGRZQPD\UHVXOW Soak in water or warm water with liquid mild detergent. (about 1 hour) Clean off the dirt with a cloth or soft brush. Wipe off Wipe the dirt off (For detail, see page 13.) Sy st em s 6RDNLQZDWHU with detergent Scrub down Wipe off (For detail, see ee page 13.) Caution %HVXUHWRGRLQDVKRZHUSURRISODFHVXFKDVEDWKURRPRUVLQNLQDNLWFKHQ KURRPRUVLQN KURRPRUVLQNLQDNLW 8VHRQO\VSHFLILHGYROXPHRIOLTXLGPLOGGHWHUJHQW QW W 'RQRWXVHSRZGHUGHWHUJHQWRUDONDOLQHGHWHUJHQWDQGVFUXEZLWKKDUGVSRQJH QWDQGVFUXEZLWK WDQGVFUXEZLWK Distortion or damage to the equipment may result. y res resu Rinse well Soak in water or warm water to remove detergent. (about 30 minutes) 6RDNLQZDWHU or warm water Ai rC on tro l Rinse with running water. Caution 6RDNZHOODV³FOHDQLQJVLJQ´PD\EHRQHYHQDIWHUFOHDQLQJLIDQ\GHWHUJHQWUHPDLQV 6 NZHOODV³ ZHOO Fr om Rinse with running water and then dry. Rinse well Caution %HFDUHIXOQRWWROHDYHELWVRIWLVVXHVXFKDVFORWK0DOIXQFWLRQPD\UHVXOW Dry in the breezy shade. (about 1 day) 'U\LQWKHVKDGH Caution 'RQRWH[SRVHWRGLUHFWVXQOLJKW5HVLQSDUWPD\EHGLVFRORUHGRUGLVWRUWHG 'U\LQWKHVKDGHDV³FOHDQLQJVLJQ´PD\EHRQHYHQDIWHUFOHDQLQJLIDQ\PRLVWXUHUHPDLQV Attach each part. (page 14.) (page 14.) (page 14.) English / 12 Care and Cleaning CAUTION When cleaning the unit, be careful not to cut your hands with the 1) Ionized wire 2) Streamer discharger 3) Ionizing frame Cleaning the plasma ionizer Ai rC on tro l 1) Ionized wire (8 pieces) &OHDQRIIWKHLRQL]HUZLUHVDQGSHULSKHUDOUHVLQSDUWZLWKDVRIW cloth. Sy st em s opposing pole plate or ionizer wires. (It is safer to use rubber gloves.) When cleaning the unit, be careful not to cut the ionizer wires. Be sure to do in a shower-proof place such as bathroom or sink in a kitchen. Use only specified volume of liquid mild detergent. Do not use powder detergent or alkaline detergent and scrub with hard sponge. Distortion or damage to the equipment may result. 3) Ionizing frame &OHDQRIIWKHUHVLQSDUWZLWKDVRIWFORWK 8VHDFRWWRQEXGWRZLSHRIIGLUWRIRGGVKDSHGDUHDZKHUH your finger does not reach. %HFDUHIXOQRWWROHDYHELWVRIWLVVXH0DOIXQFWLRQPD\UHVXOW * Gently wipe off the ionizer wires. s. Pulling hard may cut them. Fr om 2) Streamer discharger &OHDQRIIWKHLQWHUQDOUHVLQSDUWZLWKDVRIWFORWK UHVLQSDUWZLWKD QSDUWZLWKD (For removal, see page e 11.) * Use a cotton bud to wipe off dirt of odd-shaped area. NOTE If the ionizer wires are cut; Replacement is necessary. Contact your dealer. Discharge needle *2 : Resin part *1 *1 Wipe off only the resin part. *2 Do not touch the discharge needle. Bending the needle will reduce deodorizing performance. 13 / English Cotton bud $VVHPEOLQJWKHSODVPDLRQL]HU $WWDFKWKHRSSRVLQJSROHSODWHV $WWDFKWKHVWUHDPHUGLVFKDUJHU 1) Securely insert the opposing pole plate into the hooks (2 locations in the middle) of the plasma ionizer. 1) Insert bottom of the streamer discharger to the ionizer frame. 2) Attach the opposing pole plate while opening the knobs (one at a side) of the plasma ionizer. 3) Insert securely until it clicks. 2) Insert top of the streamer discharger. scharger. ger. Ai rC on tro l Open Sy st em s Insert downward Confirm if it is attached securely. 3) Confir Fr om 4) Attach another side of the opposing plate. po g pole ole plate English / 14 Care and Cleaning Cleaning the deodorization catalytic unit Vacuum dusts with a cleaner without removing from the PDLQXQLW 'RQRWZDVK NOTE If the operation of 4. is not performed, the unit will not return to normal operation mode. If the operation of 4. is performed, during the settings, the settings will not be correct. When the sensitivity is set high, it will become difficult for the sensor lamp to go out. Optional accessories )RUUHSODFHPHQWSOHDWHGILOWHUDQGELRDQWLERG\ILOWHUFRQWDFW\RXU dealer. Part name 7KHUHFHLYLQJWRQHVRXQGVRQHRI³ ´//RZ “ ” M (Standard) and “ ” H (High) lamps blinks for 5 seconds, and then the lamp corresponding to the set sensitivity turns on. &KDQJHWKHVHWWLQJVXVLQJWKH³ 6WRS@EXWWRQRIWKHPDLQXQLW ´>2SHUDWLRQVZLWFK Airflow speed display “ ” L (Low) “ ” M (Standard) “ ” H (High) Dust sensor sensitivity High (Sensor display becomes easy to light.) Normal (setting when shipped) Low (Sensor display play will have ave difficulty difficu coming min on.) :KHQ\RXGHFLGHRQWKHVHWWLQJVSRLQWWKHUHPRWH QWWKHUHPRWH QWWKHUHPRWH ss the “ ” controller at the main unit and press >2))7,0(5@EXWWRQ 7KHUHFHLYHVRXQGZLOOEHHSDQGWKHVHWWLQJODPSZLOOIODVK VHWWLQJODPS LQJODPS Fr om 8QSOXJWKHSRZHUSOXJRQHWLPHDQGWKHQDIWHU HWLPHD PH GWKH WK LWLQDJDLQ QDJDLQ VHFRQGVRUPRUHSOXJLWLQDJDLQ 7KLVFRPSOHWHVWKHVHWWLQJV LQJV Airflow rate indicator Off timer button 15 / English Operation switch / stop button K KAF972A4E ,IXVHGZLWKGLUW\SDUWV &DQQRWREWDLQDLUFOHDQHIIHFW DQHIIHFW IIHFW &DQQRWREWDLQGHRGRUL]DWLRQHIIHFW GRUL]DWLRQHIIHFW UL]DWLRQHIIHF 2GRUPD\DULVH H 'LVSRVDOUHTXLUHPHQWV OUHTXLUHPHQW HTXLUHPH <RXU'DLNLQSURGX <RXU'DLNLQSURGXFWLVPDUNHGZLWKWKLVV\PERO7KLV <RXU'DLNLQS and electronic products shall not means that electrical elec e with unsorted household waste. be mixed wit Disposal o Dispo of this product must be done in accordance with relevant local and national legislation. By disposing rel of this product correctly, you will help ensure its proper treatment, recovery and recycling, thus preventing negative consequences for the environment and human potential ne contact your local authority for more information. health. Please P Batteries must be removed from the remote controller and disposed of Batter separately in accordance with relevant local and national legislation. sep Ai rC on tro l 6ZLWFKHVHDFKWLPHLWLVSUHVVHG 7KHVHWWLQJVLVVKRZQLQWKHDLUIORZUDWHLQGLFDWRU KAC972A4E em s 3UHVV³ ´ZLWKWKHUHPRWHFRQWUROSRLQWHGDWWKHPDLQ unit while holding “ ” on the main unit for VHFRQGV Bio-antibody filter (1 sheet) Part number st The sensitivity of the sensor differs depending on the size of URRPLQVWDOODWLRQSODFHDQGW\SHRIGLUW &KDQJHWKHVHQVRUVHQVLWLYLW\LI\RXGRQ¶WOLNHLW Sy Sensitivity settings of the dust sensor Pleated filter (7 sheets) )UHTXHQWO\DVNHGTXHVWLRQV Question Answer 7KHGXVWVHQVRUGRHVQRW FKDQJHIURPWKHUHGJUHHQ ODPS 7KHVHQVLWLYLW\RIWKHGXVW VHQVRUVHHPVWREHEDGRU WRRJRRG This is due to dusts built up in the dust sensor. Vacuum dusts from the air inlet with a crevice nozzle of a cleaner and then manually operate the unit for a while. The sensor will go back to normal. This is because react time of the dust sensor differs depending on the size of room. If the unit is installed at the lower position of a room, reaction to smoke of cigarettes or others may be bad. Re-install the unit at the higher place such as on a shelf. If the sensitivity is still bad, adjust the sensor with sensitivity settings. Can I wash the deodorization catalytic unit? Is replacement necessary? The deodorization catalytic unit cannot be washed. (The unit will be ruined.) :KDWWRGRLIWKHLRQL]HU wires are cut? If the ionizer wires should be cut, replacement is necessary. Contact your dealer. ,VQRWDSUREOHPWRXVH while the cleaning sign is EOLQNLQJ" While the cleaning sign is blinking, electric dust collection and deodorization rization on functions funct func remarkably harger stops stop for f safety. deteriorate as electricity supply to the ionizer wires and streamer discharger Be sure to inspect inside until the sign turns off. (Blinking is not a problem from a safety viewpoint.) st em s Vacuum dusts with a cleaner without removing from the main unit. Replacement is not necessary. 7URXEOH6KRRWLQJ &KHFN Case 'RHVQRWRSHUDWH Is the power plug unplugged? Sy ,QYHVWLJDWHWKHSUREOHPRQFHDJDLQEHIRUHUHTXHVWLQJUHSDLUV QJUHSDLUV QJUHSDLUV Ai rC on tro l Is the front panel correctly set? 7KHIRXUDLUIORZUDWHGLVSOD\V// 4XLHW//RZ06WDQGDUGDQG+ +LJKDUHIODVKLQJDWWKHVDPHWLPH $LUGRHVQRWFRPHRXW &OHDQLQJHIIHFWLVQRWREWDLQHG Fr om 7HOHYLVLRQVFUHHQLVGLVWRUWHG 'XULQJRSHUDWLRQDFUDFNOLQJ DFUDFNOLQJ UDFNO VRXQGRUDEX]]LQJVRXQGDUH ]]LQJVRXQGDUH KHDUG 2GRULVFRPLQJIURPWKHDLURXWOHW The cleaning sign does not turn RIIRUEOLQNVDJDLQHYHQDIWHU FOHDQLQJWKHSODVPDLRQL]HU Measure Secu Securely insert it. cur Securely set it. Are the battery of the remote controller ontroller oller dead? Replace with new battery. (page 5.) Is there any foreign matterr in n the air outlet? Remove the foreign matter. For other cases, contact your dealer. Is the unit installed location where the talled at a locatio loca flow does not obstructions ot pass or are there t close to the unit? un Remove the obstruction. Is there dust in the pre-filter or here ere too much du pleated leated d filter? Clean or replace. (pages 5, 6, 9) Iss too much odors o od or smoke being generated? For this case, contact your dealer. Is a television te televis or radio installed within 2m of is un this unit or is an indoor antenna being used cclose to this unit? Separate the television, radio and indoor antenna from this unit by 2m or more. IIs the power cord or antenna of the television or radio close to this unit? Separate the power cord and antenna of the television or radio as much as possible away from this unit. Is the plasma ionizer securely set? Securely set it. Is dust adhering to the ionizing line of the plasma ionizer (resin part)? Clean the plasma ionizer. (pages 11, 12.) Has water entered into the spurt hole moistening the negative ionization assembly? If the negative ionization assembly is dry, the sound will go away. Is a large amount of odor being generated temporarily? (Many people smoking or grilling meat.) If operated, the odor will gradually go away. Have you moved the main unit to another room? Odor from the original room may smell. If the pre-filter or plasma ionizer dirty? Clean it. (pages 9, 11, 12, 13.) Is the plasma ionizer set securely? Securely set it. Are not droplets left in the opposing pole plates or other places? Wipe off droplets. Are not bits of tissue left in the plasma ionizer? Remove bits of tissue. Did you rinse and soak the plasma ionizer well after washing the plasma ionizer with detergent? Soak well. Are not the ionizer wires cut? Contact your dealer. English / 16 0&9060&90: 2SB63475-11E Noboru Murata Manager Quality Control Department Shiga, 1st of Nov. 2005 ys lS s Umeda Center Bldg., 4-12, Nakazaki-Nishi 2-chome, Kita-ku, Osaka, 530-8323 Japan m te Ai rC on tro l Sy st em s AirControl Systems Andil House Court Street Trowbridge BA14 8BR Tel: 0044 (0)1225 752494 www.air-purifiers.org.uk 3P167171-1A M05B061A (0511) HT