Download Smart Motor Manager User Manual
Transcript
Smart Motor Manager Bulletin 825 User Manual Important User Information %HFDXVHRIWKHYDULHW\RIXVHVIRUWKHSURGXFWVGHVFULEHGLQWKLVSXEOLFDWLRQWKRVHUHVSRQVLEOH IRUWKHDSSOLFDWLRQDQGXVHRIWKLVFRQWUROHTXLSPHQWPXVWVDWLVI\WKHPVHOYHVWKDWDOO QHFHVVDU\VWHSVKDYHEHHQWDNHQWRDVVXUHWKDWHDFKDSSOLFDWLRQDQGXVHPHHWVDOOSHUIRUPDQFH DQGVDIHW\UHTXLUHPHQWVLQFOXGLQJDQ\DSSOLFDEOHODZVUHJXODWLRQVFRGHVDQGVWDQGDUGV 7KHLOOXVWUDWLRQVFKDUWVVDPSOHSURJUDPVDQGOD\RXWH[DPSOHVVKRZQLQWKLVJXLGHDUH LQWHQGHGVROHO\IRUSXUSRVHVRIH[DPSOH6LQFHWKHUHDUHPDQ\YDULDEOHVDQGUHTXLUHPHQWV DVVRFLDWHGZLWKDQ\SDUWLFXODULQVWDOODWLRQ$OOHQ%UDGOH\GRHVQRWDVVXPHUHVSRQVLELOLW\RU OLDELOLW\WRLQFOXGHLQWHOOHFWXDOSURSHUW\OLDELOLW\IRUDFWXDOXVHEDVHGXSRQWKHH[DPSOHV VKRZQLQWKLVSXEOLFDWLRQ $OOHQ%UDGOH\SXEOLFDWLRQ6*,6DIHW\*XLGHOLQHVIRUWKH$SSOLFDWLRQ,QVWDOODWLRQDQG0DLQWHQDQFH RI6ROLG6WDWH&RQWURO DYDLODEOHIURP\RXUORFDO$OOHQ%UDGOH\RIILFHGHVFULEHVVRPHLPSRUWDQW GLIIHUHQFHVEHWZHHQVROLGVWDWHHTXLSPHQWDQGHOHFWURPHFKDQLFDOGHYLFHVWKDWVKRXOGEHWDNHQ LQWRFRQVLGHUDWLRQZKHQDSSO\LQJSURGXFWVVXFKDVWKRVHGHVFULEHGLQWKLVSXEOLFDWLRQ 5HSURGXFWLRQRIWKHFRQWHQWVRIWKLVFRS\ULJKWHGSXEOLFDWLRQLQZKROHRUSDUWZLWKRXW ZULWWHQSHUPLVVLRQRI5RFNZHOO$XWRPDWLRQLVSURKLELWHG 7KURXJKRXWWKLVPDQXDOZHXVHQRWHVWRPDNH\RXDZDUHRIVDIHW\FRQVLGHUDWLRQV ATTENTION ,GHQWLILHVLQIRUPDWLRQDERXWSUDFWLFHVRUFLUFXPVWDQFHVWKDWFDQOHDG WRSHUVRQDOLQMXU\RUGHDWKSURSHUW\GDPDJHRUHFRQRPLFORVV $WWHQWLRQVWDWHPHQWVKHOS\RXWR • LGHQWLI\DKD]DUG • DYRLGDKD]DUG • UHFRJQL]HWKHFRQVHTXHQFHV IMPORTANT ,GHQWLILHVLQIRUPDWLRQWKDWLVFULWLFDOIRUVXFFHVVIXODSSOLFDWLRQDQG XQGHUVWDQGLQJRIWKHSURGXFW $OOHQ%UDGOH\LVDWUDGHPDUNRI5RFNZHOO$XWRPDWLRQ European Communities (EC) Directive Compliance ,IWKLVSURGXFWKDVWKH&(PDUNLWLVDSSURYHGIRULQVWDOODWLRQZLWKLQWKH(XURSHDQ8QLRQDQG (($UHJLRQV,WKDVEHHQGHVLJQHGDQGWHVWHGWRPHHWWKHIROORZLQJGLUHFWLYHV EMC Directive 7KLVSURGXFWLVWHVWHGWRPHHWWKH&RXQFLO'LUHFWLYH(&(OHFWURPDJQHWLF &RPSDWLELOLW\(0&E\DSSO\LQJWKHIROORZLQJVWDQGDUGVLQZKROHRULQSDUWGRFXPHQWHGLQ DWHFKQLFDOFRQVWUXFWLRQILOH • (1(0&³*HQHULF(PLVVLRQ6WDQGDUG3DUW³,QGXVWULDO(QYLURQPHQW • (1(0&³*HQHULF,PPXQLW\6WDQGDUG3DUW³,QGXVWULDO(QYLURQPHQW 7KLVSURGXFWLVLQWHQGHGIRUXVHLQDQLQGXVWULDOHQYLURQPHQW Low Voltage Directive 7KLVSURGXFWLVWHVWHGWRPHHW&RXQFLO'LUHFWLYH((&/RZ9ROWDJHE\DSSO\LQJWKH VDIHW\UHTXLUHPHQWVRI(13URJUDPPDEOH&RQWUROOHUV3DUW (TXLSPHQW 5HTXLUHPHQWVDQG7HVWV)RUVSHFLILFLQIRUPDWLRQUHTXLUHGE\(1 UHIHUWRWKH DSSURSULDWHVHFWLRQVLQWKLVSXEOLFDWLRQDVZHOODVWKH$OOHQ%UDGOH\SXEOLFDWLRQ,QGXVWULDO $XWRPDWLRQ:LULQJDQG*URXQGLQJ*XLGHOLQHV)RU1RLVH,PPXQLW\SXEOLFDWLRQ 7KLVHTXLSPHQWLVFODVVLILHGDVRSHQHTXLSPHQWDQGPXVWEHPRXQWHGLQDQHQFORVXUHGXULQJ RSHUDWLRQWRSURYLGHVDIHW\SURWHFWLRQ ATTENTION ,QRUGHUWRDFKLHYHPD[LPXPSHUIRUPDQFHIURPWKLVSURGXFWFRUUHFW WUDQVSRUWSURSHUDQGFRPSHWHQWVWRUDJHDQGLQVWDOODWLRQDQGFDUHIXO RSHUDWLRQDQGPDLQWHQDQFHPXVWEHREVHUYHG • 7KHSRZHUVXSSO\PXVWEHVZLWFKHGRIISULRUWRDQ\LQWHUYHQWLRQ LQWKHHOHFWULFDORUPHFKDQLFDOSDUWRIWKHHTXLSPHQW • ,QDFFRUGDQFHZLWKDSSOLFDEOHUXOHVZRUNRQHOHFWULFDOHTXLSPHQW RUPHDQVRISURGXFWLRQPD\RQO\EHFDUULHGRXWE\FRPSHWHQW HOHFWULFLDQVRUVXLWDEO\WUDLQHGSHUVRQVJXLGHGDQGVXSHUYLVHGE\ DFRPSHWHQWHOHFWULFLDQ • 7KHHOHFWULFDOHTXLSPHQWRIDPDFKLQHSODQWPXVWEHLQVSHFWHG WHVWHG'HILFLHQFLHVVXFKDVORRVHFRQQHFWLRQVRUVFRUFKHG FDEOHVPXVWEHHOLPLQDWHGLPPHGLDWHO\ • 7KH%XOOHWLQ6PDUW0RWRU0DQDJHUIHDWXUHVVXSHUYLVLRQDQG SURWHFWLRQIXQFWLRQVWKDWFDQDXWRPDWLFDOO\VZLWFKGHYLFHVRII EULQJLQJPRWRUVWRDVWDQGVWLOO0RWRUVFDQDOVREHVWRSSHGE\ PHFKDQLFDOEORFNDJHDVZHOODVPDLQVIDLOXUHVDQGYROWDJH IOXFWXDWLRQV • ,QFDVHRIIXQFWLRQDOGLVWXUEDQFHVWKHPDFKLQHSODQWPXVWEH VZLWFKHGRIIDQGSURWHFWHGDQGWKHGLVWXUEDQFHHOLPLQDWHG LPPHGLDWHO\ • 7KHHOLPLQDWLRQRIDGLVWXUEDQFHPD\FDXVHWKHPRWRUWRUHVWDUW 7KLVPD\HQGDQJHUSHUVRQVRUGDPDJHHTXLSPHQW7KHXVHUPXVW WDNHWKHQHFHVVDU\VDIHW\PHDVXUHVWRDYRLGWKLVW\SHRI RFFXUUHQFH • 6XIILFLHQWVDIHW\GLVWDQFHPXVWEHPDLQWDLQHGZKHUHZLUHOHVV HTXLSPHQWZDONLHWDONLHVFRUGOHVVDQGPRELOHSKRQHVLVXVHG Table of Contents Chapter 1 — Introduction :K\+DYHDQ(OHFWURQLF&RQWURODQG3URWHFWLRQ6\VWHP" 2SHUDWLRQDO'HPDQGVRIWKH0RWRU'ULYH 7HPSHUDWXUH5LVH 0RWRU2SHUDWLQJ&KDUDFWHULVWLFV &XUUHQWDQG7HPSHUDWXUH&XUYHV /LPLWLQJ7HPSHUDWXUHV,QVXODWLRQ&ODVVHV 2SHUDWLRQDO5HTXLUHPHQWVIRU,QVWDOODWLRQ 3HUVRQQHODQG,QVWDOODWLRQ6DIHW\ %XOOHWLQ6PDUW0RWRU0DQDJHU DVDQ$XWRPDWLRQ&RPSRQHQW Chapter 2 — Equipment Description 6\VWHP6WUXFWXUH 6\VWHP&RPSRQHQWV ,QVWDOODWLRQ 0RGXODU'HVLJQ %ORFN'LDJUDP 2SHUDWLQJ(OHPHQWV 6SHFLILFDWLRQV ³%DVLF8QLWDQG&RQYHUWHU0RGXOH 6WDQGDUGV 0DLQ&XUUHQW7UDQVIRUPHUVIRUWKH0RWRU&LUFXLW &RUH%DODQFH&XUUHQW7UDQVIRUPHU 6KRUW&LUFXLW3URWHFWLRQ 5HVSRQVH6XSSO\9ROWDJH)DLOXUH $XWRPDWLF5HFRJQLWLRQRI&RQYHUWHU0RGXOH Chapter 3 — Functions 0HQX2YHUYLHZ $FWXDO9DOXHV 6HW9DOXHV 5HFRUGHG9DOXHV Publication 825-UM001B-EN-P January 2001 ii Table of Contents 2SHUDWLRQ 6HOHFWLQJWKH6HWWLQJ'LVSOD\0RGH 6HWWLQJWKH2SHUDWLRQ3DUDPHWHUV6HW9DOXHV ,QGLFDWLRQVRI$FWXDO9DOXHV ,QGLFDWLRQVRI5HFRUGHG9DOXHV6WDWLVWLFV 7HVW%XWWRQ )XQFWLRQ6XPPDU\ )XQFWLRQVRIWKH%DVLF8QLW&DW1R0« 7KHUPDO2YHUORDG $GMXVWDEOH5DWLRRI&RROLQJ&RQVWDQWV ,QGLFDWLRQRIWKH7LPHWR7ULSSLQJ ,QGLFDWLRQRIWKH7LPHXQWLOWKH7KHUPDO7ULSFDQEH5HVHW $GMXVWDEOH6HWWLQJ&KDUDFWHULVWLF $V\PPHWU\3KDVH8QEDODQFHDQG3KDVH)DLOXUH +LJK2YHUORDGDQG-DP 8QGHUORDG (DUWK*URXQG)DXOW /LPLWLQJWKH1XPEHURI6WDUWVSHU+RXU6WDUW/RFNRXW 0RQLWRULQJWKH6WDUWLQJ7LPH :DUP6WDUW (PHUJHQF\2YHUULGHRI7KHUPDO7ULS(PHUJHQF\6WDUW /('$ODUPDQG7ULS,QGLFDWRU &RQQHFWLRQRIWKH0DLQ5HOD\05 &RQQHFWLRQRIWKH$ODUP5HOD\$/ $ODUP5HOD\$/ 5HVHW )XQFWLRQRIWKH&DW1R0672SWLRQ&DUG 6KRUW&LUFXLW (DUWK*URXQG)DXOW3URWHFWLRQZLWKD&RUH%DODQFH&XUUHQW 7UDQVIRUPHU 6WDOOLQJ'XULQJ6WDUW 37&7KHUPLVWRU,QSXW $QDORJ2XWSXW $QDORJ2XWSXWIRU7KHUPDO/RDGRU 0RWRU7HPSHUDWXUH370D[ $QDORJ2XWSXWIRU0RWRU&XUUHQW &RQWURO,QSXWVDQG 6ZLWFKLQJWRD6HFRQG5DWHG&XUUHQW Publication 825-UM001B-EN-P January 2001 Table of Contents iii )XQFWLRQVRIWKH&DW1R0/92SWLRQ&DUG 3KDVH6HTXHQFH 3KDVH)DLOXUH%DVHGRQ9ROWDJH0HDVXUHPHQW 6WDU'HOWD:\H'HOWD6WDUWLQJ )XQFWLRQVRIWKH&DW1R0092SWLRQ&DUG 37 Ω3ODWLQXP7HPSHUDWXUH6HQVRU57' 377HPSHUDWXUH6HQVRU57' Chapter 4 — Assembly and Installation $VVHPEO\ )OXVK0RXQWLQJ 0RXQWLQJ3RVLWLRQ 6XUIDFH0RXQWLQJ &RQYHUWHU0RGXOHV 7KHUPDO8WLOL]DWLRQ,QGLFDWRU ,QVWDOODWLRQDQG:LULQJ *HQHUDO 0DLQ&LUFXLWV &RQWURO&LUFXLWV Chapter 5 — Setting the Operational Parameters 0HQX2YHUYLHZ 0DLQ6HWWLQJV 6SHFLDO6HWWLQJV 2SHUDWLQJ3DUDPHWHUV Chapter 6 — Commissioning and Operation &KHFNLQJWKH,QVWDOODWLRQ &KHFNLQJWKH:LULQJ &KHFNLQJWKH,QVWDOODWLRQZLWKWKH&RQWURO9ROWDJH$SSOLHG 6ZLWFKLQJRQWKH&RQWURO9ROWDJH &KHFNLQJWKH6HW3DUDPHWHUV 0RWRU&XUUHQW /RFNHG5RWRURU6WDUWLQJ&XUUHQW /RFNHG5RWRU7LPH Publication 825-UM001B-EN-P January 2001 iv Table of Contents 3URJUDPPLQJ6HWXSDQG2SHUDWLRQ 6WDUWLQJ 2SHUDWLQJ Chapter 7 — Testing and Maintenance *HQHUDO &KHFNLQJZLWKRXW7HVW(TXLSPHQW )XQFWLRQDO&KHFNZLWKWKH7HVW%XWWRQ ,QGLFDWLRQRI5HFRUGHG9DOXHV &KHFNLQJZLWK7HVW(TXLSPHQW 7HVW8QLW Chapter 8 — Error Diagnosis and Troubleshooting $ODUP:DUQLQJ 3URFHGXUHZKHQ$ODUP:DUQLQJ3LFNV8S 7ULS )DXOW&RGHV 3URFHGXUHLI´$/$50µGRHVQRW5HVHW 3URFHGXUHLI´75,3µFDQQRWEH5HVHW Chapter 9 — Applications/Wiring %XOOHWLQ6PDUW0RWRU0DQDJHUZLWK&RQWDFWRUV 0DLQ&LUFXLW &RQWURO&LUFXLW 6WDU'HOWD6WDUWHUZLWK%XOOHWLQ6PDUW0RWRU0DQDJHU 0DLQ&LUFXLW &RQWURO&LUFXLW 6KRUW&LUFXLW3URWHFWLRQRI0HGLXP+LJK9ROWDJH0RWRUV 0DLQ&LUFXLWZLWK&DW1R0672SWLRQ&DUG &RQWURO&LUFXLW 7ZR6SHHG0RWRUV 0DLQ&LUFXLW 7ZR6SHHG0RWRU$6SHHG,$6SHHG,,$ 0DLQ&LUFXLW 7ZR6SHHG0RWRUVZLWK3ULPDU\&XUUHQW7UDQVIRUPHU 3ULPDU\&LUFXLW 6HSDUDWHO\9HQWLODWHG0RWRUV Publication 825-UM001B-EN-P January 2001 Table of Contents v %DVLF8QLWDQG&RQYHUWHU0RGXOHZLWK3ULPDU\&XUUHQW7UDQVIRUPHU DQG&RUH%DODQFH&XUUHQW7UDQVIRUPHU 0DLQ&LUFXLW %DVLF8QLWDQG&RQYHUWHU0RGXOHZLWK&RUH%DODQFH&XUUHQW 7UDQVIRUPHU 0DLQ&LUFXLW 0RWRUVZLWK/RZ,GOLQJ&XUUHQW H 0DLQ&LUFXLW &RQQHFWLQJWKH377HPSHUDWXUH6HQVRUV8VLQJWKH &RQGXFWRU7HFKQLTXH %DVLF8QLWDQG&RQYHUWHU0RGXOHZLWK3ULPDU\&XUUHQW7UDQVIRUPHU 3KDVH&XUUHQW(YDOXDWLRQ 7LPH&XUUHQW&KDUDFWHULVWLFRI%XOOHWLQ 6PDUW0RWRU0DQDJHU Chapter 10 — References Figures )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH %XOOHWLQ6PDUW0RWRU0DQDJHU 2SHUDWLQJ&KDUDFWHULVWLFVRIDQ$&0RWRU $&&XUUHQW3URILOHRID0RWRU6WDUWLQJ 'LUHFWRQ/LQH 7HPSHUDWXUH5LVH&KDUDFWHULVWLFV RI0RWRU:LQGLQJV 5HGXFWLRQLQ$YHUDJH/LIH(0RID0RWRU ZKHQ:LQGLQJLV&RQWLQXRXVO\2YHUKHDWHG 0RGXODU'HVLJQRIWKH%XOOHWLQ 6PDUW0RWRU0DQDJHU %ORFN'LDJUDP )URQW9LHZZLWK2SHUDWLQJ(OHPHQWV 6HWWLQJ0RGH 0HQX6HOHFWLRQ (QWHULQJD'DWD9DOXH 6HOHFWLQJWKH$FWXDO9DOXHV 6HOHFWLQJ5HFRUGHG'DWD %DVLF8QLW7HVW%XWWRQ 7ZR%RG\6LPXODWLRQRIWKH+HDWLQJ8S RID0RWRU 7ULS&KDUDFWHULVWLF« V Publication 825-UM001B-EN-P January 2001 vi Table of Contents )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH 7ULS&KDUDFWHULVWLFV«V 5HGXFWLRQLQ3HUPLVVLEOH0RWRU2XWSXW 'XHWR9ROWDJH$V\PPHWU\SHU,(&DQG1(0$ )XQFWLRQRI+LJK2YHUORDGDQG-DP3URWHFWLRQ )XQFWLRQRI8QGHUORDG3URWHFWLRQ 3KDVH&XUUHQW'HWHFWLRQ ([DPSOHRI3KDVH&XUUHQW6HQVLQJ ,VRODWHG1HWZRUN(DUWK)DXOW RQWKH1HWZRUN6LGH 1HWZRUN(DUWKHGWKURXJKD+LJK,PSHGDQFH (DUWK)DXOWRQWKH1HWZRUN6LGH ,VRODWHGQHWZRUN(DUWK*URXQG)DXOWRQWKH/HDGV RQWKH0RWRU6LGH 1HWZRUN(DUWKHGWKURXJKD+LJK,PSHGDQFH (DUWK*URXQG)DXOWRQWKH0RWRU/HDGV ,VRODWHG1HWZRUN(DUWK*URXQG)DXOW LQWKH0RWRU 1HWZRUN(DUWKHGWKURXJKD+LJK,PSHGDQFH (DUWK*URXQG)DXOWRQWKH0RWRU /LPLWLQJWKH1XPEHURI6WDUWVSHU+RXU 0RQLWRULQJ6WDUWLQJ7LPH &XUUHQWDQG7HPSHUDWXUH&XUYHVIRU:DUPDQG &ROG0RWRU6WDUWVDQGWKH6PDUW0RWRU0DQDJHU 7ULSSLQJ/LPLWV ([DPSOHIRUW[H VDQG :DUP7ULS7LPH ,QWHUUXSWLRQRID6KRUW&LUFXLW 6WDOOLQJ'XULQJ6WDUWLQJ &KDUDFWHULVWLFRI37&6HQVRUVDVSHU,(& $QDORJ2XWSXWIRU0RWRU7HPSHUDWXUH5LVH $QDORJ2XWSXWIRU0RWRU7HPSHUDWXUH $QDORJ2XWSXWIRU0RWRU&XUUHQW 2SHUDWLQJ'LDJUDPIRU7LPHU)XQFWLRQV 'LDJUDPRI6WDU'HOWD:\H'HOWD6WDUWLQJ %DVLF8QLW0RXQWHGLQDQ(QFORVXUH 0RXQWLQJ3RVLWLRQ %DVLF8QLW0RXQWHGLQWR3DQHO0RXQWLQJ)UDPH &DW1R)30 Publication 825-UM001B-EN-P January 2001 Table of Contents )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH )LJXUH vii &DW1RV0&00&00&0 &DW1RV0&00&01 &DW1R07807KHUPDO8WLOL]DWLRQ,QGLFDWRU %DVLF8QLW+RXVLQJZLWK2SWLRQ&DUGV %DVLF8QLWZLWK&RQYHUWHU0RGXOH 3KDVH&XUUHQW(YDOXDWLRQ 3KDVH&XUUHQW(YDOXDWLRQ 6PDUW0RWRU0DQDJHU%DVLF8QLW &DW1R0672SWLRQ&DUG &DW1R0/92SWLRQ&DUG &DW1R0092SWLRQ&DUG 5DQJHRI6WDUWLQJ&XUUHQWVRI6WDQGDUG0RWRUV ([SUHVVHGDV0XOWLSOHRIWKH5DWHG6HUYLFH &XUUHQW 7HVWZLWKD3KDVH&XUUHQW6RXUFH 7HVWZLWKD6LQJOH3KDVH&XUUHQW6RXUFH %DVLF8QLWDQG&RQYHUWHU0RGXOH &RQWUROE\0RPHQWDU\&RQWDFW %DVLF8QLWDQG&RQYHUWHU0RGXOH &RQWUROE\0RPHQWDU\&RQWDFW %DVLF8QLWIRU6KRUW&LUFXLW3URWHFWLRQ &RQWUROE\0RPHQWDU\&RQWDFW 7ZR6SHHG$SSOLFDWLRQ8WLOL]LQJ2QH0&0 7ZR6SHHG$SSOLFDWLRQ8WLOL]LQJ0&0 7ZR6SHHG$SSOLFDWLRQ8WLOL]LQJ3ULPDU\&XUUHQW 7UDQVIRUPHU 7\SLFDO$SSOLFDWLRQ8WLOL]LQJ3ULPDU\&XUUHQW 7UDQVIRUPHUVDQG&RUH%DODQFH&XUUHQW 7UDQVIRUPHU 7\SLFDO$SSOLFDWLRQ8WLOL]LQJ&RUH%DODQFH&XUUHQW 7UDQVIRUPHU $SSOLFDWLRQZLWK/RZ,GOLQJ&XUUHQW &RQGXFWRU7HFKQLTXHIRU37:LULQJ 7\SLFDO$SSOLFDWLRQ8WLOL]LQJ3KDVH&XUUHQW (YDOXDWLRQZLWK3ULPDU\&XUUHQW7UDQVIRUPHUV 7ULS&KDUDFWHULVWLFV Publication 825-UM001B-EN-P January 2001 viii Table of Contents Tables 7DEOH$ 7DEOH% 7DEOH& 7DEOH' 7DEOH( 7DEOH) 7DEOH* 7DEOH+ 7DEOH, 7DEOH$ 7DEOH% 7DEOH& 7DEOH' 7DEOH( 7DEOH) 7DEOH* 7DEOH+ 7DEOH, 7DEOH7DEOH. 7DEOH/ 7DEOH0 7DEOH1 7DEOH2 7DEOH3 7DEOH4 7DEOH5 7DEOH6 7DEOH7 7DEOH8 7DEOH9 7DEOH: (QYLURQPHQWDO5DWLQJV 1RPLQDO5DWHG9ROWDJHV8H (OHFWULFDO5DWLQJV 6XSSO\5DWLQJV 5HOD\5DWLQJV 7HUPLQDOV 0DLQ&XUUHQW7UDQVIRUPHU5DWLQJV 5HFRPPHQGHG'DWDIRU&RUH%DODQFH&XUUHQW 7UDQVIRUPHU &RQYHUWHU0RGXOH³5HODWHG(UURU0HVVDJHV $FWXDO9DOXHV2YHUYLHZ 6HW9DOXHV2YHUYLHZ 5HFRUGHG9DOXHV2YHUYLHZ 'LVSOD\([DPSOHRI6HW9DOXHV0HQX 'LVSOD\([DPSOHRI$FWXDO9DOXHV0HQX 'LVSOD\([DPSOHRI5HFRUGHG9DOXHV 3URWHFWLYH)XQFWLRQV6XPPDU\ :DUQLQJ)XQFWLRQV6XPPDU\ &RQWURO)XQFWLRQV6XPPDU\ 7KHUPDO2YHUORDG6HWWLQJ3DUDPHWHUV 3URWHFWLRQ$JDLQVW7KHUPDO2YHUORDG $V\PPHWU\3KDVH8QEDODQFH 6HWWLQJ3DUDPHWHUV +LJK2YHUORDGDQG-DP6HWWLQJ3DUDPHWHUV 8QGHUORDG6HWWLQJ3DUDPHWHUV (DUWK*URXQG)DXOW³+ROPJUHHQ5HVLGXDO 6HWWLQJ3DUDPHWHUV &RUH%DODQFH&XUUHQW7UDQVIRUPHU 6HWWLQJ3DUDPHWHUV (DUWK*URXQG)DXOW&RUH%DODQFH 6HWWLQJ3DUDPHWHUV 6WDUWVSHU+RXU6HWWLQJ3DUDPHWHUV 0RQLWRULQJ6WDUW7LPH6HWWLQJ3DUDPHWHUV :DUP6WDUW6HWWLQJ3DUDPHWHUV $ODUP([DPSOHV 5HVHW6HWWLQJ3DUDPHWHUV 6KRUW&LUFXLW6HWWLQJ3DUDPHWHUV Publication 825-UM001B-EN-P January 2001 Table of Contents 7DEOH; 7DEOH< 7DEOH= 7DEOH$$ 7DEOH$% 7DEOH$& 7DEOH$' 7DEOH$( 7DEOH$) 7DEOH$ 7DEOH% 7DEOH& 7DEOH$ 7DEOH% 7DEOH& 7DEOH' 7DEOH$ 7DEOH$ 7DEOH$ ix 6WDOOLQJGXULQJ6WDUW6HWWLQJ3DUDPHWHUV 37&6HWWLQJ3DUDPHWHUV 6HQVRU0HDVXULQJ&LUFXLW6SHFLILFDWLRQV 3KDVH6HTXHQFH6HWWLQJ3DUDPHWHUV 3KDVH)DLOXUH6HWWLQJ3DUDPHWHUV 6WDU'HOWD:\H'HOWD6WDUWLQJ 6HWWLQJ3DUDPHWHUV 377HPSHUDWXUH'HWHFWRU5HVLVWDQFH SHU,(& 3757'6HWWLQJ3DUDPHWHUV 0RWRU,QVXODWLRQ&ODVV6HWWLQJ3DUDPHWHUV &DW1RV0&00&00&0 &DW1RV0&00&01 6SHFLILFDWLRQV 0DLQ6HWWLQJV 6SHFLDO6HWWLQJV &RPPXQLFDWLRQ6HWWLQJV &DW1R0«2SHUDWLQJ3DUDPHWHUV &KHFNLQJWKH$FWXDO9DOXHV /LVWRI5HFRUGHG9DOXHV 3RVVLEOH&DXVHVDQG$FWLRQV Publication 825-UM001B-EN-P January 2001 x Table of Contents Notes: Publication 825-UM001B-EN-P January 2001 Chapter 1 Introduction Why Have an Electronic Control and Protection System? 7KHQHHGWRRSWLPL]HSURGXFWLRQIDFLOLWLHVUHTXLUHVHQKDQFHGFRQWUROPRQLWRULQJDQG SURWHFWLRQV\VWHPV 0RWRUDQGLQVWDOODWLRQXVHPXVWEHPD[LPL]HGZKLOHPLQLPL]LQJERWKWKHGRZQWLPHUHTXLUHG IRUPDLQWHQDQFHDQGWKDWFDXVHGE\PRWRUIDLOXUHVWKHVHUHTXLUHPHQWVDUHHDVLO\PHWE\WKH PLFURSURFHVVRUEDVHG%XOOHWLQ6PDUW0RWRU0DQDJHU 7KH%XOOHWLQ6PDUW0RWRU0DQDJHUKDVDPRGXODUGHVLJQDQGLVHDVLO\SURJUDPPHG,WV DWWULEXWHVHQDEOHDQRSWLPXPILWWRDZLGHYDULHW\RIPRWRUDQGLQVWDOODWLRQUHTXLUHPHQWV 7KH%XOOHWLQ6PDUW0RWRU0DQDJHUSURYLGHVFRQWLQXRXVPRQLWRULQJRIPRWRURSHUDWLQJ GDWDLQRQHRIWZRZD\V7KHGDWDFDQEHYLHZHGGLUHFWO\RQWKHXQLWRULWFDQEHPRQLWRUHG UHPRWHO\YLDDQHWZRUNE\XVLQJD3&RUSURFHVVFRPSXWHU7KHPDLQVWDWLVWLFDOGDWDFDQDOVR EHDFFHVVHGDWDQ\WLPH Figure 1.1 Bulletin 825 Smart Motor Manager Publication 825-UM001B-EN-P January 2001 1-2 Introduction Operational Demands of the Motor/Drive Temperature Rise 0RWRUGHVLJQVDQGDSSOLFDEOHVWDQGDUGVUHTXLUHWKDWZKHQDPRWRULVRSHUDWHGXQGHU VSHFLILHGORDGVDQGDPELHQWFRQGLWLRQVWKHFULWLFDOSDUWVRIWKHPRWRUZLOOUHPDLQZLWKLQDQ DOORZDEOHWHPSHUDWXUHUDQJHDQGVKRUWWHUPRYHUORDGVZLOOQRWKDUPWKHPRWRU 7KHGHYLFHSURWHFWLQJWKHPRWRUPXVWSHUPLWIXOOXVHRIWKHPRWRUDQGLWVHFRQRPLFDO RSHUDWLRQ$WWKHVDPHWLPHWKHSURWHFWLYHGHYLFHPXVWVZLWFKRIIUDSLGO\LIDQRYHUORDG RFFXUV Motor Operating Characteristics (OHFWULFPRWRUVDEVRUEHOHFWULFDOHQHUJ\DQGVXSSO\PHFKDQLFDOHQHUJ\'XULQJWKLVHQHUJ\ FRQYHUVLRQORVVHVDUHSURGXFHGLQWKHIRUPRIKHDW7KHWRWDOORVVFRQVLVWVRIWKHIROORZLQJ VHSDUDWHORVVHV • /RVVHVLQGHSHQGHQWRIWKHFXUUHQWWKHVHORVVHVDUHYLUWXDOO\FRQVWDQWLHWKH\DOVR RFFXUDWQRORDG • ,URQORVVHVFDXVHGE\UHPDJQHWL]DWLRQDQGHGG\FXUUHQWV • 0HFKDQLFDOORVVHVFDXVHGE\IULFWLRQDQGYHQWLODWLRQ • /RVVHVGHSHQGHQWRQWKHFXUUHQWWKHVHORVVHVLQFUHDVHZLWKORDGLHZLWKWKHFXUUHQW FRQVXPHGE\WKHPRWRU • +HDWORVVHVFDXVHGE\WKHFXUUHQWLQWKHVWDWRU • +HDWORVVHVFDXVHGE\WKHFXUUHQWLQWKHURWRU • ,QFUHDVHGWHPSHUDWXUHULVHFDXVHGE\SRRUFRROLQJHJFRROLQJILQVDUHGXVW\RU GDPDJHGFRRODQWWHPSHUDWXUHLVWRRKLJK Publication 825-UM001B-EN-P January 2001 Introduction 1-3 I Pv cos ϕ, η, n ⎯ ⎯ ⎯ ne, Ie, Pve Figure 1.2 Operating Characteristics of an AC Motor P Pe Pv Pve e n ne ns cos ϕ η 1.5 1.4 1.3 1.2 1.1 Ie ns 1.0 n 0.9 η 0.8 0.7 cos ϕ 0.5 I Pv 25 50 75 100 Power Rated operational power Power losses Power losses under rated conditions Operational current Rated service current Speed Rated operational speed Synchronous speed Power factor Efficiency 125 P ⎯ [%] Pe Operating characteristics of an AC motor as a function of load. Between no load and half load, the losses increase only slightly with rising load. Between half load and rated load, the change in efficiency is minimal, and the power factor approaches its maximum. The losses increase approximately proportional to the load. Above rated load, the losses increase more rapidly than the load. Current and Temperature Curves 3RZHUORVVLVDSSUR[LPDWHO\SURSRUWLRQDOWRWKHVTXDUHRIWKHPRWRUFXUUHQW7KHSRWHQWLDO IRUPRWRUKD]DUGVH[LVWVPDLQO\GXULQJVWDUWLQJDQGLQDORFNHGURWRUFRQGLWLRQ:KHQD ORFNHGURWRUFRQGLWLRQH[LVWVWKHPD[LPXPYDOXHRIWKHVWDUWLQJFXUUHQWIORZVDSSUR[LPDWHO\ «WLPHVWKHUDWHGVHUYLFHFXUUHQW,HDQGDOORIWKHSRZHUDEVRUEHGLVFRQYHUWHGLQWRKHDW $VWKHPRWRUVSHHGLQFUHDVHVWKHSRZHUFRQYHUWHGLQWRKHDWGHFUHDVHV%XWLIWKHURWRU UHPDLQVORFNHGWKHWHPSHUDWXUHRIWKHVWDWRUDQGURWRUZLQGLQJVULVHVFRQVLGHUDEO\FDXVHGE\ WKHKLJKORVVHVDQGWKHVKRUWWLPHWKDWKHDWFDQIORZLQWRWKHODPLQDWHGFRUH,IWKHPRWRULV QRWVZLWFKHGRIITXLFNO\WKHVWDWRURUURWRUZLQGLQJFDQEXUQRXW $IWHUVWDUWXSWKHWHPSHUDWXUHRIWKHZLQGLQJULVHVDFFRUGLQJWRWKHORDGDQGFRROLQJRIWKH PRWRU,QWLPHWKHZLQGLQJUHDFKHVLWVVWHDG\VWDWHYDOXH $KLJKFXUUHQWUHVXOWVLQDFRUUHVSRQGLQJO\KLJKRSHUDWLQJWHPSHUDWXUH Publication 825-UM001B-EN-P January 2001 1-4 Introduction Figure 1.3 AC Current Profile of a Motor Starting Direct-on-Line 2 2 Ie 1.6 2 IA I 2 2 IA A Starting current tA Starting time e Rated service current t Time tA Oscillogram of switching on a squirrel-cage induction motor by direct-on-line starting. The high motor starting current A flows during the starting time (tA). If this is less than the limit specified by the manufacturer (usually 10 s), the starting current does not cause an excessive temperature rise. The brief, asymmetrical peak when switching on can be ignored. 0RWRUVDUHQRWWKHUPDOO\KRPRJHQHRXV7KHZLQGLQJVWDWRULURQDQGURWRUKDYHGLIIHUHQW KHDWFDSDFLWLHVDQGFRQGXFWLYLWLHV)ROORZLQJXQGXO\KHDY\ORDGVHJGXULQJVWDUWLQJ WHPSHUDWXUHHTXDOL]DWLRQRFFXUVEHWZHHQWKHYDULRXVSDUWVRIWKHPDFKLQHKHDWIORZVIURP WKHZDUPHUZLQGLQJLQWRWKHFRROHULURQXQWLOWKHWHPSHUDWXUHGLIIHUHQFHLVPLQLPDO Figure 1.4 Temperature Rise Characteristics of Motor Windings ϑ ϑG ϑK ϑs ϑe ϑG ϑe ϑs ϑK 0t t A B t tA tB Temperature limit of the insulation Coolant temperature Temperature rise at start Temperature rise when operated continuously at rated current Starting time Permitted stalling time Temperature rise in a motor winding. During the starting time (tA), the temperature of the winding rises very rapidly; at the end of startup, the temperature drops temporarily because heat is transferred to the laminated core. Limiting Temperatures, Insulation Classes 7KHSHUPLVVLEOHWHPSHUDWXUHOLPLWIRUDZLQGLQJ³DQGWKXVWKHORDGEHDULQJFDSDFLW\³RI WKHPRWRULVSULPDULO\DIXQFWLRQRIWKHPRWRU VLQVXODWLRQ$SSOLFDEOHVWDQGDUGV8/&6$ ,(&DQG1(0$GLVWLQJXLVKEHWZHHQGLIIHUHQWFODVVHVRILQVXODWLRQDQGFRUUHVSRQGLQJ WHPSHUDWXUHOLPLWV Publication 825-UM001B-EN-P January 2001 Introduction 1-5 Insulation Aging 7KHDJLQJRILQVXODWLRQPDWHULDOLVDFKHPLFDOSURFHVVWKDWLVDFFHOHUDWHGE\FRQWLQXRXV RYHUWHPSHUDWXUH,WPD\EHDVVXPHGWKDWDZLQGLQJWHPSHUDWXUHWKDWLVFRQVWDQWO\ . KLJKHUWKDQWKHWHPSHUDWXUHOLPLWUHGXFHVWKHPRWRUOLIHE\KDOI7KLV´OLIHODZµVKRZVWKDW SDUWLFXODUDWWHQWLRQPXVWEHSDLGWRDGKHULQJWRWKHSHUPLWWHGRSHUDWLQJWHPSHUDWXUHIRUORQJ SHULRGVRIWLPH1RWHWKDWRYHUWHPSHUDWXUHVRIVKRUWGXUDWLRQDQGLQIUHTXHQWRFFXUUHQFHGR QRWVHULRXVO\DIIHFWWKHOLIHRIWKHPDFKLQH 7KH%XOOHWLQ6PDUW0RWRU0DQDJHU VDELOLW\WRDFFXUDWHO\OLPLWH[FHVVLYHFXUUHQW FRQGLWLRQVJUHDWO\DLGVLQH[WHQGLQJPRWRUOLIH,QSUDFWLFHLWPD\EHH[SHFWHGWKDWWKHUHZLOO EHUHGXFHGORDGVDQGSDXVHVVRWKDWZKHQWKHWHPSHUDWXUHOLPLWLVUHDFKHGWKHPRWRUOLIHZLOO QRWEHLPSDLUHG Figure 1.5 Reduction in Average Life (EM) of a Motor when Winding is Continuously Overheated % 100 EM ϑG EM Average motor life Temperature limit of the insulation 70 50 25 0 +5K +10K +15K +20K ϑG Rotor Temperature 7KHURWRUVRIVTXLUUHOFDJHLQGXFWLRQPRWRUVZLWKVLPSOHFRQVWUXFWLRQQRLQVXODWLRQPD\ FRQWLQXRXVO\DWWDLQKLJKHUWHPSHUDWXUHVWKDQURWRUVLQPRWRUVZLWKLQVXODWHGZLQGLQJV +RZHYHULQODUJHUPRWRUVWKHFRQFHQWUDWLRQRIWKHURWRUORVVHVGXULQJVWDUWLQJLVKLJKHUWKDQ WKHFRQFHQWUDWLRQVRIORVVHVLQRWKHUSDUWVRIWKHPRWRU7KHVWDUWLQJWLPHRIVXFKPRWRUVLV WKHUHIRUHOLPLWHGE\WKHWKHUPDOFDSDFLW\RIWKHURWRU7KHVHW\SHVRIPRWRUVDUHFRPPRQO\ UHIHUUHGWRDV´URWRUFULWLFDOµPRWRUV&ULWLFDOWRWKHURWRUDUHWKHPHFKDQLFDOVWUHVVHVFDXVHG E\WKHWHPSHUDWXUHULVHXQVROGHULQJRIWKHURWRUEDUVDQGIRU(([HPRWRUVPRWRUVIRUXVH LQWKHFKHPLFDOLQGXVWU\WKHKLJKWHPSHUDWXUHDVDVRXUFHRILJQLWLRQ Operational Requirements for Installation 0RQLWRULQJWKHDSSOLFDWLRQSDUDPHWHUVDQGSURFHVVGDWDRIDQLQVWDOODWLRQFDQEHYHU\ LPSRUWDQW(YHQDVOLJKWFKDQJHLQWKHVWDUWLQJDQGRSHUDWLQJEHKDYLRURIWKHPRWRUFDQ LQGLFDWHDQLPSHQGLQJIDXOW7KH6PDUW0RWRU0DQDJHUKHOSVHOLPLQDWHSRWHQWLDOWURXEOH EHIRUHPDMRUUHSDLUVDUHQHFHVVDU\DQGORVVRISURGXFWLRQRFFXUV Publication 825-UM001B-EN-P January 2001 1-6 Introduction 7KH6PDUW0RWRU0DQDJHUIXOILOVWKHVHUHTXLUHPHQWVE\SURYLGLQJSURWHFWLRQDJDLQVWWKH IROORZLQJ • KLJKRYHUORDGVWDOOLQJDQGMDP • XQGHUORDG • SKDVHVHTXHQFH Personnel and Installation Safety 3HUVRQQHOSURWHFWLRQLQWKHYLFLQLW\RIFRQWUROHTXLSPHQWLVRISULPDU\LPSRUWDQFH7KH FRUUHVSRQGLQJUHTXLUHPHQWVRIUHJXODWRU\DJHQFLHVDUHWKHUHIRUHEHFRPLQJLQFUHDVLQJO\ VHYHUH7KH6PDUW0RWRU0DQDJHUUHIOHFWVWKLVE\SURYLGLQJWKHIROORZLQJSURWHFWLRQ • HTXLSPHQWFRQVWUXFWLRQ • WRXFKSURWHFWLRQ • LQVXODWHGKRXVLQJ • PRWRUSURWHFWLYHIXQFWLRQV • (DUWKJURXQGIDXOW • +LJKRYHUORDGVWDOOLQJDQGMDP • :URQJGLUHFWLRQRIURWDWLRQ Bulletin 825 Smart Motor Manager as an Automation Component 7KH%XOOHWLQ6PDUW0RWRU0DQDJHUGHWHFWVDEQRUPDORSHUDWLQJFRQGLWLRQVDQGIDXOWVLQ PRWRUEUDQFKFLUFXLWV7KHGDWDPDGHDYDLODEOHE\WKH6PDUW0RWRU0DQDJHUFDQEHXVHGIRU RSHUDWLRQDOFRQWURODQGRSWLPL]DWLRQRIWKHLQVWDOODWLRQ $ODUJHQXPEHURIVXSHUYLVRU\SURWHFWLYHDQGFRQWUROIXQFWLRQVLPSURYHRSHUDWLRQDOFRQWURO DQGDYRLGXQQHFHVVDU\GRZQWLPH7KLVPD[LPL]HV\RXUPRWRULQYHVWPHQWPDNLQJWKH6PDUW 0RWRU0DQDJHUDYDOXDEOHFRPSRQHQWLQPRGHUQDXWRPDWLRQV\VWHPV Publication 825-UM001B-EN-P January 2001 Chapter 2 Equipment Description System Structure 7KH%XOOHWLQ6PDUW0RWRU0DQDJHULVDPLFURSURFHVVRUEDVHGSURWHFWLRQDQGFRQWURO V\VWHPIRUPRWRUV)RUWKH$&PRWRUDQGWKHRSHUDWHGLQVWDOODWLRQWKLVPHDQV • 0D[LPXPXWLOL]DWLRQ • &RQWLQXRXVVXSHUYLVLRQ • 5HOLDEOHSURWHFWLRQ 7KHPRGXODUVWUXFWXUHRIWKHV\VWHPDQGDOORILWVSRVVLEOHIXQFWLRQVHQDEOHWKH%XOOHWLQ 6PDUW0RWRU0DQDJHUWREHHFRQRPLFDOO\DQGRSWLPDOO\DGDSWHGWRDQ\LQVWDOODWLRQ System Components 7KHPRWRUSURWHFWLRQV\VWHPFRQVLVWVRI • • • • • 7KHEDVLFFRQWURODQGSURWHFWLRQXQLW &XUUHQWFRQYHUWHUPRGXOHVIRU«$ &DEOHIRUFRQQHFWLQJEHWZHHQWKHEDVLFXQLWDQGWKHFXUUHQWFRQYHUWHUPRGXOH 2SWLRQDOSOXJLQSULQWHGFLUFXLWERDUGV 7KHUPDOXWLOL]DWLRQPHWHUWRLQGLFDWHWKHWKHUPDOORDG Installation 7KH6PDUW0RWRU0DQDJHUFDQEHHLWKHUIOXVKPRXQWHGLQDQHQFORVXUHGRRURUVXUIDFH PRXQWHGWRWKHHQFORVXUHPRXQWLQJSODWHXVLQJDSDQHOPRXQWLQJIUDPH &XUUHQWFRQYHUWHUPRGXOHVFDQEHVXUIDFHPRXQWHG Publication 825-UM001B-EN-P January 2001 2-2 Equipment Description Modular Design 7KH&DW1R0EDVLFXQLWFDQEHILWWHGZLWKDGGLWLRQDORSWLRQIXQFWLRQFDUGVWRVXLWWKH UHTXLUHPHQWV Figure 2.1 Modular Design of the Bulletin 825 Smart Motor Manager Basic unit, Cat. No. 825-M… Option: Cat. No. 825-MLV Cat. No. 825-MMV PT100 Communication Communication Network Cat. No. 825-MST Thermal utilization module 4...20 mA Core Balance Current Transformer Converter module $YDLODEOH&RPPXQLFDWLRQV&DUGV &DW1R0'1'HYLFH1HW &DW1R5,25HPRWH,2➊ &DW1R0%60RGEXV➊ &DW1R03%352),%86)06 ➊ Available from Prosoft Technology, Inc. (not an Allen-Bradley product). References to third-part products are provided for informational purposes only. Prosoft Technology, Inc., is solely responsible for the accuracy of information, supply, and support of this product. For further information regarding this particular referenced product, please contact Prosoft Technology, Inc., in the U.S. at (661) 664-7208 or your local Prosoft Technology, Inc. distributor. Publication 825-UM001B-EN-P January 2001 ϑamb M 3~ ∑ 825MCM PT100 #7 (RTD) Phase failure Phase sequence 7T1/7T2/7T3 L1 L2 L3 Control inputs PT100 #1…#6 (RTD) F #2 #1 Thermistor overload Earth fault Remote reset 825-MDN 3600-RIO Ambient temperature 825-MMV 825-MLV 825-MST 825-M LCD Stator / bearing temperature Basic unit 825-M Controller Operation Communication Interface Disable settings Emergency start Supply 1T1/1T2/1T3 …6T1/6T2/6T3 L1 L2 L3 Y31 Y32 Y41 24 V AC/DC Y42 24 V AC/DC T1, T2 k, l Y21 Y22 A1 (-) A2 (+) + Y11 Y12 Y13 3600-MBS 825-MPB 4…20 mA PLC PC Choice 825-MLV or 825-MMV Auxiliary relay #4 Auxiliary relay #5 53/54 Auxiliary relay #3 Analog output 43/44 I+ / I- 63/64 Auxiliary relay #1 Auxiliary relay #2 23/24 33/34 Alarm relay AL Main relay MR Warning/Trip 13/14 95/96 97/98 Network L1 L2 L3 Equipment Description 2-3 Block Diagram Figure 2.2 Block Diagram Publication 825-UM001B-EN-P January 2001 2-4 Equipment Description Operating Elements 7KH6PDUW0RWRU0DQDJHULVYHU\HDV\WRRSHUDWH$OOIXQFWLRQVGDWDDQGWHVWVFDQEH HQWHUHGH[HFXWHGRUGLVSOD\HGXVLQJWKHVL[PHPEUDQHNH\VDQGWKHVLQJOHOLQH/&'ZKLFK GLVSOD\VDOODYDLODEOHGDWDDQGIXQFWLRQV Figure 2.3 Front View with Operating Elements ➊ ➋ ➏ ➌ ➍ ➎ ➊ Fault indicator (LED) Flashing: warning Steady state: trip ➋ LCD: Single line (two lines of text are displayed alternately) ➌ Values: Selection of mode Actual: Indication of actual operational data Set: Setting mode (set/modify, store parameters) Recorded: Indication of statistical data ➍ Select: Select function and enter/change operating parameter ➎ Settings: Enable entry (Change) and memorize (Enter) ➏ Test: Verifies operation of Smart Motor Manager. ➐ Reset: Enables the Smart Motor Manager after a trip. Publication 825-UM001B-EN-P January 2001 ➐ Equipment Description 2-5 Specifications — Basic Unit and Converter Module Table 2.A Environmental Ratings Temperature Operation -5…+ 60 °C (23…140 °F) Storage -40…+ 60 °C (-40…140 °F) Transport -40…+ 85 °C (-40…185 °F) Climatic Withstand Damp heat IEC 68-2-3 Climatic cycling IEC 68-2-30 40 °C (104 °F), 92% relative humidity, 56 days 25/40 °C (77/104 °F), 21 cycles Enclosure Protection Class 825-M, enclosed in panel IP65 Terminals IP20 Resistance to Vibration as per IEC 68-2-6 10…150 Hz, 3 G Resistance to Shock as per IEC 68-2-27 30 G, shock duration 18 ms, half a sine wave in x, y, z directions Publication 825-UM001B-EN-P January 2001 2-6 Equipment Description Table 2.B Nominal Rated Voltages Ue 825MCM2 Primary Detection Circuit 825MCM180 MCM630 MCM630N 825MCM20 Motor Circuit as per IEC, SEV, VDE 0660 as per CSA, UL 400V AC 240V AC 660V AC 600V AC 1 000V AC 600V AC Control Circuit Main relay (MR) 95…98, supply A1, A2 Phase sequence protection L1, L2, L3 as per IEC 947 as per SEV as per UL, CSA Alarm relay (AL) 13/14 Auxiliary relay #1, #4, #5 as per IEC 947 as per SEV as per UL, CSA Auxiliary relays #2, #3 Control inputs #1, #2 400V AC 380V AC 240V AC 400V AC 250V AC 240V AC 50V AC/30V AC 24V AC/DC Table 2.C Electrical Ratings Test Voltage 825MCM2 Motor Circuit Uimp as per IEC 947-1 2.5 kV Control Circuit Between control circuits and to all other circuits ➊ Main relay (MR) 95…98, supply A1, A2 Phase sequence protection L1, L2, L3 Alarm relay (AL), auxiliary relay #1, #4, #5 as per IEC 947-4 Core balance current transformer k, I Control inputs #1, #2 Auxiliary relays #2, #3 as per IEC 947-4 825MCM20 825MCM180 MCM630 825-MCM630N Uimp 6 kV Uimp 8 kV Uimp 12 kV Uimp 4 kV Uimp 2.5 kV ➊ The measuring inputs for PT100 and PTC, the 4…20 mA output, and the communication interface are not isolated from one another. Publication 825-UM001B-EN-P January 2001 Equipment Description 2-7 Standards (0& 1RLVHHPLVVLRQDVSHU(1DQGDVSHU(1 1RLVHSURRIDVSHU(1DQGDVSHU(1 6WDQGDUGV,(&&6$&1R8/ $SSURYDOV&(8//LVWHG&6$37%3K\VNDOLVFK7HFKQLVFKH%XQGHVDQVWDOW*HUPDQ\ &HUWLILFDWLRQUHTXLUHGIRUPRWRUSURWHFWLRQLQH[SORVLRQKD]DUGDUHDHJ&KHPLFDO 3HWURFKHPLFDO,QVWDOODWLRQV Table 2.D Supply Ratings Nominal supply voltage Us Permissible voltage fluctuation 50/60 Hz, 22…24, 33…36, 44…48, 110…120, 220…240, 380…415, 440V AC 24…48, 72…120, 220V DC AC 0.85…1.10 US DC 0.80…1.10 US for 24…48V DC DC 0.80…1.20 US for 72…120V DC DC 0.80…1.15 US for 220V DC Power consumption Short-circuit protection AC 13 VA, DC 10 W max. With the appropriate supply cable rating, the supply module is short-circuit proof. Publication 825-UM001B-EN-P January 2001 2-8 Equipment Description Table 2.E Relay Ratings Contacts fitted Nominal operating voltage as per UL, CSA: pilot duty 240 V Continuous thermal current Rated operating current for AC-15 Max. permissible switching current (cos ϕ = 0.3) AC-15 Rated operating current for DC-13 without prot. network, L/R = 300 ms Max. rated current of back-up fuse: Contact Data of Output Relays Main Relay (MR) 95…96 1 N/C and 1 N/O contact, galvanically separated [V] 24 220…250 380…440 [A] [A] 4 3 110…125 3 1.2 [A] 30 30 12 [A] 2 0.2 – [A] 10 A, 500V AC, Type gG 0.3 Alarm Relay (AL), Auxiliary Relays #1, #4, #5 Contacts fitted 1 N/O contact each Continuous thermal current 4A Max. permissible switching voltage 400V AC, 125 VDC Nominal Operating Current cos ϕ = 1 4 A at 250V AC or 30V DC cos ϕ = 0.4, L/R = 7 ms 2 A at 250 VAC or 30V DC Max. Switching Power cos ϕ = 1 1 250 VA, 150 W cos ϕ = 0.4, L/R = 7 ms 500 VA, 60 W as per UL/CSA 240 V, 1 A pilot duty Auxiliary Relays #2, #3 Contacts fitted 1 N/O contact each Continuous thermal current 4A Max. permissible switching voltage 48 VAC, 30 VDC Max. Switching Power cos ϕ = 1 150 W cos ϕ = 0.4, L/R = 7 ms 60 W Publication 825-UM001B-EN-P January 2001 Equipment Description 2-9 Table 2.F Terminals Cat. No. 825-M plug-in terminals as per UL as per VDE Range of gauges: 0.5…2.5 m2, single wire (AWG No. 20…14) 0.5…1.5 m2 double wire (AWG No. 20…16) AWG No. 22…14 nominal gauge 1.5 mm 2 Main circuit 825-MCM2/ 825-MCM20 825-MCM180 825-MCM630(N) Terminals: 2 x 2.5 mm2/1 x 4 mm2 (2 x 0.0039 in2/1 x 0.006 in2) 2 x AWG No. 20…14/1 x AWG No. 20…12 Aperture or busbars: Wire ∅ 19 mm max. 20/16 x 4 mm Bus bars: 25 x 8 mm Publication 825-UM001B-EN-P January 2001 2-10 Equipment Description Main Current Transformers for the Motor Circuit :KHQWKH&DW1R0&RQWURODQG3URWHFWLRQ8QLWLVXVHGDVDVHFRQGDU\UHOD\ZLWK&DW 1RV0&0DQG0&0WKHIROORZLQJVSHFLILFDWLRQVDSSO\ Table 2.G Main Current Transformer Ratings Minimum nominal operating voltage Minimum rated primary current 1n Rated secondary current Class and nominal overcurrent factor Nominal operating voltage of motor Nominal operating current of motor 1 A or 5 A 5 P 10 ext. 120% ➊ According to power consumption in leads Power rating and measuring circuits Rated frequency 50/60 Hz 825-M + 825-M + Burden: 825-MCM2 825-MCM20 0.1 VA/phase 0.4 VA/phase Power consumption at max. rated current ➋ Continuous thermal current 3A 24 A Thermal current, 1 s duration 250 A 600A Frequency of input current 50/60 Hz 50/60 Hz General Notes on 825-MCM… An open-circuit secondary is permitted, as the burden is No-load installed in the detection module ➊ Designation according to IEC 60044 part 2: 5 Total measurement error (percentage): ±5% within range up to rated nominal overcurrent (10X) ±1% at rated nominal primary current P For protection purposes 10 Rated nominal overcurrent factor: 10X rated nominal primary current ext. 120% Extended rated thermal current: 120% of rated nominal primary current (if e motor > 87% of rated nominal transformer current) With starting current 10 e: class 5 P 20 The current transformer error in addition to the basic unit error ➋ 2.5 A with Cat. No. 825-MCM2, 20 A with Cat. No. 825-MCM20 Publication 825-UM001B-EN-P January 2001 Equipment Description 2-11 Core Balance Current Transformer Table 2.H Recommended Data for Core Balance Current Transformer minimum detectable earth (ground) fault Pickup current of basic unit earth (ground) fault protection Burden: Measuring circuit 825-M… Power consumption at max. rated current Continuous thermal current Thermal current, 1 s duration Frequency of input current Nominal ratio Kn = 0.4 VA 0.5 A 25 A 50/60 Hz $FRUHEDODQFHFXUUHQWWUDQVIRUPHUFXUUHQWUDWLR LVDYDLODEOHDQGPLJKWVXLWPRVW DSSOLFDWLRQV0D[HDUWKJURXQGIDXOW FXUUHQW $ Short-Circuit Protection Choosing a Circuit Breaker or Fuse and Associated Contactor 7KHEUDQFKFLUFXLWVKRUWFLUFXLWSURWHFWLYHGHYLFHVHULHVFLUFXLWEUHDNHURUIXVHPXVWDVVXUH WKDWWKHPRWRUFDQVWDUWZKLOHLQWHUUXSWLQJVKRUWFLUFXLWFXUUHQWVUDSLGO\HQRXJKWRSUHYHQW GDPDJHWRWKHLQVWDOODWLRQ7RDLGLQWKHODWWHUWKHIXVHUDWLQJVKRXOGEHDVORZDVSRVVLEOH 7KHORZHVWSRVVLEOHIXVHUDWLQJGHSHQGVRQWKHVWDUWLQJFXUUHQWRIWKHPRWRUDQGWKHWULSSLQJ WLPHVHWRQWKH6PDUW0RWRU0DQDJHU The Short-Circuit Coordination of the Starter Must Always be Taken into Account 7KHFRQWDFWRUUHFHLYHVLWVWULSSLQJVLJQDOZKHQWKH6PDUW0RWRU0DQDJHUEDVLFXQLWWULSV7KH EDVLFXQLWLQWHUUXSWVDOOFXUUHQWXSWRWKHSRLQWRILQWHUVHFWLRQZLWKWKHWLPHFXUUHQW FKDUDFWHULVWLFVRIWKHFLUFXLWEUHDNHURUIXVH :KHQVWDUWLQJODUJHPRWRUVWKHPDLQFRQWDFWVRQWKHFRQWDFWRUDUHVXEMHFWHGWRKLJKWKHUPDO ORDGV,IWKHPRWRUVWDUWLQJWLPHH[FHHGVDFHUWDLQOLPLWWKHPD[LPXPSHUPLVVLEOHFXUUHQWKDV WREHUHGXFHG 7KHUDWLQJRIWKHIXVHRUFRQWDFWRUPXVWDOVRDOORZIRUWKHSURVSHFWLYHVKRUWFLUFXLWFXUUHQW 7KH%XOOHWLQFRQYHUWHUPRGXOHVDUHVKRUWFLUFXLWSURRI 7KHFRRUGLQDWLRQJUDGLQJGLDJUDPVIRUFRQWDFWRUVDUHDYDLODEOHRQUHTXHVW Publication 825-UM001B-EN-P January 2001 2-12 Equipment Description Response Supply Voltage Failure ,IWKHVXSSO\YROWDJHIDLOVWKHVHWWLQJGDWDDUHUHWDLQHG Failure of Supply Voltage > 30 ms • • • • • $OOHQHUJL]HGRXWSXWUHOD\VGURSRXW 7KH/('H[WLQJXLVKHV 7KHWLPHUIRU´GXUDWLRQRIVXSSO\IDLOXUHµVWDUWVPD[LPXPK 7KHLQVWDQWDQHRXVVHWDQGVWDWLVWLFDOGDWDDUHUHFRUGHG 7KH/&'H[WLQJXLVKHV Recovery of the Supply Voltage • ,QLWLDOL]DWLRQURXWLQHLVVWDUWHG • 7KHWLPHRIRFFXUUHQFHDQGWKHGXUDWLRQRIWKHVXSSO\IDLOXUHDUHHQWHUHGLQWR PHPRU\ • 7KHWKHUPDOLPDJHLVFDOFXODWHGDQGXSGDWHG • $OORXWSXWUHOD\VUHWXUQWRWKHVWDWHEHIRUHWKHVXSSO\IDLOXUHH[FHSWIRUUHOD\DQG ZKHQFRQWUROLVH[HFXWHGYLDFRPPXQLFDWLRQ • /&'DQG/('DFWLYDWH Publication 825-UM001B-EN-P January 2001 Equipment Description 2-13 Automatic Recognition of Converter Module 7KH%XOOHWLQUHJXODUO\FKHFNV • 7KHOLQNEHWZHHQWKHEDVLFXQLWDQGWKHFRQYHUWHUPRGXOH • 9HULILHVWKDWWKHIXOOORDGFXUUHQWVHWRQWKHEDVLFXQLWLVZLWKLQWKHUDQJHRIWKH FRQYHUWHUPRGXOH • 7KHVXSHUYLVRU\FLUFXLWV ,QWKHHYHQWRIDIDXOWWKHRXWSXWUHOD\05WULSVDQGWKHW\SHRIIDXOWLVGLVSOD\HGRQWKH/&' Table 2.I Converter Module — Related Error Messages Verify Verification that FLC on basic unit is within range of converter module Sequence • After switching on supply • Supervision while motor is stationary • When running, as soon as the link is interrupted the basic unit will trip and display one or more of the following causes: • short circuit, thermal, earth fault (Holmgreen = residual), asymmetry, overcurrent • After switching on supply • After each change in setting of rated current Supervisory circuits • Continuous monitoring (hardware errors, supply, etc.) Link between basic unit and converter module Display 825-MCM NOT CON Ie OUT OF RANGE ERROR 825-MCM Publication 825-UM001B-EN-P January 2001 Chapter 3 Functions Menu Overview Actual Values ,Q´$FWXDO9DOXHVµPRGHDOORSHUDWLQJSDUDPHWHUVFDQEHVHOHFWHGDQGUHDGIURPWKH/&' Table 3.A Actual Values Overview Display List Option Card Cat. No. Page Display List Option Card Cat. No. Page I MOTOR A — 6-6 I earth - H %I — 6-7 I MOTOR %e — 6-5 I earth - C mA — 6-7 I1 %e — 6-6 Tambient ºC 825-MMV 6-7 I2 %e — 6-6 PT100 #1(…6) ºC 825-MMV 6-7 I3 %e — 6-6 PROBUS — 825-MPB 6-7 TRIP IN s — 6-6 RIO — 3600-RIO 6-7 RESET IN s — 6-7 MODBUS — 3600-MBS 6-7 ASYM % — 6-7 DevNet — 825-MDN 6-7 Publication 825-UM001B-EN-P January 2001 Functions 3-2 Set Values 7KHSDUDPHWHUV´0DLQ6HWWLQJVµDQG´6SHFLDO6HWWLQJVµPXVWEHSURJUDPPHGIRUHYHU\ DSSOLFDWLRQ7KHRWKHUSDUDPHWHUVHJ´+LJK2YHUORDGµ´$V\PPHWU\µKDYHIDFWRU\VHW YDOXHVZKLFKDUHFRUUHFWIRUPRVWDSSOLFDWLRQV Table 3.B Set Values Overview Parameter List THERMAL TRIP Option Card Cat. No. Page — 5-4 Parameter List THERMAL RESET LEVEL Option Card Cat. No. Page — 5-10 THERMAL WARNING — 5-4 COOLING CONSTANT RATIO — 5-10 ASYMMETRY TRIP — 5-5 PTC TRIP 825-MST 5-10 ASYMMETRY WARNING — 5-5 PTC RESET 825-MST 5-10 OVERCURRENT TRIP — 5-5 CONTROL INPUT #1 5-10 OVERCURRENT WARNING — 5-5 DELAY AUX REL # 2 5-10 EARTH FAULT PROTECTION — 5-6 SPEED SWITCH EARTH FAULT HOLMGREEN TRIP — 5-6 DISABLE FUNCTION 5-11 825-MST 5-7 CONTROL INPUT #2 5-12 EARTH FAULT CORE TRIP EARTH FAULT CORE WARNING 825-MST 5-7 DELAY AUX REL #3 SHORT CIRCUIT PROTECTION 825-MST 5-7 NEW FULL LOAD CURRENT UNDERLOAD TRIP — 5-8 PHASE REVERSAL TRIP UNDERLOAD WARNING — 5-8 PHASE LOSS TRIP STAR DELTA STARTING 825-MST 825-MST 5-11 5-12 5-12 825-MLV 5-13 5-13 825-MLV 5-8 PT100 PROTECTION WARM STARTING — 5-9 PT100 RESET/WARNING START INHIBIT — 5-11 OUTPUT 4…20 mA START CONTROL — 5-9 STATION NUMBER — 5-16 MAIN RELAY CONNECTION — 5-10 REL #2-3 VIA COM — 5-16 825-MMV 5-13 825-MST 5-15 ALARM RELAY CONNECTION — 5-10 CLEAR RECORDED VALUES — 5-16 THERMAL RESET — 5-10 FACTORY SETTINGS — 5-16 ATTENTION $OOSDUDPHWHUVFDQEHVHWLQFOXGLQJWKRVHIXQFWLRQVDVVRFLDWHGZLWK RSWLRQERDUGVWKDWKDYHQRWEHHQPRXQWHGLQWKHGHYLFH+RZHYHU WKHVHZDUQLQJDQGWULSIXQFWLRQVDUHQRWRSHUDWLRQDOXQOHVVWKH FRUUHVSRQGLQJRSWLRQERDUGLVLQVWDOOHG Publication 825-UM001B-EN-P January 2001 3-3 Functions Recorded Values ,Q´5HFRUGHGYDOXHVµPRGHDOOUHFRUGHGGDWDFDQEHVHOHFWHGDQGUHDGIURPWKH/&' Table 3.C Recorded Values Overview Option Card Cat. No. Display List Page Display List Option Card Cat. No. Page 825-M MAIN TIME h min. — 7-2 CAUSE 2PRV TRIP — — 7-3 MOTOR RUNNING HR h min. — 7-2 CAUSE 3PRV TRIP — — 7-3 SINCE LAST START h min. — 7-2 CAUSE 4PRV TRIP — — 7-3 SINCE 1PRV START h min. — 7-2 SINCE EMG START h min. — 7-3 SINCE 2PRV START h min. — 7-2 SINCE POWER OFF h min. — 7-3 SINCE 3PRV START h min. — 7-2 DURATION POW OFF h min. — 7-3 SINCE 4PRV START h min. — 7-2 I BEF LAST TRIP %e — 7-3 SINCE LAST TRIP h min. — 7-2 AS BEF LAST TRIP % — 7-3 SINCE 1PRV TRIP h min. — 7-3 EF BEF LAST TRIP mA, %e — 7-3 SINCE 2PRV TRIP h min. — 7-3 MAX T BEF LAST TRIP ºC 825-MMV 7-4 SINCE 3PRV TRIP h min. — 7-3 TH BEF LAST TRIP % — 7-4 SINCE 4PRV TRIP h min. — 7-3 NUMBER START — — 7-4 CAUSE LAST TRIP — — 7-3 — — 7-4 CAUSE 1PRV TRIP — — 7-3 NUMBER TRIP (TH, AS, OC, EF, SC, UL, PTC, PR, PL, PT100) Publication 825-UM001B-EN-P January 2001 Functions 3-4 Operation Selecting the Setting/Display Mode SET Actual Change mode by pressing Set Recorded Values ACTUAL VALUES Actual Indication of actual operational data Change SET VALUES Actual RECORDED VALUES Change Setting mode (set/vary, store parameters) Actual Change Indication of statistical data Publication 825-UM001B-EN-P January 2001 3-5 Functions Setting the Operation Parameters (Set Values) 7H[WDQGGDWDDUHLQGLFDWHGDOWHUQDWHO\DSSUR[LPDWHO\VWH[WDQGVGDWD2QWKH´VHFRQG OLQHµWKHGDWDWKDWLVIDFWRU\VHWRUVXEVHTXHQWO\PRGLILHGLVGLVSOD\HG)XQFWLRQVQRW DFWLYDWHG2))DUHQRWLQGLFDWHG 7RVHWWKHRSHUDWLRQSDUDPHWHUVUHSHDWHGO\SUHVVWKH9DOXHVEXWWRQXQWLO´6(7 9$/8(6µDSSHDUVRQWKHGLVSOD\ Figure 3.1 Setting Mode SET VALUES Actual Change Set Recorded Enter Values Select Settings 3UHVV6HOHFW8SRU'RZQXQWLOWKHGHVLUHGSDUDPHWHUHJ´)8///2$'&855µ DQG´$PSµDSSHDUVGLVSOD\DOWHUQDWHVEHWZHHQWH[WDQGGDWD Figure 3.2 Menu Selection 35 AMP FULL LOAD CURR Change Actual Set Enter Recorded Values Select Settings 3UHVVWKH6HWWLQJV&KDQJHEXWWRQRQFH7KHVHWYDOXHEHJLQVWRIODVK$QHZVHWYDOXH FDQQRZEHHQWHUHGE\PHDQVRIWKH6HOHFWNH\V8SRU'RZQ7KHHQWU\LVFRPSOHWHG E\SUHVVLQJ6HWWLQJV(QWHU Publication 825-UM001B-EN-P January 2001 Functions 3-6 Figure 3.3 Entering a Data Value 35 AMP Actual Change Set Recorded Values Enter Select Settings 1RWH +ROGGRZQWKH6HOHFWEXWWRQWRFKDQJHWKHYDOXHVPRUHTXLFNO\ Table 3.D Display Example of Set Values Menu LCD SET VALUES Range Description — Mode: setting parameters 0.5…2 000 Rated motor current in A No/Yes Primary current transformer in use PRIMARY C.T. RATIO 1 1…2 000 Primary current transformer ratio LOCKED ROT CURR 6 x Ie 2.5…12 Locked rotor current as ___ e LOCKED ROT TIME 10 sec 1…600 Maximum permitted time for the rotor to be stalled from cold FULL LOAD CURR 20 A PRIMARY C.T. NO 1RWH )RUDFRPSOHWHOLVWRISDUDPHWHUVUHIHUWR&KDSWHU Publication 825-UM001B-EN-P January 2001 3-7 Functions Indications of Actual Values ,Q´$FWXDO9DOXHVµPRGHDOORSHUDWLQJSDUDPHWHUVFDQEHVHOHFWHGDQGUHDGIURPWKH/&' 3UHVV9DOXHVXQWLO´$&78$/9$/8(6µDSSHDUVRQWKHGLVSOD\ 3UHVV6HOHFW8SRU'RZQXQWLOWKHGHVLUHGLQIRUPDWLRQLVGLVSOD\HG Figure 3.4 Selecting the Actual Values ACTUAL VALUES Actual Change Set Recorded Enter Values Select Settings I MOTOR 00 % Ie Actual Change Set Recorded Values Enter Select Settings Table 3.E Display Example of Actual Values Menu LCD Range Description — Display of the actual values I MOTOR…A 0.00…49.99 50…24 000 Motor current in A TH UTILIZ…% 0…100 Thermal utilization 0/20…999 Motor current as percent of rated current ACTUAL VALUES I MOTOR…% Ie 1RWH )RUDFRPSOHWHOLVWRISDUDPHWHUVUHIHUWR&KDSWHU Publication 825-UM001B-EN-P January 2001 Functions 3-8 Applications 7KH´$FWXDO9DOXHVµPRGHSURYLGHV • $VVLVWDQFHGXULQJSURJUDPPLQJDQGVHWXS • 9HULILFDWLRQDIWHUPDLQWHQDQFHRUSURGXFWLRQFKDQJH • &RQWLQXRXVRSHUDWLRQDOVXSHUYLVLRQ Indications of Recorded Values (Statistics) ,Q´5HFRUGHG9DOXHVµPRGHDOOUHFRUGHGGDWDFDQEHVHOHFWHGDQGUHDGIURPWKH/&' 3UHVV9DOXHVXQWLO´5(&25'('9$/8(6µDSSHDUVRQWKHGLVSOD\ 3UHVV6HOHFW8SRU'RZQXQWLOWKHGHVLUHGVWDWLVWLFDOLQIRUPDWLRQLVGLVSOD\HG Figure 3.5 Selecting Recorded Data RECORDED VAL Actual Change Set Recorded Values Enter Select Settings 2 h 28 min SINCE LAST TRIP Actual Change Set Recorded Values Enter Select Settings Publication 825-UM001B-EN-P January 2001 3-9 Functions Table 3.F Display Example of Recorded Values LCD Description RECORDED VALUES Display of the statistical data 825-M MAIN TIME _ _ _ H_ _ _MIN Bulletin 825-M* running time (including interruption ≤ 8 hour of control voltage in hours, minutes) MOTOR RUNNING TIME _ _ _h_ _ _min Total motor running time in hours, minutes 1RWH )RUDFRPSOHWHOLVWRISDUDPHWHUVUHIHUWR&KDSWHU Applications 7KH´5HFRUGHG9DOXHVµPRGHSURYLGHV • $QDO\VLVRIPRWRUIDXOWVDQGSURGXFWLRQLQWHUUXSWLRQV • $QDO\VLVRISUHPDWXUHPRWRUIDLOXUHV • $PHDQVRIGHWHUPLQLQJPDLQWHQDQFHMREVRQWKHVZLWFKJHDUPRWRUDQGLQVWDOODWLRQ Test Button :KHQWKHPRWRULVDWVWDQGVWLOOWKHDODUPVWULSVDQGWULSSLQJWLPHVRIWKHSURWHFWLYH IXQFWLRQVFDQEHFKHFNHGZLWKRXWH[WHUQDODLGVE\SUHVVLQJWKH7HVWEXWWRQ Figure 3.6 Basic Unit Test Button SMART MOTOR MANAGER Change Test Enter Settings Publication 825-UM001B-EN-P January 2001 Reset Functions 3-10 Testing the Thermal Trip 3UHVVWKH7HVW EXWWRQ /&' TEST THERMAL ON $IWHUWKHVHWEORFNLQJWLPHKDVH[SLUHGWKHEDVLFXQLWPXVWWULS /&' LOCK ROT TIME _ _ _sec 7KH/('OLJKWV 7KHVHOHFWHGRXWSXWUHOD\SLFNVXS05PDLQUHOD\RQWULS /&' THERMAL TRIP Resetting $XWRPDWLF 7KHWULSEHFRPHVLQDFWLYHZKHQWKH7HVW EXWWRQLVQRORQJHUSUHVVHG 0DQXDO 5HVHWWKHWULSZLWKWKH5HVHWEXWWRQ 1RWH $IWHUWKHWHVWWKHWKHUPDOLPDJHUHVXPHVLWVFRUUHFWVWDWH6LPXODWLRQRIWKHPRWRU FRROLQJLVQRWDIIHFWHGE\WKHWHVW Testing the Trips (Asymmetry/Unbalance, Underload, etc.) ([DPSOH$V\PPHWU\ :KHQLQ´6HW9DOXHVPRGHµDFFHVVWKHVHOHFWHGRXWSXWUHOD\ /&' ASYMMETRY TRIP AUX RELAY #2 Publication 825-UM001B-EN-P January 2001 3-11 Functions ,IQRRXWSXWLVDVVLJQHGWKHIROORZLQJUHDGRXWDSSHDUV /&' ASYMMETRY TRIP NO OUTPUT RELAY 3UHVVWKH7HVW EXWWRQ /&' TEST $IWHUWKHVHWWULSGHOD\H[SLUHVWKHEDVLFXQLWPXVWWULS /&' AS TRIP TIME _ _ _sec 7KH/('OLJKWV 7KHVHOHFWHGRXWSXWUHOD\SLFNVXS /&' ASYMMETRY TRIP Resetting &DQFHOWKHWULSE\SUHVVLQJ5HVHW Testing the Warning Functions ([DPSOH$V\PPHWU\ZDUQLQJ :KHQLQ´6HW9DOXHVµPRGHDFFHVVWKHVHOHFWHGRXWSXWUHOD\ /&' AS WARNING ALARM RELAY Publication 825-UM001B-EN-P January 2001 Functions 3-12 3UHVVWKH7HVW EXWWRQ /&' TEST 7KH/('IODVKHVDQGWKHVHOHFWHGRXWSXWUHOD\SLFNVXSLPPHGLDWHO\ /&'IODVKHV /&' TEST AS WARNING Resetting $VVRRQDVWKH7HVW EXWWRQLVQRORQJHUSUHVVHGWKHXQLWZLOODXWRPDWLFDOO\UHVHW Publication 825-UM001B-EN-P January 2001 3-13 Functions Function Summary Table 3.G Protective Functions Summary Thermal overload Asymmetry (phase failure) High overloading/jam Underload Underload delayed enable Earth (ground) fault (residual) Starting time monitor Limited starts per hour Short-circuit Earth (ground) fault (core balance c.t.) Stalling during start Thermistor input (PTC) Off 5 mA…50 A 1A 0.1…5 s — ➊ ➊ — — — Bulletin 825-MLV Option Card Off — — — Off — — — Bulletin 825-MMV Option Card Off Off Phase sequence (motor supply) Phase failure (motor supply) PT100 input #1…#6 (RTD) (stator, bearings) PT100 input #7 (RTD) ➋ Functions Tripping Factory Relays ➌ Factory Setting Factory Factory Delay Setting Selection Setting Range Setting Setting Range Bulletin 825-M… Basic Unit On 100% — — MR, No MR On 5…80% 35% 1…25 s 2.5 s All MR 1…6 e 2.4 e On 0.1…5 s 0.5 s All MR Off 25…100% 75% 1…60 s 10 s All MR On — — 0…240 s 0s — — On 10…100% 50% 0.1…5 s 0.5 s All MR Off — — 1…240 s 10 s All MR Off 1…10 2 — — All MR Bulletin 825-MST Option Card 4…12 e 10 e 20…990 ms 50 ms Off #1, No #1 0.5 s All MR — 800 ms All ➊ All MR ➊ MR 1s 2s All All MR MR Off 50…200 °C 50 °C — <8s Off — — — — MR, AL #1…#3 — MR — ➊ Via external speedometer (control input #1), output and trip relays as for high overload. ➋ Allowing for the ambient temperature in the thermal image. ➌ Only one relay per function can be selected: MR = main relay, AL = alarm relay, auxiliary relay #1…#5 (if auxiliary relays #2 and #3 are assigned to the communication [refer to page 5-16] they cannot be selected here). ATTENTION :DUQLQJIXQFWLRQVHWWLQJVPXVWEHVXFKWKDWDVVRFLDWHGDODUPVDUH DFWXDWHGEHIRUHDWULSRFFXUV Publication 825-UM001B-EN-P January 2001 Functions 3-14 Table 3.H Warning Functions Summary Functions Factory Setting Thermal utilization (%Δϑ load) Asymmetry (% e) High overloading (x e) Underload Earth (ground) fault (core balance c.t.) Tripping Delay Range Bulletin 825-M… Basic Unit Factory Relays ➊ Setting Selection Factory Setting Setting Range Factory Setting Off 50…99% 75% — — AL, #1…5 AL Off 5…80% 1…6 e 20% 2 e — — AL, #1…5 AL Off Off — 25…100%➋ 75%➋ — Bulletin 825-MST Option Card — — AL, #1…5 AL, #1…5 AL AL Off 5 mA…50 A 500 mA — — AL, #1…5 AL — AL, #1…3 AL Bulletin 825-MMV Option Card PT100 input #1…#6 (RTD) (stator, bearings) Off 50…200 °C 50 °C — ➊ Only one relay per function can be selected: MR = main relay, AL = alarm relay, auxiliary relay #1…#5 (if auxiliary relays #2 and #3 are assigned to the communication [refer to page 5-16] they cannot be selected here). ➋ Same setting as for the Underload Trip function. Publication 825-UM001B-EN-P January 2001 3-15 Functions Table 3.I Control Functions Summary Warm start (% of “cold” trip) Emergency override of thermal trip ➊ Tripping Delay Range Bulletin 825-M… Basic Unit Functions Factory Setting Setting Range Factory Setting Off 50…100% 70% 4…60 min. ➋ 60 min. ➋ — — — — — — — — — Factory Relays Factory Setting Selection Setting Bulletin 825-MST Option Card Analog output assigned 4…20 mA to: 0…100% thermal utilization On — — — — 50…200 °C PT100 max. 0…200% e temperature Motor Bulletin 825-MST Option Card, Control Input #1: (24V AC/DC; 8 mA) One of 3 functions can be selected: 1) Pickup delay, relay #2 Off — — 0…240 s 1s — 1) Dropout delay, relay #2 — — — 0…240 s 2s — — Off — — — — — #2 #2 high overload relay 3) Disable protective functions: Asymmetry/phase failure Off High overload/jam Off Earth (ground) fault Off Short-circuit Off Underload Off Limiting starts/hour Off PTC Off PT100 (RTD) Off — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — 2) Speed switch ➊ Terminals Y11…Y12 must be jumpered. ➋ Minimum waiting time between two warm starts. Publication 825-UM001B-EN-P January 2001 Functions 3-16 Table 3.I Control Functions Summary (Continued) Tripping Functions Setting Factory Relays Factory Factory Delay Factory Setting Selection Setting Range Setting Range Setting Bulletin 825-MST Option Card, Control Input #2: (24V AC/DC; 8 mA) One of three functions can be selected: 1) Pickup delay, relay Off — — 0…240 s 1s — #3 #3 1) Dropout delay, relay — — — 0…240 s 2s — #3 #3 0.5… 2) Set second rated Off 20 A — — — — current ➊ 2 000 A 3) Disable protective functions: Asymmetry/phase Off — — — — — — failure High overload/jam Off — — — — — — Earth (ground) fault Off — — — — — — Short-circuit Off — — — — — — Underload Off — — — — — — Limiting starts/hour Off — — — — — — PTC Off — — — — — — PT100 (RTD) Off — — — — — — Bulletin 825-MLV Option Card Y-Δ at 1.1 e Y-Δ at 1…240 s 10 s Star-delta starting Off — — Y: #4/Δ:#5 ➊ For example, when used with two-speed motors Functions of the Basic Unit (Cat. No. 825-M…) Thermal Overload 7KH6PDUW0RWRU0DQDJHUDFFXUDWHO\VLPXODWHVWKHUPDOFRQGLWLRQVLQWKHPRWRUIRUDOO RSHUDWLQJPRGHV7KLVSHUPLWVPD[LPXPXWLOL]DWLRQRIDQLQVWDOODWLRQDQGDVVXUHVVDIH SURWHFWLRQRIWKHPRWRU 7KHEDVLFXQLWXVHVDWZRERG\VLPXODWLRQWRFDOFXODWHDPRUHSUHFLVHUHSUHVHQWDWLRQRID PRWRU·VWKHUPDOFRQGLWLRQGXULQJDOOPRGHVRIRSHUDWLRQ$WZRERG\VLPXODWLRQLQFRUSRUDWHV WKHWHPSHUDWXUHULVHFKDUDFWHULVWLFVRIERWKWKHVWDWRUZLQGLQJVDQGWKHLURQPDVVRIWKH PRWRULQWRWKHWKHUPDOLPDJH 7KHVLPXODWLRQRIWKH6PDUW0RWRU0DQDJHUDFFXUDWHO\UHSUHVHQWVWKHFRQGLWLRQVLQWKH PRWRUDWDOOWLPHV Publication 825-UM001B-EN-P January 2001 3-17 Functions :KLOHWKHPRWRULVUXQQLQJWKHLURQORVVHVDVZHOODVORVVHVFDXVHGE\DV\PPHWU\DUHIHGWR WKHVLPXODWLRQPRGHO$OORZDQFHIRUWKHDPELHQWWHPSHUDWXUHRIWKHPRWRUDVDQRSWLRQ HQKDQFHVWKHPD[LPXPXWLOL]DWLRQRIWKHLQVWDOODWLRQHYHQZLWKFRQVLGHUDEOHYDULDWLRQRIWKH WHPSHUDWXUH:LWKRXWWKHRSWLRQDOLQFOXVLRQRIWKHDPELHQWWHPSHUDWXUHRIWKHPRWRUWKH WKHUPDOPRGHOEDVHVWKHWKHUPDOFDOFXODWLRQRQDQDPELHQWWHPSHUDWXUHRI&7KH GLIIHUHQWFRROLQJFRQGLWLRQVRIDVHOIYHQWLODWHGPRWRUZKHQUXQQLQJDQGDWVWDQGVWLOODUH WDNHQLQWRDFFRXQWE\WZRGLIIHUHQWWLPHFRQVWDQWV$IWHUVZLWFKLQJRIIWKHUDSLGFRROLQJRI WKHZLQGLQJWRWKHLURQWHPSHUDWXUHDQGWKHVXEVHTXHQWVORZFRROLQJRIWKHPRWRUDVDZKROH DUHVLPXODWHG 7KHWZRERG\VLPXODWLRQFDQEHUHSUHVHQWHGDVDFDSDFLWDQFHUHVLVWDQFHQHWZRUN6HH )LJXUH Figure 3.7 Two-Body Simulation of the Heating Up of a Motor PCu ≈ (IM2 + kIG2) R1 PFe S1 C1 C2 R2 R3 ϑ amb C1 C2 R1 R2 R3 PCu PFe S1 M G ϑamb k Capacitance representing the heat capacity of the winding (adjustable) Capacitance representing the heat capacity of the iron an other masses of the machine Resistance representing resistance to heat transfer between winding and iron Resistance representing heat dissipation to the surroundings when stationary Resistance representing heat dissipation to the surroundings when running Input of a current proportional to the copper losses Input of a current proportional to the iron losses Changeover from stationary to running Motor current Opposing component caused by asymmetry Allowance for the temperature of the environment coolant (optional PT100 #7) Constant factor according to IEC and NEMA Adjustable Ratio of Cooling Constants 7KHUDWLRRIWKHFRROLQJFRQVWDQWZKHQWKHPRWRULVDWVWDQGVWLOOWRWKHFRROLQJFRQVWDQWZKHQ LWLVUXQQLQJDOORZVIRUWKHGLIIHUHQFHLQFRROLQJLQWKHVHVWDWHV7KHFRROLQJFRQVWDQWUDWLRLV VHWWRLQWKHIDFWRU\7KLVYDOXHLVFRUUHFWIRUWKHPDMRULW\RIVHOIFRROHG$&PRWRUV )RUVHSDUDWHO\YHQWLODWHGDQGVSHFLDOPRWRUVDQGWKRVHZKLFKUHVSRQGYHU\TXLFNO\RUYHU\ VORZO\\RXPD\KDYHWRPRGLI\WKHFRROLQJIDFWRU Publication 825-UM001B-EN-P January 2001 Functions 3-18 Indication of the Time to Tripping /&' TRIP IN…sec 7KLVIHDWXUHSURYLGHVFRQWLQXRXVLQGLFDWLRQRIWKHWLPHUHPDLQLQJEHIRUHWULSSLQJZKHQLQDQ RYHUORDGFRQGLWLRQ7KLVHQDEOHV\RXWRLQWHUYHQHEHIRUHWULSSLQJRFFXUV%ODQNGLVSOD\ PHDQV7LPH! V Indication of the Time until the Thermal Trip can be Reset /&' RESET IN …sec )ROORZLQJDWKHUPDOWULSWKHEDVLFXQLWPD\QRWEHUHVHWXQWLOWKHUHVHWWKUHVKROGKDVEHHQ UHDFKHG7KLVLVVHWWRDWHPSHUDWXUHULVHRILQWKHIDFWRU\ Adjustable Setting Characteristic 7KHGHJUHHRILQHUWLDFDQEHVHWWRPDWFKWKHSURSHUWLHVRIWKHPRWRU$VXLWDEOHUHIHUHQFH YDOXHDPRQJRWKHUVLVWKHDGPLVVLEOHORFNHGURWRUWLPHRIWKHFROGPRWRULQFRQMXQFWLRQ ZLWKWKHDVVRFLDWHGFXUUHQW7KLVPDNHVLWSRVVLEOHWRSURWHFWPRWRUVWKDWDUHWKHUPDOO\YHU\ IDVWRUYHU\VORZ6HH)LJXUH )LJXUH DQG)LJXUH 7KHWKHUPDOFDSDFLW\RIWKHLURQLVSDUWLFXODUO\LPSRUWDQWDWVPDOORYHUORDGV$OORZLQJIRUWKLV LQWKHVLPXODWLRQHQDEOHVWKHRYHUORDGUHVHUYHVRIWKHPRWRUWREHXWLOL]HGZLWKRXWULVNLQJD SUHPDWXUHSURWHFWLYHWULS Publication 825-UM001B-EN-P January 2001 3-19 Functions Figure 3.8 Trip Characteristic (10…30 s) 10000.0 1000.0 From cold, without pre-load 10s 20s 30s Trip time [s] 100.0 10.0 10s 20s 30s From warm, pre-load 1xIe 1.0 0.1 1.0 1.1 2.0 3.0 4 Load current as multiple of full load current Publication 825-UM001B-EN-P January 2001 5 6 7 8 9 nxI e 10 Functions 3-20 Figure 3.9 Trip Characteristics (40…100 s) 100000.0 10000.0 From cold, without pre-load 40s 60s 100s Trip time [s] 1000.0 100.0 10.0 40s 60s 100s From warm, pre-load 1xIe 1.0 1.0 1.1 2.0 3.0 4 Load current as multiple of full load current . 5 6 7 8 9 10 nxI e )RU8/&6$DSSOLFDWLRQVUHIHUWRSDJH Publication 825-UM001B-EN-P January 2001 3-21 Functions Table 3.J Thermal Overload Setting Parameters Detection Module ➋ 825-MCM20 825-MCM180 825-MCM630 Rated Current 0.5…2.5 A ➊ 2.5…20 A ➊ 20…180 A 160…630 A ➌ 20 A 20 A 20 A 20 A 0.01…2 A 0.1…2 A 1A 2A Locked-Rotor Current (Multiple of Rated Current) 2.5…12 e 825-MCM2 Setting range Factory setting Setting increments Setting range Factory setting Setting increments 825-MCM630N 160…630 A 20 A 2A 6 e 0.1 e Locked-Rotor Time (Admissible Locked-Rotor Time of Cold Motor) 1…600 s 10 s 1s Cooling Factor of Motor Off/On ➍ Setting range 1…10 Factory setting 2.5 Setting increments 0.5 Resetting the Thermal Trip Setting range 10…100% of thermal utilization Factory setting 50% Setting increments 1% Ultimate Release Current 1.05…1.15 e Incl. setting tolerance Setting range Factory setting Setting increments ➊ ➋ ➌ ➍ Up to 2 000 A, if primary current transformers are used. –5…60 °C (23…140 °F) UL/CSA 160…434 A The cooling factor can be modified to reflect different motor cooling with running motor and at standstill. Publication 825-UM001B-EN-P January 2001 Functions 3-22 Table 3.K Protection Against Thermal Overload Warning Trip Function Factory setting Setting range Factory setting Setting increments Selection Factory setting Off Response Level ➊ 55…99% 75% 1% Output Relay ➋ AL, #1…#5 AL On — 100% — MR, No output relay MR ➊ Thermal utilization % ➋ If auxiliary relays #2 and #3 are assigned to the communication (refer to page 5-16) they cannot be selected here. Asymmetry (Phase Unbalance) and Phase Failure $V\PPHWULFDOSKDVHYROWDJHVXVXDOO\RFFXUZKHQWKHOHDGVFORVHVWWRWKHPRWRUDUHWRRORQJ 7KHUHVXOWLQJFXUUHQWDV\PPHWU\LQWKHPRWRUZLQGLQJVPD\WKHQEH«WLPHVWKHYROWDJH DV\PPHWU\7KH6PDUW0RWRU0DQDJHUWDNHVLQWRDFFRXQWWKHDGGLWLRQDOWHPSHUDWXUHULVHDQG WKXVSUHYHQWVWKHOLIHRIWKHPRWRUIURPEHLQJUHGXFHG+LJKHUDV\PPHWU\RUWKHIDLOXUHRID SKDVHFDQEHFDXVHGE\GHIHFWLYHFRQWDFWVLQFLUFXLWEUHDNHUVRUFRQWDFWRUVORRVHWHUPLQDOV EORZQIXVHVDQGIDXOWVLQWKHPRWRULWVHOI5DSLGGHWHFWLRQDQGLQWHUUXSWLRQRIWKHVHIDFWRUV KHOSWRSUHYHQWGDPDJHFDXVHGE\RYHUKHDWLQJLQVXFKHTXLSPHQW7KHVWUHVVRQWKH LQVWDOODWLRQDQGWKHPRWRUEHDULQJVLVUHGXFHG7KH6PDUW0RWRU0DQDJHUPHDVXUHVWKHSKDVH FXUUHQWVDQGFDOFXODWHVWKHWRWDOFRSSHUORVVHVDFFRUGLQJWRWKHGHILQLWLRQRIYROWDJH DV\PPHWU\SHU,(&DQG1(0$ P Cu 2 2 ≈ ( M + k G ) 'HILQLWLRQRIYROWDJHDV\PPHWU\SHU,(&DQG1(0$ Max. deviation from the average of the phase voltages × 100 ΔU ( % ) = ----------------------------------------------------------------------------------------------------------------------------Average of the phase voltages Publication 825-UM001B-EN-P January 2001 3-23 Functions Figure 3.10 Reduction in Permissible Motor Output Due to Voltage Asymmetry per IEC and NEMA fR fR 1.0 ΔU 0.9 Reduction factor for motor output Voltage asymmetry in percent 0.8 ΔU 0.7 0 1 2 3 4 5 [%] Table 3.L Asymmetry (Phase Unbalance) Setting Parameters Factory setting Setting range Factory setting Setting increments Setting range Factory setting Setting increments Selection (relays) Factory setting Warning ➊ (Current Asymmetry) Function Off Response Level 5…80% 20% 5% Tripping Delay — — — Output Relay ➋ AL, #1…#5 AL Trip ➊ On 5…80% 35% 5% 1…25 s ± 0.2 s 2.5 s ± 0.2 s 0.5 s MR, AL, #1…#5 MR ➊ –5…60 °C (2…140 °F) ➋ If auxiliary relays #2 and #3 are assigned to the communication (refer to page 5-16) they cannot be selected here. High Overload and Jam :KHQDQRYHUORDGLVH[FHVVLYHO\KLJKDQGWKHPRWRUMDPVXQQHFHVVDU\PHFKDQLFDODQG WKHUPDOORDGLQJRIWKHPRWRUDQGWUDQVPLVVLRQHOHPHQWVFDQEHDYRLGHGE\VZLWFKLQJWKH PRWRURIILPPHGLDWHO\7KLVUHGXFHVFRQVHTXHQFHVRIDFFLGHQWDQGORVVRISURGXFWLRQ$ JUDGXDOLQFUHDVHLQRYHUORDGFDQEHGHWHFWHGHDUO\DQGUHSRUWHGHJEHDULQJGDPDJH7KH SURWHFWLYHIXQFWLRQDFWLYDWHVDVVRRQDVWKHPRWRUKDVVWDUWHG Publication 825-UM001B-EN-P January 2001 Functions 3-24 Application • • • • • &RQYH\LQJV\VWHPV 0LOOV 0L[HUV &UXVKHUV 6DZVHWF Figure 3.11 Function of High Overload and Jam Protection I Ie ≥ 1.2 1 3 2.4 2 1.1 t tv 4 1 2 3 Motor start ≥ 1.2 e Nominal operation High overload or jam 5 tV 4 5 Tripping delay Jam protection not active Jam protection active (tripping threshold) Table 3.M High Overload and Jam Setting Parameters Factory setting Setting range Factory setting Setting increments Setting range Factory setting Setting increments Selection (relays) Factory setting Warning ➊ Function Off Response Level 1…6 e Trip ➊ On 1…6 e 2 e 2.4 e 0.2 e 0.2 e Tripping Delay — — — Output Relay ➋ AL, #1…#5 AL 0.1…5 s ± 0.04 s 0.5 s ± 0.04 s 0.1 s MR, AL, #1…#5 MR ➊ –5…60 °C (23…140 °F) ➋ If auxiliary relays #2 and #3 are assigned to the communication (refer to page 5-16) they cannot be selected here. Publication 825-UM001B-EN-P January 2001 3-25 Functions ATTENTION ,WLVHVVHQWLDOWRVHWWKH´:DUQLQJµUHVSRQVHOHYHOWRDYDOXHOHVVWKDQ WKH´7ULSµUHVSRQVHOHYHO 1RWH ,IWKHVWDUWLQJFXUUHQWLVEHORZ)/&WKHQWKH´0RQLWRULQJWKH6WDUW7LPHµ IXQFWLRQPXVWEHDFWLYDWHG$IWHUWKHVHWPD[VWDUWLQJ7LPHKDVHODSVHGWKH´+LJK 2YHUORDG6WDOOµIXQFWLRQZLOOEHFRPHDFWLYH $SSOLFDWLRQV • 6OLSULQJPRWRUV • 6RIWVWDUWHUV • 0RWRUSURWHFWLRQZLWK´QRQIDLOVDIHPRGHµDIWHUDFRQWUROYROWDJHIDLOXUH Underload 0RWRUVWKDWDUHFRROHGE\WKHPHGLXPKDQGOHGHJIDQVVXEPHUVLEOHSXPSVFDQEHFRPH RYHUKHDWHGGHVSLWHEHLQJXQGHUORDGHG7KLVFDQEHDUHVXOWRIWKHDEVHQFHRIWKHPHGLXPRU LQVXIILFLHQWPHGLXPGXHWRFORJJHGILOWHUVFORVHGYDOYHVHWF2IWHQWKHVHPRWRUVDUH LQVWDOOHGLQLQDFFHVVLEOHSODFHVVRUHSDLULVOHQJWK\DQGH[SHQVLYH 7KHFRQVXPSWLRQRIOHVVWKDQDSUHVHWDSSOLFDWLRQVSHFLILFDPRXQWRIFXUUHQWPD\LQGLFDWHD PHFKDQLFDOGHIHFWLQWKHLQVWDOODWLRQHJWRUQFRQYH\RUEHOWGDPDJHGIDQEODGHVEURNHQ VKDIWVRUZRUQWRROV6XFKFRQGLWLRQVGRQRWKDUPWKHPRWRUEXWWKH\GROHDGWRORVVRI SURGXFWLRQ5DSLGIDXOWGHWHFWLRQKHOSVWRPLQLPL]HGDPDJH 7KHXQGHUORDGSURWHFWLRQWULSWLPHFDQEHGHOD\HGIROORZLQJHDFKVWDUWWRSUHYHQWWULSSLQJ 7KHZDUQLQJLVDFWXDWHGDVVRRQDVWKHXQGHUORDGWKUHVKROGLVUHDFKHG Application • • • • 6XEPHUVLEOHSXPSV )DQV &RQYH\RUV\VWHPV 'HWHFWLRQRIIUDFWXUHVLQPHFKDQLFDOWUDQVPLVVLRQV\VWHP Publication 825-UM001B-EN-P January 2001 Functions 3-26 Figure 3.12 Function of Underload Protection I I Ie 1 2 Ie IT 3 3 t tA tp ts 1 2 3 tA e tv tp r Tripping threshold ts Delayed activation (underload protection not active) tv Tripping delay tp Warning Start Nominal operation Underload operation Starting time Rated current Table 3.N Underload Setting Parameters Factory setting Setting range Factory setting Setting increments Setting range Factory setting Setting increments Setting range Factory setting Setting increments Selection (relays) Factory setting Warning ➊ Trip ➊ Function Off On Response Level 25…100% e ➋ ➋ 75% ➋ 5% Tripping Delay — 1…60 s -0.2 s/+0.4 s — 10 s — 1s Delayed Activation of Underload Protection — 0…240 s +0.4 s/+0.8 s — 0s — 1s Output Relay ➌ AL, #1…#5 MR, AL, #1…#5 AL MR ➊ –5…60 °C (23…140 °F) ➋ For warning, the set Response Level is the same as the level set for tripping. If the starting current is below 1.2 FLC, then the “Monitoring the Start Time” function must be activated. After the set max. starting Time has elapsed, the “High Overload/Stall” function will become active. ➌ If auxiliary relays #2 and #3 are assigned to the communication (refer to page 5-16) they cannot be selected here. Publication 825-UM001B-EN-P January 2001 3-27 Functions Earth (Ground) Fault 7KHLQVXODWLRQLQPRWRUVLVRIWHQGDPDJHGE\KLJKYROWDJHVXUJHVZKLFKPD\EHFDXVHGE\ OLJKWQLQJVWULNHVVZLWFKLQJRSHUDWLRQVLQWKHQHWZRUNFDSDFLWRUGLVFKDUJHVDQGSRZHU HOHFWURQLFVHTXLSPHQW2WKHUFDXVHVDUHDJLQJDQGVXVWDLQHGRUF\FOLFRYHUORDGLQJDVZHOODV PHFKDQLFDOYLEUDWLRQDQGWKHHQWU\RIIRUHLJQREMHFWV0RVWLQVXODWLRQIDXOWVUHVXOWLQOHDNDJH WRWKHJURXQGHGSDUWVRIWKHPDFKLQH,QHDUWKHGJURXQGHGQHWZRUNVWKHIDXOWFXUUHQWFDQ UDSLGO\ULVHWRDYHU\KLJKYDOXH'HSHQGLQJRQWKHW\SHRIQHWZRUNDQGLWVUHTXLUHPHQWV PRQLWRULQJRIHDUWKJURXQGIDXOWVLVSHUIRUPHGHLWKHUE\WKHUHVLGXDOPHWKRGRUE\XVLQJD FRUHEDODQFHFXUUHQWWUDQVIRUPHU Earth (Ground) Fault Protection by the Holmgreen Method = Residual Method (Solidly Earthed Networks) 7RGHWHFWDQHDUWKJURXQGIDXOWFXUUHQWLQHLWKHUDVROLGO\HDUWKHGJURXQGHGQHWZRUNRU RQHWKDWLVHDUWKHGWKURXJKDORZLPSHGDQFHWKHFXUUHQWVLQHDFKRIWKHWKUHHSROH FRQGXFWRUVDUHPHDVXUHG,QD´KHDOWK\µPRWRUWKLVVXPLV]HUR,IDFXUUHQWLVIORZLQJWRWKH IUDPHRIWKHPRWRUDQGWKXVWRHDUWKDQHXWUDOFXUUHQWSURSRUWLRQDOWRWKHIDXOWFXUUHQWLV SURGXFHGDWWKHQHXWUDORIWKHFXUUHQWWUDQVIRUPHU7KLVQHXWUDOFXUUHQWLVGHWHFWHGE\WKH HDUWKJURXQGIDXOWGHWHFWRUDQGFDXVHVDWULS$EULHIGHOD\KHOSVWRDYRLGQXLVDQFHWULSV FDXVHGE\WUDQVLHQWFXUUHQWWUDQVIRUPHUVDWXUDWLRQZKLFKFDQEHFDXVHGE\VZLWFKLQJ RSHUDWLRQV7KHVHQVLWLYLW\KDVWREHVXFKWKDWQHLWKHUWUDQVIRUPDWLRQHUURUVLQWKHFXUUHQW WUDQVIRUPHUQRUGLVWXUEDQFHVLJQDOVLQVWDUGHOWDZ\HGHOWDFRQQHFWLRQVFDXVHGE\WKHWKLUG KDUPRQLFFDXVHQXLVDQFHWULSSLQJ Figure 3.13 3-Phase Current Detection Measurement of the neutral current 0 in the neutral connection of the current transformer to detect an earth (ground) fault (residual circuit) L1 L2 L3 P1 S1 P1 S1 P1 S1 P2 S2 P2 S2 P2 S2 1 3 5 825-MCM I0 M1 3~ Publication 825-UM001B-EN-P January 2001 2 4 6 825-M Functions 3-28 Table 3.O Earth (Ground) Fault — Holmgreen/Residual Setting Parameters Trip ➊ Function Factory setting On Response Level Setting range Factory setting Setting increments 10…100% 50% 10% Tripping Delay Setting range Factory setting Setting increments 0.1…5 s ± 0.4 s 0.5 s 0.1 s Output Relay ➋ Selection (relays) Factory setting MR, AL, #1…#5 MR ➊ –5…60 °C (23…140 °F) ➋ If auxiliary relays #2 and #3 are assigned to the communication (refer to page 5-16) they cannot be selected here. Earth (Ground) Fault Protection with a Core Balance Current Transformer 7KLVIXQFWLRQFDQEHSURYLGHGE\WKH&DW1R067RSWLRQFDUG ,QLVRODWHGKLJKLPSHGDQFHHDUWKHGRUFRPSHQVDWHGQHWZRUNVWKHQHFHVVDU\KLJKVHQVLWLYLW\ LVREWDLQHGE\XVLQJDFRUHEDODQFHFXUUHQWWUDQVIRUPHUZKRVHFRUHVXUURXQGVDOOWKUHHRIWKH SKDVHOHDGVWRWKHPRWRU $FFRUGLQJWRWKHSULQFLSOHRIWKHUHVLGXDOFXUUHQWSURWHFWLRQFLUFXLWEUHDNHUVHQVLWLYH SURWHFWLRQDJDLQVWHDUWKJURXQGIDXOWVLVSRVVLEOH:LWKDORZUHVSRQVHWKUHVKROGTXLWHD PLQRULQVXODWLRQIDXOWFDQOHDGWRDZDUQLQJRUWULSDWDQHDUO\VWDJH Figure 3.14 Example of 2-Phase Current Sensing Example of 2-phase current detection and core balance current transformer for sensitive earth (ground) fault protection (3-phase current detection is also possible) L2 L1 L3 1 5 P1 S1 P1 S1 P2 S2 P2 S2 2 6 825-MCM 3 825-M 4 S1 · S2 M1 3~ Publication 825-UM001B-EN-P January 2001 3-29 Functions $SSOLFDWLRQ • +LJKYROWDJHPRWRUV • ,QVWDOODWLRQVLQDGLIILFXOWHQYLURQPHQWZLWKPRLVWXUHGXVWHWFHJPLQHVJUDYHO SLWVFHPHQWIDFWRU\PLOOVZRRGZRUNLQJVKRSVZDWHUSXPSLQJVWDWLRQVZDVWHZDWHU WUHDWPHQW Table 3.P Core Balance Current Transformer Setting Parameters Current Ratio Setting range Factory setting Setting steps 1…2 000 100 1 Table 3.Q Earth (Ground) Fault Core Balance Setting Parameters Factory setting Setting range Factory setting Setting increments Setting range Factory setting Setting increments Selection (relays) Factory setting Warning ➊ Function Off Response Level 5 mA…50 A 500 mA 5 mA Tripping Delay — — — Output Relay ➋ AL, #1…#5 AL Trip ➊ On 5 mA…50 A 1.0 mA 0.25 A 0.1…5 s ± 0.04 s 0.5 s 0.1 s MR, AL, #1…#5 MR ➊ –5…60 °C (23…140 °F) ➋ If auxiliary relays #2 and #3 are assigned to the communication (refer to page 5-16) they cannot be selected here. Earth (Ground) Fault Protection in High-Voltage Systems 7KLVVHFWLRQSURYLGHVDQRYHUYLHZRIHDUWKJURXQGIDXOWVLQLVRODWHGKLJKLPSHGDQFHHDUWK RUFRPSHQVDWHGQHWZRUNV :LWKHDUWKQHXWUDOSRLQWW\SHQHWZRUNVWKHPDJQLWXGHRIWKHHDUWKJURXQGIDXOWOHDN FXUUHQWLVGHWHUPLQHGE\WKHHDUWKFDSDFLWDQFHRIWKHQHWZRUNDQGWKHHDUWKUHVLVWDQFHRUWKH FRPSHQVDWLQJUHDFWRU%HFDXVHWKHVL]HRILQGXVWULDOQHWZRUNVLVOLPLWHGHDUWKIDXOWFXUUHQWV DUHYHU\VPDOO7RDJUHDWH[WHQWHDUWKFDSDFLWDQFHVDUHGHWHUPLQHGE\WKHFDEOHVDQGWKH PRWRUV 7KHFDSDFLWDQFHYDOXHVIRUFDEOHVDUHJLYHQLQFDEOHWDEOHVDQGUDQJHIURPDSSUR[LPDWHO\ «μ)NP$YDOXHEHWZHHQ«μ)SHU0:RIPRWRUUDWLQJFDQEHDVVXPHG IRUKLJKYROWDJHPRWRUV Publication 825-UM001B-EN-P January 2001 Functions 3-30 $UXOHRIWKXPEIRULQGXVWULDOPHGLXPYROWDJHQHWZRUNVLVWRDOORZDERXW$RIFDSDFLWLYH HDUWKFXUUHQWIRUHYHU\ « N9$RIV\VWHPSRZHU8VXDOO\WKHGLVSODFHPHQWYROWDJH LVPHDVXUHGDWDVLQJOHQHXWUDOSRLQWDQGLVDVVXPHGWREHUHSUHVHQWDWLYHRIWKHHQWLUHQHWZRUN 7KHHDUWKJURXQGIDXOWLVORFDOL]HGE\XVLQJDQHDUWKJURXQGIDXOWFXUUHQWGHWHFWRUVXFKDV WKH6PDUW0RWRU0DQDJHUZLWKHDUWKJURXQGIDXOWSURWHFWLRQLQWKHPRWRUIHHGHUV2IWHQ RSHUDWLRQFDQFRQWLQXHVLQFHWKHHDUWKFXUUHQWVDUHFRPSDUDWLYHO\LQVLJQLILFDQWDQGWKH LQVXODWLRQRIWKHQRQIDXOW\SKDVHVFDQEHRSHUDWHGDWDKLJKHUYROWDJHIRUDVKRUWSHULRGRI WLPH Isolated or High-Impedance Earth Networks ,QWKHFDVHRIHDUWKFDSDFLWDQFHVWKHQHXWUDOSRLQWRIWKHQHWZRUNDVVXPHVHDUWKSRWHQWLDODQG WKHVXPRIWKHFXUUHQWVIORZLQJWKURXJKWKHHDUWKFDSDFLWDQFHVLV]HUR$OVRQRFXUUHQWIORZV LQQRUPDORSHUDWLRQLQWKHKLJKYDOXHHDUWKUHVLVWRU)LJXUH )LJXUH DQG)LJXUH LQWKHFDVHRIWUDQVIRUPHUZLWKQHXWUDOSRLQW,WDYRLGVH[WUHPHRYHUYROWDJHVLQWKHHYHQWRI LQWHUPLWWHQWHDUWKIDXOWVVXFKDVFDQRFFXULQLVRODWHGQHWZRUNV ,IIRUH[DPSOHSKDVHFRQGXFWRU)LJXUH DQG)LJXUH EHFRPHVFRQQHFWHGWRHDUWK GXHWRDQHDUWKIDXOWWKHWZRRWKHUSKDVHFRQGXFWRUVFDUU\DOLQHWROLQHYROWDJHZLWKUHVSHFW WRHDUWK7KURXJKWKHLUHDUWKFDSDFLWDQFHV& 1RQWKHSRZHUVXSSO\VLGHDVVHHQIURPWKH 6PDUW0RWRU0DQDJHUDQG& 0RQPRWRUVLGHDFDSDFLWLYHFXUUHQWIORZVWRZDUGHDUWKDQG EDFNWRSKDVHFRQGXFWRUWKURXJKWKHIDXOWORFDWLRQ,QWKHFDVHRIKLJKLPSHGDQFHHDUWKLQJ )LJXUH )LJXUH DQG)LJXUH WKHQHXWUDOSRLQWYROWDJHQRZDWDKLJKYDOXH FDXVHVDQDGGLWLRQDOFXUUHQWWKDWLVOLPLWHGE\WKHHDUWKLQJUHVLVWRUWKURXJKWKHIDXOWORFDWLRQ ,QWKHHYHQWRIDQHDUWKIDXOWRQWKHSRZHUVXSSO\VLGHRIWKHPHDVXULQJORFDWLRQFXUUHQW WUDQVIRUPHULQVWDOODWLRQORFDWLRQWKHEDVLFXQLWPHDVXUHVWKHFRPSRQHQWRIWKHHDUWKFXUUHQW IORZLQJYLD& 07KHUHVSRQVHVHQVLWLYLW\PXVWEHVHOHFWHGVXFKWKDWLQWKLVFDVHWKH6PDUW 0RWRU0DQDJHUGRHVQRWWULS2QWKHRWKHUKDQGHDUWKIDXOWGHWHFWLRQE\WKH6PDUW0RWRU 0DQDJHUVKRXOGEHDVVHQVLWLYHDVSRVVLEOHVLQFHLQWKHFDVHRIHDUWKIDXOWVLQWKHPRWRU ZLQGLQJVWKHGLVSODFHPHQWYROWDJHEHFRPHVVPDOOHUWKHFORVHUWKHIDXOWORFDWLRQLVWRWKH QHXWUDOSRLQW7KHIDXOWFXUUHQWGHFUHDVHVSURSRUWLRQDOO\1RUPDOO\DUHVSRQVHWKUHVKROGLV VHOHFWHGWKDWLVJUHDWHUWKDQ«RIWKHFXUUHQWWKDWIORZVLQWKHHYHQWRIDGHDGHDUWK IDXOWDWWKHPRWRUWHUPLQDOV Neutralized Networks 6\VWHPVZLWKHDUWKIDXOWQHXWUDOL]HUVUHVRQDQWHDUWKV\VWHP3HWHUVHQFRLO$OWKRXJK FRPSHQVDWHGLQGXVWULDOQHWZRUNVDUHUDUHWKHLUPDLQIHDWXUHVDUHVKRZQLQ)LJXUH )LJXUH DQG)LJXUH 8QGHUIXOO\FRPSHQVDWHGFRQGLWLRQVWKHFRPSHQVDWLRQUHDFWRU VXSSOLHVDFXUUHQWRIWKHVDPHPDJQLWXGHDVWKDWRIWKHFDSDFLWLYHIDXOWFXUUHQWEXWSKDVH VKLIWHGE\°VRWKDWRQO\DVPDOORKPLFUHVLGXDOFXUUHQWIORZVYLDWKHIDXOWORFDWLRQ Publication 825-UM001B-EN-P January 2001 3-31 Functions Schematic Representation of Various Network Configurations and Earth (Ground) Fault Locations 7KHHDUWKJURXQGIDXOWFXUUHQWPHDVXUHGE\WKH6PDUW0RWRU0DQDJHUZLWKWKHDLGRIDFRUH EDODQFHFXUUHQWWUDQVIRUPHULVGHSHQGHQWRQWKHSRZHUVXSSO\QHWZRUNFRQILJXUDWLRQDQGRQ WKHORFDWLRQRIWKHHDUWKIDXOW7KHIROORZLQJGLDJUDPVLQGLFDWHWKHUHODWLRQVKLSVLQWKHYDULRXV DSSOLFDWLRQV 7KHV\PEROVXVHGKDYHWKHIROORZLQJPHDQLQJV & 1 (DUWKFDSDFLWDQFHRISKDVHFRQGXFWRURQSRZHUVXSSO\V\VWHPVLGH & 0 (DUWKFDSDFLWDQFHRIPRWRULQFOXGLQJVXSSO\FRQGXFWRUVEHWZHHQFXUUHQWWUDQVIRUPHU DQGPRWRU / &RPSHQVDWLQJFRLO 5 +LJKHDUWKLQJUHVLVWDQFH 7 7UDQVIRUPHU ( (DUWKJURXQGIDXOWFXUUHQW Figure 3.15 Isolated Network: Earth Fault on the Network Side The basic unit measures the earth current component through C M. T K1 1 2 3 M1 825-M 3 AC U2 U1 U3 CN IE CM Figure 3.16 Network Earthed through a High Impedance: Earth Fault on the Network Side The basic unit measures the earth current component through C M. Compensated network: Through the fault a small current flows, given by the vector sum of the earth currents. T 1 2 3 K1 825-M M1 3 AC U2 U1 U3 L R CN IE Publication 825-UM001B-EN-P January 2001 CM Functions 3-32 Figure 3.17 Isolated network: Earth (Ground) Fault on the Leads on the Motor Side The basic unit measures the earth current component through C M. T 1 2 3 K1 M1 825-M 3 AC U2 U1 U3 CN IE CM Figure 3.18 Network Earthed through a High Impedance: Earth (Ground) Fault on the Motor Leads The basic unit measures the vector sum of the earth currents through C N and the earthing resistance R. Compensated network: The basic unit measures the vector sum of the earth currents through C N and the compensating coil L. T 1 2 3 K1 3 AC M1 825-M U2 U1 U3 L R CN IE CM Figure 3.19 Isolated Network: Earth (Ground) Fault in the Motor The nearer the fault is to the motor star-point, the smaller the fault current. T K1 1 2 3 M1 825-M 3 AC U2 CN CM IE U1 U3 Figure 3.20 Network Earthed through a High Impedance: Earth (Ground) Fault on the Motor The basic unit measures vector sum of the earth currents through C N and the earthing resistance R. Compensated network: The basic unit measures the vector sum of the earth currents through C N and the compensating coil L. The nearer the fault is to the motor star-point, the smaller the fault current. T 1 K1 825-M M1 3 AC U2 U1 2 3 IE L R CN CM U3 Publication 825-UM001B-EN-P January 2001 3-33 Functions Limiting the Number of Starts per Hour (Start Lockout) Function :KHQWKHVHWQXPEHURIVWDUWVLVUHDFKHGDQGWKHPRWRULVVZLWFKHGRIIDQHZVWDUWLV SUHYHQWHG'HSHQGLQJRQLWVVHWWLQJHLWKHUWKHPDLQUHOD\FKDQJHVWR´)DXOWµRUWKHVHOHFWHG DX[LOLDU\LVDFWLYDWHG $VVRRQDVDQHZVWDUWLVSHUPLVVLEOHWKHVWDUWORFNRXWLVDXWRPDWLFDOO\UHVHW Figure 3.21 Limiting the Number of Starts per Hour I I Ie Ie II I t tw tw 60 min. First start Second start The selected relay (MR, or #1…#5) remains in the tripped position until 60 min. have expired. If an additional start is allowed, the number of starts can be increased by one. Table 3.R Starts per Hour Setting Parameters Function Factory setting Off Setting Setting range Factory setting Setting increments 1…10 starts/hour 2 starts/hour 1 Output Relay ➊ Selection (relays) Factory setting MR, AL, #1…#5 MR ➊ If auxiliary relays #2 and #3 are assigned to the communication (refer to page 5-16) they cannot be selected here. ATTENTION 7KHPRWRUPDQXIDFWXUHU VLQVWUXFWLRQVUHJDUGLQJWKHSHUPLVVLEOH QXPEHURIVWDUWVSHUKRXUDQGWKHPLQLPXPZDLWLQJWLPHEHWZHHQ LQGLYLGXDOVWDUWVPXVWEHFRPSOLHGZLWK 1RWH 7KHWKHUPDOSURWHFWLRQRIWKHPRWRULVLQGHSHQGHQWRIWKLVIXQFWLRQ(DFKVWDUW GHSHQGVRQWKHWKHUPDOUHVHUYHRIWKHPRWRU Publication 825-UM001B-EN-P January 2001 Functions 3-34 Monitoring the Starting Time Function 7KHVWDUWLQJWLPHRIWKHPRWRULVPRQLWRUHG,IVWDUWLQJKDVQRWILQLVKHGE\WKHVHWWLPHWKH LQVWDOODWLRQFDQEHVZLWFKHGRII7KLVPRQLWRULQJLVLQGHSHQGHQWRIWKHWKHUPDOVWDWHRIWKH PRWRU 7KHEHJLQQLQJRIDVWDUWLVUHFRJQL]HGE\WKH6PDUW0RWRU0DQDJHUZKHQWKHPRWRUFXUUHQW UHDFKHVH6WDUWLQJLVGHHPHGWRKDYHEHHQFRPSOHWHGZKHQWKHPRWRUFXUUHQWLVOHVVWKDQ H Applications • ,QVWDOODWLRQVLQZKLFKDQHOHYDWHGORDGRUVWDOOLQJRIWKHGULYHKDYHWREHGHWHFWHG GXULQJWKHVWDUWLQJVWDJHLQRUGHUWRDYRLGVHULRXVGDPDJH3RVVLEOHFDXVHV RYHUORDGHGLQVWDOODWLRQGHIHFWLYHEHDULQJVRUWUDQVPLVVLRQHOHPHQWV Figure 3.22 Monitoring Starting Time I ≥1.2 Ie 1 3 2 ≤1.1 Ie t tv 1 2 tV 3 Motor starting current ≥ 1.2 e Rated conditions Max. starting time Tripping if starting lasts too long Publication 825-UM001B-EN-P January 2001 3-35 Functions Table 3.S Monitoring Start Time Setting Parameters Function Factory setting Off Max. Starting Time ➊ Setting range Factory setting Setting increments 1…240 s ± 0.04 s 10 s ± 0.04 s 1s Output Relay ➋ Selection (relays) Factory setting MR, AL, #1…#5 MR ➊ –5…60 °C (23…140 °F) ➋ If auxiliary relays #2 and #3 are assigned to the communication (refer to page 5-16) they cannot be selected here. 1RWH :LWK6WDU'HOWD:\H'HOWDVWDUWLQJWKHWRWDOVWDUWLQJWLPH6WDUDQG'HOWDLV PRQLWRUHG,ILPPHGLDWHVZLWFKRIILVGHPDQGHGLQWKHHYHQWRIVWDOOLQJPRQLWRULQJPXVWEH SURYLGHGE\D]HURVSHHGVZLWFKIXQFWLRQ´VWDOOLQJGXULQJVWDUWLQJµ 1RWH ,IWKHVWDUWLQJFXUUHQWLVEHORZ)/&WKHQWKH´0RQLWRULQJWKH6WDUW7LPHµ IXQFWLRQPXVWEHDFWLYDWHG$IWHUWKHVHWPD[VWDUWLQJ7LPHKDVHODSVHGWKH´+LJK 2YHUORDG6WDOOµIXQFWLRQZLOOEHFRPHDFWLYH $SSOLFDWLRQV • 6OLSULQJPRWRUV • 6RIWVWDUWHUV • 0RWRUSURWHFWLRQZLWK´QRQIDLOVDIHPRGHµDIWHUDFRQWUROYROWDJHIDLOXUH Warm Start Function 7KHPRWRUZLQGLQJVPD\EHKHDWHGIRUDVKRUWWLPHDERYHWKHSHUPLVVLEOHWHPSHUDWXUHOLPLW 7KLVDSSOLHVSDUWLFXODUO\WRURWRUFULWLFDOPRWRUV7KHWHPSHUDWXUHWKDWLVSHUPLWWHGIRUWKLV VKRUWSHULRGLVDSSUR[LPDWHO\ °&DQGLVWKXVDSSUHFLDEO\KLJKHUWKDQWKHFRQWLQXRXV RSHUDWLQJWHPSHUDWXUHRI« °&7KLVPHDQVWKDWDPRWRUZDUPIURPUXQQLQJKDVD UHODWLYHO\ORQJSHUPLVVLEOHVWDUWLQJWLPH7KLVSURSHUW\RIWKHPRWRUFDQEHXVHGZLWKWKH 6PDUW0RWRU0DQDJHUZKLFKLVIDFWRU\VHWIRURQHZDUPVWDUWSHUKRXU7KHWULSSLQJWLPHLV WKHQRIWKDWIURPFROG7KHZDUPVWDUWIXQFWLRQLVVZLWFKHGRIILQWKHIDFWRU\$V DGGLWLRQDOSURWHFWLRQIRUWKHPRWRUWRRPDQ\ZDUPVWDUWVFDQEHSUHYHQWHGE\WKH´OLPLWLQJ WKHQXPEHURIVWDUWVSHUKRXUµIXQFWLRQ Publication 825-UM001B-EN-P January 2001 Functions 3-36 Figure 3.23 Current and Temperature Curves for Warm and Cold Motor Starts and the Smart Motor Manager Tripping Limits I IA 1 2 3 4 Ie t ϑ1 ϑ ϑe t t1 tw tw tw A e ϑe ϑ1 Starting current Rated current Permissible temperature of the motor in continuous operation and normal tripping limit of 825-M for continuous operation Motor temperature permissible for a short time and tripping limit of 825-M with modified characteristic for warm start ATTENTION 1 2 3 4 t1 tw First start (cool) First warm start Second warm start Cold start (after the motor has cooled down) Minimum time before first start is possible (t1 > 10t6e) Minimum waiting time warm starts (4…60 min.) 7KHPRWRUPDQXIDFWXUHU VLQVWUXFWLRQVPXVWEHFRPSOLHGZLWK HVSHFLDOO\UHJDUGLQJWKHPLQLPXPZDLWEHWZHHQWZRVWDUWV $QDWWHPSWWRVWDUWPD\EHPDGHEHIRUHWKHWLPHKDVHODSVHG7KH6PDUW0RWRU0DQDJHUZLOO WULSGXULQJVWDUWLQJLIWKHWKHUPDOFDSDFLW\DYDLODEOHLVQRWVXIILFLHQW Publication 825-UM001B-EN-P January 2001 3-37 Functions Applications • 7KH:DUP6WDUWIXQFWLRQFDQEHXVHGLQDQ\LQVWDOODWLRQWKDWPD\KDYHWREHUHVWDUWHG LPPHGLDWHO\DIWHUDYROWDJHLQWHUUXSWLRQ • &KHPLFDOSURFHVVDQGSURGXFWLRQSODQWVHJPL[HUVFHQWULIXJHVSXPSVFRQYH\RU V\VWHPV • 0LQHVDQGWXQQHOVIUHVKDLUIDQVZDWHUSXPSV Figure 3.24 Example for t6x,e = 10 s and Warm Trip Time = 70% 10 4 10 3 Trip Time [s] a 10 2 c d 10.0 7.3 b 1.6 1.0 0.1 1.0 1.1 2.0 3.0 4 5 6 7 nxIe 8 9 10.0 Load Current as Multiple of Full Load Current a) Time/current characteristic from cold when setting the trip time t6xe = 10 s. b) Time/current characteristic after preloading with 1xe when the trip time from cold t6xe = 10 s and WARM START function is disabled. c) Time/current characteristic after preloading with 1xe (thermal utilization or winding temperature = 82%) when the trip time from cold t6xe = 10 s and WARM START function is enabled, setting: WARM TRIP TIME = 70% of the trip time from cold. (The WARM TRIP TIME 7.3 s for 6xe is higher than (70% x 10) = 7 s because it depends on the winding and iron temperature which are not at their highest value.) d) If the thermal utilization (winding temperature) is higher than 82%, the WARM START function is automatically disabled. If lower than 82% the WARM TRIP TIME depends on the winding and iron temperature and its range is 7.3…10 s. Publication 825-UM001B-EN-P January 2001 Functions 3-38 Table 3.T Warm Start Setting Parameters Function Factory setting Off Tripping Time from Warm State as a Percentage of Tripping Time from Cold State Setting Setting range 50…100% Factory setting 70% Setting steps 10% Minimum Time Between Two Warm Starts Setting Setting range 4…60 min. Factory setting 60 min. Setting steps 1 min. Emergency Override of Thermal Trip (Emergency Start) Suggested Procedure 3URFHGXUHZKHQ37DQG37&DUHQRWXVHG 0RPHQWDULO\EULGJHWHUPLQDOV<<YROWDJHIUHHFRQWDFW$VSULQJUHWXUQNH\ VZLWFKLVUHFRPPHQGHG /&'IODVKHV´(0(5*(1&<67$57µ ,IWKHWKHUPDOUHOHDVHKDVWULSSHGLWFDQQRZEHUHVHW ,IWKHPD[LPXPQXPEHURIVWDUWVSHUKRXUKDVEHHQUHDFKHGWKHFRXQWHUKDVRQH VWDUWGHGXFWHG 6WDUWWKHPRWRU $VVRRQDVWKHPRWRUVWDUWVWKHVWDWRUZLQGLQJPHPRU\ZLOOEHVHWWR]HURFRSSHU ORVVHVRQO\ ATTENTION 'RQRWOHDYH<<EULGJHGEHFDXVHHDFKVWDUWZLOOUHVHWWKH FRSSHUPHPRU\ Publication 825-UM001B-EN-P January 2001 3-39 Functions $GGLWLRQDOSURFHGXUHZKHQ37DQGRU37&DUHLQVWDOOHG 'LVDEOH37&DQGRU37 SET VALUES PTC TRIP OFF PT100 #1…6 TRIP OFF $OWHUQDWLYHO\WKH6PDUW0RWRU0DQDJHUFDQEHVHWXSVXFKWKDWLQSXWVDQG GHDFWLYDWHWKH37&DQGRU37WULSSLQJ7KLVFDQEHDFKLHYHGZLWKDVHSDUDWH VZLWFKRUDVHSDUDWHVHWRIFRQWDFWVRQWKHNH\VZLWFKUHIHUWRSDJH 7KHLQSXWVKRXOGUHPDLQDFWLYDWHGXQWLOWKHWHPSHUDWXUHVUHWXUQWRQRUPDO LED Alarm and Trip Indicator 7KH/('LQGLFDWRURQWKHIURQWRIWKH6PDUW0RWRU0DQDJHUGLIIHUHQWLDWHVEHWZHHQWZR NLQGVRILQGLFDWLRQ • /('IODVKLQJLQGLFDWHVDQDODUP • /('FRQWLQXRXVO\OLWLQGLFDWHVDWULSSHGFRQGLWLRQ Publication 825-UM001B-EN-P January 2001 Functions 3-40 Connection of the Main Relay (MR) 7KHPDLQRXWSXWUHOD\FDQEHRSHUDWHGDVHOHFWULFDOO\KHOGRUQRQIDLOVDIH Electrically Held Mode Supply Off Supply On Supply On and Trip 95 96 97 98 Non-Fail-Safe Mode 1RWH 7HUPLQDOPDUNLQJVVKRXOGEHFKDQJHGIURPWKRVHXVHGLQHOHFWULFDOO\KHOGPRGHZKHQ VZLWFKLQJWRWKLVPRGH Supply Off Supply On Supply On and Trip 97 98 95 96 Applications of the Non-Fail-Safe Connection 7KHQRQIDLOVDIHFRQQHFWLRQLVVXLWDEOHIRUXVHLQVLWXDWLRQVZKHUHWKHIDLOXUHRIWKHFRQWURO YROWDJHPXVWQRWLQWHUUXSWWKHSURFHVV • • • • &KHPLFDOSURFHVVHV .QHDGHUVDQGPL[HUVLQZKLFKWKHPDVVZRXOGVROLGLI\ )UHVKDLUIDQV &RROLQJSXPSVHWF Connection of the Alarm Relay (AL) ,QILUPZDUHYHUVLRQVEHIRUHWKHDODUPUHOD\ZDVFRQQHFWHGLQWKHQRQIDLOVDIHPRGH 6LQFH9DQGODWHULWFDQDOVREHFRQQHFWHGLQWKHHOHFWULFDOO\KHOGPRGH Publication 825-UM001B-EN-P January 2001 3-41 Functions Electrically Held Mode Supply Off Supply On Supply On and Warning 13 13 13 14 14 14 Non-Fail-Safe Mode Supply Off Supply On Supply On and Warning 13 13 13 14 14 14 Applications of the Electrically Held Connection 0RQLWRULQJWKHVXSSO\YROWDJHDVZHOODVRSHUDWLRQRIWKHFRPPXQLFDWLRQRSWLRQZKHQWKH PDLQUHOD\LVLQQRQIDLOVDIHPRGH Alarm Relay AL $VLGHIURPWKHWKHUPDORYHUORDGVKRUWFLUFXLWDQGWKHUPLVWRU37&SURWHFWLYHIXQFWLRQVDOO DODUPDQGWULSSLQJIXQFWLRQVPD\EHDVVLJQHGWRWKHDODUPUHOD\$/ Table 3.U Alarm Examples Warning Thermal Utilization Asymmetry High Overload Underload All these functions Publication 825-UM001B-EN-P January 2001 Factory Setting 75% 20% 2 e 75% Off Functions 3-42 Reset :KHQWKHPRWRULVDWVWDQGVWLOODWULSFRQGLWLRQFDQEHUHVHW Kinds of Reset • 0DQXDOUHVHW³3UHVVWKHUHVHWEXWWRQRQWKH%XOOHWLQIRUDWOHDVWPV • 5HPRWHUHVHW³6KRUWFLUFXLWWHUPLQDOV<O< • $XWRPDWLFUHVHW³,QWKHPRGH´VHWYDOXHVµVHWDXWRPDWLFUHVHWIRU • 7KHUPDOWULS • 37&WULS • 37WULS Reset Conditions • 7KHUPDO³$VVRRQDVWKHWHPSHUDWXUHULVHKDVGURSSHGWRWKHSUHVHWUHVHW WKUHVKROG • 37&GHWHFWRU³$VVRRQDVWKHWHPSHUDWXUHLVEHORZWKHUHVHWWKUHVKROG • 37GHWHFWRU³$VVRRQDVWKHWHPSHUDWXUHLVEHORZWKHWULSSLQJWKUHVKROG • $V\PPHWU\3KDVHIDLOXUH³0DQXDORUUHPRWHUHVHWSRVVLEOH • $OORWKHUWULSV³&DQEHUHVHWLPPHGLDWHO\ Table 3.V Reset Setting Parameters Setting range Factory setting Setting range Factory setting Setting increments Manual/Automatic Manual Reset Threshold of the Thermal Trip 10…100% 70% 5% Function of the Cat. No. 825-MST Option Card Short-Circuit +HDY\SKDVHFXUUHQWVFDXVHGE\VKRUWFLUFXLWVEHWZHHQSKDVHVDQGIURPSKDVHWRHDUWKDUH GHWHFWHGE\WKH&DW1R067RSWLRQFDUG7KHVXSSO\FDQEHLQWHUUXSWHGLPPHGLDWHO\E\ FRQWUROOLQJWKHSRZHUVZLWFKLQJGHYLFHHJFLUFXLWEUHDNHU 6KRUWFLUFXLWSURWHFWLRQLVDOZD\VDFWLYH7KHUHIRUHWKHUHVSRQVHOHYHOPXVWEHVHWVRPHZKDW KLJKHUWKDQWKHPD[LPXPVWDUWLQJFXUUHQW Publication 825-UM001B-EN-P January 2001 3-43 Functions 7ULSSLQJLVGHOD\HGE\PV7KLVHQDEOHVWKHFLUFXLWEUHDNHUWREHDFWXDWHGUDSLGO\ZKLOH SUHYHQWLQJXQQHFHVVDU\WULSSLQJE\FXUUHQWSHDNV,QWKHHYHQWRIDVKRUWFLUFXLWWKHVHSDUDWH RXWSXWUHOD\WULSVUHJDUGOHVVRIWKHRWKHUSURWHFWLYHIXQFWLRQV7KHRXWSXWUHOD\ DFWXDWHVDFLUFXLWEUHDNHUZLWKDGHTXDWHEUHDNLQJFDSDFLW\7RSUHYHQWWKHFRQWDFWRUIURP RSHQLQJXQGHUVKRUWFLUFXLWFRQGLWLRQVUHOD\05UHPDLQVEORFNHGDWFXUUHQWV≥ ,H,ID WKHUPDOWULSRFFXUUHGVKRUWO\EHIRUHWKHVKRUWFLUFXLWUHOD\05DVVXPHVWKHWULSSHGSRVLWLRQ DVVRRQDVWKHFXUUHQWKDVGURSSHGWR ,H Figure 3.25 Interruption of a Short-Circuit I 1 2 3 12 Ie IA Ie t 825-M Relais #1 Q1M A e tv tQ tLB 1 2 3 tBL Circuit-breaker (tripping relay) Current curve Pickup value Rated service current Tripping delay 50 ms Operating time of the breaker Arc duration Short-circuit Contact separation Short-circuit interruption Relay MR blocked at ≥ 12 e Relais MR Q1M tv tQ tLB tBL Application • 0HGLXPKLJKYROWDJHPRWRUV ATTENTION 7KHVKRUWFLUFXLWSURWHFWLRQIXQFWLRQPXVWQRWEHXVHGIRUVZLWFKLQJ RIIWKHFRQWDFWRU Publication 825-UM001B-EN-P January 2001 Functions 3-44 Table 3.W Short Circuit Setting Parameters Trip ➊ Function Factory setting Off Response Level 4…12e Setting range Factory setting 10 e Setting increments 0.5 e Tripping Delay Setting range Factory setting Setting increments 20…990 ms 50 ms 10 ms Output Relay Selection (relays) Factory setting #1, No output relay #1 ➊ –5…60 °C (23…140 °F) Earth (Ground) Fault Protection with a Core Balance Current Transformer 7KLVIXQFWLRQLVLQWHJUDWHGLQWRWKH&DW1R067RSWLRQFDUG5HIHUWRSDJH Stalling During Start Function ,IWKHPRWRUVWDOOVGXULQJWKHVWDUWLQJSKDVHWKHPRWRUKHDWVXSYHU\UDSLGO\UHDFKLQJWKH WHPSHUDWXUHOLPLWRIWKHLQVXODWLRQDIWHUWKHSHUPLVVLEOHVWDOOLQJWLPH/DUJHORZYROWDJH PRWRUVDQGHVSHFLDOO\PHGLXPWRKLJKYROWDJHPRWRUVRIWHQKDYHVKRUWSHUPLVVLEOHVWDOOLQJ WLPHVDOWKRXJKWKHLUVWDUWVPD\EHFRQVLGHUDEO\ORQJHU$FFRUGLQJO\WKHSHUPLVVLEOHVWDOOLQJ WLPHPXVWEHVHWKLJKHURQWKHEDVLFXQLWLQWKHVHLQVWDQFHV:LWKDQH[WHUQDOVSHHGRPHWHURU ]HURVSHHGVZLWFKWKH6PDUW0RWRU0DQDJHUUHFRJQL]HVWKDWVWDOOLQJKDVRFFXUUHGGXULQJ VWDUWLQJDQGLWVZLWFKHVWKHPRWRURIILPPHGLDWHO\7KXVWKHPRWRUDQGWKHGULYHQ LQVWDOODWLRQDUHQRWH[SRVHGWRXQQHFHVVDU\RUXQDFFHSWDEOHVWUHVVIURPVWDOOLQJ Publication 825-UM001B-EN-P January 2001 3-45 Functions Applications • • • • • • • • • /DUJHORZYROWDJHPRWRUV 0HGLXPDQGKLJKYROWDJHPRWRUV &RQYH\RUV\VWHPV 0LOOV 0L[HUV &UXVKHUV 6DZV &UDQHV +RLVWVHWF Figure 3.26 Stalling During Starting 1 I I 2 1 Ie 2 tv Normal start without hindrance by high overload or stalling Stalling during standing Tripping delay Ie t tv Table 3.X Stalling during Start Setting Parameters Trip Function Factory setting Factory setting Off Tripping Delay The trip time tsp depends on the trip time tov chosen for the overcurrent as follows: tov < 400 ms, tsp = 600 ms.; tov ≥ 400 ms, tsp = tov + 400 ms. Actuation Message from zero speed switch to control input #1 Motor running 24V AC/DC at control input #1 Motor standstill 0V AC/DC at control input #1 Output Relay Same relay as for function “High Overload and Jam” Selection (relays) (settable only there) Publication 825-UM001B-EN-P January 2001 Functions 3-46 PTC Thermistor Input Function 7KHWKHUPLVWRUGHWHFWRUV37&VDUHHPEHGGHGLQWKHVWDWRUZLQGLQJRIWKHPRWRU7KH\ PRQLWRUWKHDFWXDOWHPSHUDWXUHRIWKHZLQGLQJ,QIOXHQFHVLQGHSHQGHQWRIWKHPRWRUFXUUHQW VXFKDVDPELHQWWHPSHUDWXUHREVWUXFWHGFRROLQJHWFDUHWDNHQLQWRDFFRXQW 7KHGHWHFWRUVDQGWKHLUOHDGVDUHPRQLWRUHGIRUVKRUWFLUFXLWDQGRSHQFLUFXLW Applications $VDGGLWLRQDOSURWHFWLRQIRU • • • • 0RWRUVDERYHN:+3 +LJKDPELHQWWHPSHUDWXUHVGXVW\HQYLURQPHQW 9DU\LQJORDGV 3OXJJLQJHWF Table 3.Y PTC Setting Parameters Function Factory setting Off Output Relay ➊ Selection (relays) Factory setting MR, AL, #1…#5 MR ➊ If auxiliary relays #2 and #3 are assigned to the communication (refer to page 5-16) they cannot be selected here. Publication 825-UM001B-EN-P January 2001 3-47 Functions Table 3.Z Sensor Measuring Circuit Specifications Function Factory setting Off Sensor Measuring Circuit Max. resistance of the PTC chain when cold Max. number of sensors as per IEC 34-11-2 Pickup value at δA = –5…+60 °C Dropout value at δA = –5…+60 °C 1.5 kΩ 6 3.3 kΩ ± 0.3 kΩ 1.8 kΩ ± 0.3 kΩ 800 ms ± 200 ms Delay on pickup Pickup value when short-circuit in sensors circuit at δA = –5…+60 °C ≤ 15 Ω Measuring voltage as per IEC 34-11-2 < 2.5V DC Measuring Lead Minimum cross-section Maximum length [mm2] [AWG No.] [m] [ft] Method of installation ➊ ➊ Twisted lead: 25 times twisted per m Screened lead: Screen connected to T2 Publication 825-UM001B-EN-P January 2001 0.5 20 0.75 18 1.0 17 1.5 16 2.5 14 200 300 400 600 1 000 656 984 1 312 1 968 3 280 up to 100 m (328 ft) twisted, unscreened Functions 3-48 Figure 3.27 Characteristic of PTC Sensors as per IEC 34-11-2 4000 1330 550 250 R [Ω] 100 20 10 -20°C 0°C TNF-20K TNF- 5K TNF+15K TNF+ 5K TNF TNF R [Ω] Nominal pickup temperature Resistance to sensors Analog Output 7KLVRXWSXWVXSSOLHVDFXUUHQWRI«P$SURSRUWLRQDOWRRQHRIWKHIROORZLQJVHOHFWDEOH DFWXDOYDOXHV • 7KHUPDOXWLOL]DWLRQFDOFXODWHGWHPSHUDWXUHULVHRIWKHPRWRU • 0RWRUWHPSHUDWXUHPD[37WHPSHUDWXUH • 0RWRUFXUUHQW,H Specifications Output Load 4…20 mA (IEC 381-1) at -5…+60 °C (23…140 °F) 0…300 Ω Analog Output for Thermal Load or Motor Temperature (PT100 Max.) 7KLVRXWSXWVXSSOLHVDFXUUHQWRI«P$HLWKHUSURSRUWLRQDOWRWKHFDOFXODWHGWHPSHUDWXUH ULVHRIWKHPRWRURUWKHPRWRUWHPSHUDWXUHPD[WHPSHUDWXUHRIWKHRSHUDWLQJ37 6HQVRUV7KHWKHUPDOORDGLQSHUFHQWDJHLVDOVRLQGLFDWHGRQWKH/&'RIWKH6PDUW0RWRU 0DQDJHU Publication 825-UM001B-EN-P January 2001 3-49 Functions Application • /RFDOLQGLFDWLRQIRUFRQWLQXRXVVXSHUYLVLRQRIWKHORDGRQPRWRUDQGLQVWDOODWLRQ • /RDGFRQWURO:LWKWKHLQGLFDWLRQRIWKHPRPHQWDU\WHPSHUDWXUHULVHRIWKHPDFKLQH WKHORDGRQWKHLQVWDOODWLRQFDQEHFRQWLQXRXVO\FRQWUROOHGWRWKHPD[LPXP SHUPLVVLEOHWHPSHUDWXUHULVHRIWKHPRWRU7KHUHVXOWLVRSWLPDOXWLOL]DWLRQRIWKH PRWRUZLWKIXOOSURWHFWLRQDQGPD[LPXPSURGXFWLYLW\RIWKHGULYHQLQVWDOODWLRQ • $XWRPDWLFORDGFRQWUROE\DFRQWUROOHURULQYHUWHUGULYHHJIRUFKDUJLQJPLOOVDQG FUXVKHUVWKH6PDUW0RWRU0DQDJHULWVHOILVXQDEOHWRSURWHFWLQYHUWHUGULYHQPRWRUV Figure 3.28 Analog Output for Motor Temperature Rise ϑ ϑmax ϑG ϑK 5 4 ϑ ϑmax ϑG ϑK 10 15 20 mA 17.2 Temperature rise of motor Permissible temperature limit (tripping threshold) Nominal temperature (load e) Coolant temperature (40 °C or via PT100 #7) 7KHUPDOXWLOL]DWLRQFDOFXODWLRQ ( …mA ± 4 mA ) Therm utiliz (%) = • 100% 16 mA Publication 825-UM001B-EN-P January 2001 Functions 3-50 Figure 3.29 Analog Output for Motor Temperature ϑ 200˚C 50˚C 5 10 15 20 mA 4 0RWRU7HPSHUDWXUHFDOFXODWLRQ ( …mA ± 4 mA ) Motor temp. (°C ) = • 150 °C 16 mA Analog Output for Motor Current 7KHRXWSXWVXSSOLHVDFXUUHQWRI«P$SURSRUWLRQDOWRWKHPRWRUFXUUHQW Figure 3.30 Analog Output for Motor Current % Ie 200 100 0 5 4 10 15 20 mA 12 0RWRUFXUUHQWFDOFXODWLRQ ( …mA ± 4 mA ) Motor current ( % e ) = • 200 % e 16 mA Publication 825-UM001B-EN-P January 2001 3-51 Functions Control Inputs #1 and #2 :LWKFRQWUROLQSXWVDQGWKHIROORZLQJFRQWURODQGSURWHFWLRQIXQFWLRQVDUHDYDLODEOH • 7LPHUIXQFWLRQV • 'LVDEOLQJRISURWHFWLRQIXQFWLRQV • 3URWHFWLRQDJDLQVWVWDOOLQJGXULQJVWDUWLQJZLWKDQH[WHUQDOVSHHGRPHWHUUHIHUWRSDJH • &KDQJLQJRYHUWRDVHFRQGUDWHGFXUUHQWWZRVSHHGPRWRU Actuation Input #1 Input #2 Y31 (+) Y32 (-) Y41 (+) 24V AC or 24V DC; 8 mA Pick values: On: 12…36 V Off: < 2 V Y42 (-) 7KHFRQWUROLQSXWVDUHJDOYDQLFDOO\VHSDUDWHGIURPWKHHOHFWURQLFFLUFXLWVE\RSWRFRXSOHUV 7KHFRQWUROLQSXWVDUHDFWLYDWHGE\DSSO\LQJ9$&RU'&WR<<RU<< )RUIXUWKHULQIRUPDWLRQUHIHUWR&KDSWHU Timer Functions 7KHIROORZLQJIXQFWLRQVFDQEHSURJUDPPHG • 2Q'HOD\WRQ«V • 2II'HOD\WRII«V • 2QDQGRIIGHOD\«V Assignment of the Output Relays • &RQWUROLQSXWWRRXWSXWUHOD\ • &RQWUROLQSXWWRRXWSXWUHOD\ Publication 825-UM001B-EN-P January 2001 Functions 3-52 Figure 3.31 Operating Diagram for Timer Functions Control input Output relay On-delay Off-delay On-off-delay > 0.5 s toff = 0 ton toff ton = 0 toff ton On-off-delay ton toff Applications • 7LPHJUDGHGVZLWFKLQJRQDQGRII • 'HOD\LQJWKHWUDQVIHURIDODUPDQGWULSPHVVDJHV Lock-Out of Protection Functions :LWKFRQWUROLQSXWVDQGRQHRUPRUHSURWHFWLYHIXQFWLRQVFDQEHORFNHGRXWDV GHVLUHG • • • • • • • • $V\PPHWU\SKDVHXQEDODQFH +LJKRYHUORDGMDP (DUWKJURXQGIDXOW 6KRUWFLUFXLW 8QGHUORDG /LPLWLQJWKHQXPEHURIVWDUWVKRXU 37& 37 Applications /RFNRXWRISURWHFWLRQIXQFWLRQV 'XULQJFHUWDLQRSHUDWLRQDOSKDVHVZKHQWKHOHYHOGLIIHUVIURPWKHQRUPDOYDOXHVVXFKDV • • • • GXULQJVWDUWLQJHDUWKIDXOWDQGVKRUWFLUFXLWSURWHFWLRQ DWQRORDGSURWHFWLRQDJDLQVWDV\PPHWU\DQGXQGHUORDG GXULQJEULHIRYHUORDGSKDVHVKLJKRYHUORDGMDP GXULQJFRPPLVVLRQLQJDQGIDXOWORFDWLRQORFDOL]LQJWKHVRXUFHRIWKHWURXEOH Publication 825-UM001B-EN-P January 2001 3-53 Functions 7KHVHOHFWHGIXQFWLRQVDUHFRPSOHWHO\GLVDEOHGDVORQJDVWKHFRQWUROLQSXWLV´RQµ 9 $&'& • 1RDODUP • 1RWULSQRUHVHW • 7ULSSLQJGHOD\VEHJLQWRUXQRQO\DIWHUWKHIXQFWLRQLVUHHQDEOHG Switching to a Second Rated Current ,QWKH6PDUW0RWRU0DQDJHUDVHFRQGYDOXHFDQEHVHOHFWHGIRUWKHUDWHGFXUUHQW,H7KH FKDQJHWRWKHVHFRQGUDWHGYDOXHLVFRQWUROOHGE\DFWLYDWLQJFRQWUROLQSXWZLWK9 $&'& 0DNHVXUHWKHVHFRQGUDWHGFXUUHQWLVFRPSDWLEOHZLWKWKHFXUUHQWUDQJHRIWKH&DW 1R 0&0FXUUHQWFRQYHUWHUPRGXOH Application • 7ZRVSHHGPRWRUV • %ULHIO\LQFUHDVHGORDGLQJRIWKHPRWRUDQGLQVWDOODWLRQ • 0D[LPXPORDGLQJZKHQWKHDPELHQWWHPSHUDWXUHYDULHVDSSUHFLDEO\([DPSOHV ([SRVHGZDWHUSXPSVGLIIHUHQWFRQYH\LQJFDSDFLWLHVGXULQJGD\WLPHDQGDWQLJKW Functions of the Cat. No. 825-MLV Option Card Phase Sequence Function ,IDPRWRULVVZLWFKHGRQLQWKHZURQJGLUHFWLRQRIURWDWLRQWKHLQVWDOODWLRQFDQEHDGYHUVHO\ DIIHFWHG7KH6PDUW0RWRU0DQDJHUPRQLWRUVWKHSKDVHVHTXHQFHZKHQYROWDJHLVDSSOLHG DQGSUHYHQWVWKHPRWRUVWDUWLQJLQWKHZURQJGLUHFWLRQ Applications • 0RELOHLQVWDOODWLRQVHJUHIULJHUDWHGWUDQVSRUWHUVFRQVWUXFWLRQPDFKLQHV • ,QVWDOODWLRQVWKDWFDQEHGLVSODFHGDVHQFORVHGXQLWVHJPRELOHFUXVKHUVFRQYH\RU EHOWVVDZV • ,IDUHYHUVHGSKDVHVHTXHQFHPXVWEHH[SHFWHGDIWHUDUHSDLU Publication 825-UM001B-EN-P January 2001 Functions 3-54 Table 3.AA Phase Sequence Setting Parameters Function Factory setting Off Tripping Delay Factory setting 1s Output Relay ➊ Selection (relays) Factory setting MR, AL, #1…#5 MR ➊ If auxiliary relays #2 and #3 are assigned to the communication (refer to page 5-16) they cannot be selected here. ATTENTION 7KHSKDVHVHTXHQFHRIWKHPRWRUVXSSO\FDQEHPRQLWRUHGRQO\DWWKH SRLQWRIPHDVXUHPHQWXVXDOO\EHIRUHWKHFRQWDFWRU([FKDQJHGOHDGV EHWZHHQWKLVSRLQWDQGWKHPRWRUFDQQRWEHUHFRJQL]HG Phase Failure (Based on Voltage Measurement) Function $SKDVHIDLOXUHLVUHFRJQL]HGE\PHDVXULQJWKHYROWDJHVEHIRUHWKHVZLWFKJHDUDQGWKXVZLWK WKHPRWRUDWVWDQGVWLOO:LWKSKDVHIDLOXUHSURWHFWLRQZKHUHWKHSKDVHFXUUHQWVDUHPHDVXUHG WKHPRWRUILUVWKDVWREHVZLWFKHGRQDOWKRXJKLWFDQQRWVWDUWZLWKRQO\WZRSKDVHV Table 3.AB Phase Failure Setting Parameters Function Factory setting Off Tripping Delay Factory setting 2s Output Relay ➊ Selection (relays) Factory setting MR, AL, #1…#5 MR ➊ If auxiliary relays #2 and #3 are assigned to the communication (refer to page 5-16) they cannot be selected here. Publication 825-UM001B-EN-P January 2001 3-55 Functions Star-Delta (Wye-Delta) Starting 7KH6PDUW0RWRU0DQDJHULVVXHVWKHFRPPDQGWRVZLWFKIURPVWDUWRGHOWDZ\HWRGHOWDDV VRRQDVWKHVWDUWLQJFXUUHQWKDVGURSSHGWRWKHUDWHGYDOXHDQGWKXVWKHPRWRUKDVUHDFKHGLWV QRUPDOVSHHGLQVWDUZ\H,IVWDUWLQJKDVQRWEHHQFRPSOHWHGZLWKLQWKHQRUPDOWLPHIRUWKLV DSSOLFDWLRQ>PD[VWDUZ\HRSHUDWLRQ@DFKDQJHWRGHOWDZLOOEHPDGHUHJDUGOHVVRIWKHVSHHG DWWDLQHG 7KHSHUPLVVLEOHWLPHIRUVWDUZ\HRSHUDWLRQFDQEHVZLWFKHGRQRURIIDVGHVLUHG,ILWLVRII WKHFKDQJHWRGHOWDLVPDGHVROHO\ZLWKUHIHUHQFHWRWKHPRWRUFXUUHQW ,IWKHPRWRUKDVWREHVZLWFKHGRIIZKHQWKHQRUPDOVWDUWLQJWLPHLQVWDUZ\HLVH[FHHGHG WKH´PRQLWRULQJVWDUWLQJWLPHµIXQFWLRQPXVWDOVREHDFWLYDWHGUHIHUWRSDJH Figure 3.32 Diagram of Star-Delta (Wye-Delta) Starting Motor on off I ⎯ Ie Motor current Ιe t Star operation, relay #4 Delta operation, relay #5 Changeover delay 80 ms 80 ms Table 3.AC Star-Delta (Wye-Delta) Starting Setting Parameters Setting Star (Wye) Relay Delta Relay Max. Star (Wye) Operation Off Off — Relay #5 — 1…240 s 10 s 1s Function Factory setting — Setting Setting range Factory setting Setting steps — Relay #4 — Publication 825-UM001B-EN-P January 2001 Functions 3-56 Functions of the Cat. No. 825-MMV Option Card PT100 (100 Ω Platinum) Temperature Sensor (RTD) 7KH37WHPSHUDWXUHGHWHFWRUVDUHRIWHQHPEHGGHGLQWKHVWDWRUZLQGLQJDQGRUWKH EHDULQJVHVSHFLDOO\LQODUJHPRWRUV7KH6PDUW0RWRU0DQDJHUPRQLWRUVWKHDFWXDOVWDWRU EHDULQJDQGFRRODQWWHPSHUDWXUH7KHUHVLVWDQFHIURPD37WHPSHUDWXUHGHWHFWRULV GHSHQGHQWRQWKHWHPSHUDWXUHDQGKDVDSRVLWLYHWHPSHUDWXUHFRHIILFLHQWΩ°& Table 3.AD PT100 Temperature Detector Resistance per IEC 751 Temperature (C 0 50 100 150 200 Resistance (Ω Ω) 100.00 119.40 138.50 157.31 175.84 6HQVRUVWKDWDUHQRWFRQQHFWHGPXVWEHVZLWFKHGRII7HPSHUDWXUHVHQVRUV«PRQLWRU WKHDFWXDOVWDWRURUEHDULQJWHPSHUDWXUHV • 7KHWHPSHUDWXUHLVFRQWLQXRXVO\LQGLFDWHGLQ°& • 7KHDODUPDQGWULSSLQJWHPSHUDWXUHVFDQEHVHWDVGHVLUHG Applications • • • • /DUJHORZYROWDJHPRWRUV 0HGLXPDQGKLJKYROWDJHPRWRUV $WKLJKDPELHQWWHPSHUDWXUHV :KHQFRROLQJLVREVWUXFWHG Publication 825-UM001B-EN-P January 2001 3-57 Functions Table 3.AE PT100 (RTD) Setting Parameters Warning Trip Function Factory setting Setting range Factory setting Setting steps Factory setting Selection (relays) Factory setting Off Response Level 50…200 °C — — Tripping Delay <8s Output Relay ➊ AL, #1…#3 AL Off 50…200 °C 50 °C 1 °C <8s MR, AL, #1…#3 MR ➊ If auxiliary relays #2 and #3 are assigned to the communication (refer to page 5-16) they cannot be selected here. ATTENTION ,WLVHVVHQWLDOWRVHWWKH´:DUQLQJµUHVSRQVHOHYHOWRDYDOXHOHVVWKDQ WKH´7ULSµUHVSRQVHOHYHO PT100 #7 Temperature Sensor (RTD) 7KH37WHPSHUDWXUHVHQVRUPHDVXUHVWKHDPELHQWWHPSHUDWXUHRUWKHFRRODQWLQWKH PRWRUDQGLQGLFDWHVLWLQ°&7KH6PDUW0RWRU0DQDJHUWDNHVLQWRDFFRXQWWKHWHPSHUDWXUHRI WKHFRRODQWLQWKHWKHUPDOLPDJH7KHPRWRUDQGWKHLQVWDOODWLRQFDQEHEHWWHUXVHGZLWK GHYLDWLQJFRRODQWWHPSHUDWXUHV PT100 PROT ON 7KHWHPSHUDWXUHRIWKHFRRODQWDPELHQWWHPSHUDWXUHLVLQGLFDWHGDVVRRQDVWKHIXQFWLRQLV DFWLYDWHGDQG37LVFRQQHFWHG /&'RI0 Tambient…°C Publication 825-UM001B-EN-P January 2001 Functions 3-58 7KLVIXQFWLRQPXVWEHDFWLYDWHGVRWKDWWKHFRRODQWWHPSHUDWXUHPD\EHWDNHQLQWRDFFRXQWLQ WKHWKHUPDOLPDJH Tamb IN TH IMAGE ON $PELHQWWHPSHUDWXUHLQWKHWKHUPDOLPDJHLVWDNHQLQWRDFFRXQW MOTOR INSULATION CLASS B ,QVXODWLRQFODVVRIZLQGLQJ Table 3.AF Motor Insulation Class Setting Parameters Function Factory setting Off Insulation Class Selection Factory setting B, E, F B /LPLWLQJZLQGLQJWHPSHUDWXUHVRIWKHWKUHHLQVXODWLRQVFODVVHV( &% &) & :KHQWKHDPELHQWWHPSHUDWXUHLVWDNHQLQWRFRQVLGHUDWLRQWKHLQVXODWLRQFODVVQHHGVWREH SURJUDPPHGIRUFRUUHFWLRQRIWKHWKHUPDOPRGHO:LWKRXWXVLQJ37DVWKHDPELHQW WHPSHUDWXUHLQSXWWKHWKHUPDOPRGHOEDVHVWKHWKHUPDOFDOFXODWLRQRQDQDPELHQW WHPSHUDWXUHRI& Application • :LWKODUJHWHPSHUDWXUHYDULDWLRQGD\QLJKW • 2XWGRRULQVWDOODWLRQV • 3XPSV • &RQYH\RUV • &UXVKHUV • 6DZV Publication 825-UM001B-EN-P January 2001 Chapter Assembly and Installation Assembly Flush Mounting 7RPRXQWWKH6PDUW0RWRU0DQDJHULQDIURQWSDQHOFXWDUHFWDQJXODUKROHZLWKWKH IROORZLQJGLPHQVLRQV Figure 4.1 Basic Unit Mounted in an Enclosure ➊ 13 8m m (57/1 6" ➋ +1 -0 +1 - 0 /16 ) 10 m m (3 /8 ") max. 6 mm (1/4") Trip Se t Ch an ge Sel ec t Set En ter tin gs Te st m ") m 6 4 1 /1 1 4 -1 (5 Res et Dimensions in mm (inches) Dimensions: Panel cutout: 138 x 138 mm (-0 mm, +1 mm) Mounting depth: min. 140 mm Publication 825-UM001B-EN-P January 2001 144 mm (5-11/16") Re co rdet Va lues 138 mm - 0 +1 rm Ac tua l (5-7/16" Ala + 1/16 ) -0 ➌ ➊ Front panel with cutout ➋ Rubber gasket ➌ Fixing nuts 4 Assembly and Installation 4-2 Mounting Position Figure 4.2 Mounting Position 22.5˚ 22.5˚ 90 ˚ 22.5˚ SMART MOTOR MANAGER Surface Mounting Figure 4.3 Basic Unit Mounted into Panel Mounting Frame (Cat. No. 825-FPM) 17 0 (6- mm 11 /16 ") 90 ˚ Hinge m m (6 - 1/ 2" ) 150 mm (5- 7/8") m 16 5 m ") m 16 0 1/ 17 - 1 (6 Alar 170 mm (6- 11/16") Ø 6.5 mm (1/4") Trip Ac tua l Re co rde t Va Se t Ch an ge lues Se lect Se En ter tting s Te st Res Dimensions in mm (inches) et Publication 825-UM001B-EN-P January 2001 4-3 Assembly and Installation Converter Modules Figure 4.4 Cat. Nos. 825 MCM2, 825-MCM-20, 825-MCM180 øe d3 b b ød ➊ d1 ➌ e2 ➋ c1 e2 c d2 a Table 4.A Cat. Nos. 825 MCM2, 825-MCM-20, 825-MCM180 'LPHQVLRQVLQPLOOLPHWHUVLQFKHV Cat. No. 825- a b c c1 ∅d d1 d2 ∅e d3 ∅ e1 2x 120 85 102 66 5.3 5.3 100 55 — (4-45/64) (3-23/64) (4) (2-39/64) (3/16) (3/16) (3-7/8) (2-3/16) 2.5 mm2 2x 120 85 102 66 5.3 5.3 100 55 — MCM20 (4-45/64) (3-23/64) (4) (2-39/64) (3/16) (3/16) (3-7/8) (2-3/16) 2.5 mm2 120 102 72 5.3 5.3 100 55 MCM180 — M8 M8 (4-45/64) (4) (2-13/16) (3/16) (3/16) (3-7/8) (2-3/16) MCM2 ➊ ➋ ➌ ➍ e2 b1 b2 38.5 (1-1/2) — — 38.5 (1-1/2) — — 38.5 75 ➌➍ (1-1/2) (2-61/64) 100/117 Mounted on DIN Rail EN 50 022-35 Bus bar or opening for conductor max. ∅ 19 mm With Cat. No. 825-MVM With Cat. No. 825-MVM2 Figure 4.5 Cat. Nos. 825-MCM630, 825-MCM630N øe b d3 ød d1 e2 e2 a Publication 825-UM001B-EN-P January 2001 ø e1 c1 c d2 Assembly and Installation 4-4 Table 4.B Cat. Nos. 825-MCM630, 825-MCM630N 'LPHQVLRQVLQPLOOLPHWHUVLQFKHV Cat. No. 825-MCM630 825-MCM630N a 155 (6-7/64) 155 (6-7/64) b 145 (5-11/16) 145 (5-11/16) c 156 (6-1/8) 177 (6-31/32) c1 118 (4-5/8) 118 (4-5/8) ∅d 6.3 (1/4) 6.3 (1/4) d1 6.3 (1/4) 6.3 (1/4) d2 135 (5-5/16) 135 (5-5/16) d3 88 (3-7/16) 88 (3-7/16) ∅ e1 M10 M10 e2 48 (1-7/8) 48 (1-7/8) Thermal Utilization Indicator Figure 4.6 Cat. No. 825-MTUM Thermal Utilization Indicator Panel cutout: 91.5 x 91.5 mm (3-39/64" x 3-39/64") (–1 mm [–1/16"] + 0.5 mm [+1/32"]) Mounting depth: 55 mm (2-3/16") Wire size: 2 x 2.5 mm2 (14 AWG) ATTENTION 7RUHWURILWRUUHSODFHRSWLRQVWKHDVVHPEO\DQGWHVWLQJLQVWUXFWLRQV VXSSOLHGZLWKWKHRSWLRQPXVWEHIROORZHGH[DFWO\ Publication 825-UM001B-EN-P January 2001 4-5 Assembly and Installation Figure 4.7 Basic Unit Housing with Option Cards 1RUPDOO\WKHEDVLFXQLWZLOOEHRUGHUHGDQGVKLSSHGZLWKWKHUHTXLUHGRSWLRQFDUGV ➊ ➊ ➋ ➌ ➍ ➎ ➏ ➐ Basic Unit housing Cat. No. 825-MMV or 825-MLV option card Communication board Cat. No. 825-MST option card Board with basic unit Rear cover Screws CM V4 /C LV 4 CS CP T4 Ba sic ➋ ➌ ➍ ➎ B4 ➏ ➐ Installation and Wiring General 7KH6PDUW0RWRU0DQDJHUIXOILOOVWKHVWULQJHQWUHTXLUHPHQWVLPSRVHGE\JOREDOVWDQGDUGV UHTXLUHPHQWVUHJDUGLQJHOHFWURPDJQHWLFFRPSDWLELOLW\(0&7KLVPHDQVWKDWWKHUHLVQR QHHGWRREVHUYHDQ\VSHFLDOVWLSXODWLRQVZKHQZLULQJWKHXQLW 1HYHUWKHOHVVFRQWUROOHDGVVKRXOGEHODLGVHSDUDWHO\IURPSRZHUOHDGV,QWKHFLUFXLWGLDJUDPV WKURXJKRXWWKLVVHFWLRQDQ\VSHFLDOZLULQJUHTXLUHPHQWVDUHVSHFLILFDOO\QRWHG 7KHGDWDRIWKHRXWSXWFLUFXLWVDQGFRQWUROLQSXWVDUHGHDOWZLWKLQ&KDSWHU 6SHFLILFDWLRQV ³ %DVLF8QLWDQG&RQYHUWHU0RGXOH7KURXJKRXWWKLVPDQXDOWKHFRQWDFWVRIWKHRXWSXWUHOD\VDUH VKRZQLQWKHLUQRUPDOZRUNLQJSRVLWLRQLHWKH6PDUW0RWRU0DQDJHUFRQWUROYROWDJHLV VZLWFKHGRQQRZDUQLQJQRWULS ATTENTION $OODVVHPEO\DQGLQVWDOODWLRQZRUNPXVWEHSHUIRUPHGE\TXDOLILHG SHUVRQQHOWDNLQJORFDOFRGHVLQWRDFFRXQW Publication 825-UM001B-EN-P January 2001 Assembly and Installation 4-6 Main Circuits Basic Unit and Converter Module without Main Current Transformer Figure 4.8 Basic Unit with Converter Module L1 1 L2 L3 3 5 Cable with plugs 825-M 825-MCM 2 4 6 Converter module cat. nos. 825-MCM2 825-MCM20 825-MCM180 825-MCM630 825-MCM630N M 3~ Basic Unit and Converter Module with Main Current Transformer Figure 4.9 3-Phase Current Evaluation L1 L2 L3 Converter module 825-MCM2 825-MCM20 1 3 5 825-MCM 2 4 6 825-M Main current transformer …A/5 or …A/1 A For selection, refer to Chapter 2. M 3~ Publication 825-UM001B-EN-P January 2001 4-7 Assembly and Installation Basic Unit and Converter Module with Main and Core Balance Current Transformer Figure 4.10 2-Phase Current Evaluation L1 L2 L3 Converter module cat. nos. 825-MCM2 825-MCM20 1 T1 3 5 825-M 825-MCM 2 4 6 k l Σ T2 M 3~ Table 4.C Specifications Main current transformer (refer to Chapter 2 for selection information) A/5 A or A/1 A Core Balance Current Transformer Earth-/ground current 5 mA…50 A Current ratio of core balance current transformer 1…2 000:1 Output from core balance current transformer 0…500 mA $GGLWLRQDOFLUFXLWGLDJUDPVFDQEHIRXQGLQ&KDSWHU Publication 825-UM001B-EN-P January 2001 Assembly and Installation 4-8 Control Circuits Figure 4.11 Smart Motor Manager Basic Unit Supply: A1 A1 + Y11 Emerg. Start Y12 Disable Settings Supply AC or DC No fuse needed Emergency override of thermal trip (Emergency start): Push button, key-switch Disable settings and keys: ➊ Wire jumper, switch, key-switch Y13 Y21 Remote Reset Remote reset: ➋ Push button, key-switch Y22 Alarm relay AL, non-fail-safe connection (Factory setting) IEC 400V AC/125V DC UL/CSA 240V AC/125V DC 13 14 13 Alarm relay AL, electrically held connection (from V2.18, selectable) IEC 400 VA/125V DC UL/CSA 240V AC/125V DC 14 95 96 Output relay MR in electrically held connection (Factory setting) IEC 400V AC/125V DC UL/CSA 240V AC/125V DC 97 98 97 Output relay MR in non-fail-safe connection IEC 400V AC/125V DC UL/CSA 240V AC/125V DC 98 95 96 External Internal ➊ Setting via communication is also disabled, as well as Test and Reset ➋ The remote reset is always active Publication 825-UM001B-EN-P January 2001 4-9 Assembly and Installation Figure 4.12 Cat. No. 825-MST Option Card 23 Aux Relay #1 Auxiliary relay #1 IEC 400V AC/125V DC UL/CSA 240V AC/125V DC Aux Relay #2 Auxiliary relay #2 50V AC/30V DC 24 33 34 43 Aux Relay #3 44 Analog output indicates the thermal utilization of the motor, the motor temperature, or the motor current Indicating instrument PLC input Recorder I+ A 4...20 mA (0...300 W) I- Control Input #1 Y31 Control Input #2 Y41 Auxiliary relay #3 50V AC/30V DC Control input #1: 24V DC or 24V AC ➊ Y32 Control input #2: 24V DC or 24V AC ➊ Y42 Thermistor overtemperature protection max. 6 PTC wired in series Measuring lead ➋ Min. cross-section [mm2] 0.5 0.75 1 1.5 2.5 [AWG No.] 20 18 17 16 14 Max. length [m] 200 300 400 600 1 000 [ft] 656 984 1 312 1 968 3 280 T1 PTC T2 L1 L2 L3 Core balance transformer 5…500 mA at k-l k l External Internal ➊ For information regarding methods of actuation, refer to Chapter 9. ➋ Method of installation: up to 100 m (328 ft) twisted, more than 100 m additional unscreened Publication 825-UM001B-EN-P January 2001 Assembly and Installation 4-10 Figure 4.13 Cat. No. 825-MLV Option Card (LWKHUWKH0/9RU009RSWLRQFDUGPD\EHLQVHUWHGLQWKLV SRVLWLRQ ATTENTION 53 Aux Relay #4 Auxiliary relay #4 IEC 400 VAC/125 VDC UL/CSA 240 VAC/125 VDC Aux Relay #5 Auxiliary relay #5 IEC 400 VAC/125 VDC UL/CSA 240 VAC/125 VDC 54 63 64 F L1 L2 L3 Phase sequence protection Phase failure protection as per IEC, SEV 110…400 VAC as per UL, CSA 110…240 VAC 1 3 5 825-MCM 2 4 6 M 3~ External T Internal T F F L1 L1 L2 L2 L3 L3 1 3 5 1 3 5 825-MCM 825-MCM 2 4 6 2 4 6 M 3~ M 3~ External Supply voltage > 400 VAC (UL, CSA > 240 VAC) Internal External Internal Supply voltage > 400 VAC (UL, CSA > 240 VAC) Publication 825-UM001B-EN-P January 2001 4-11 Assembly and Installation Figure 4.14 Cat. No. 825-MMV Option Card (LWKHUWKH0/9RU009RSWLRQFDUGVPD\EHLQVHUWHGLQ WKLVSRVLWLRQ ATTENTION 1T1 PT100 #1 1T3 1T2 PT100 inputs #1…#6 (RTD) for monitoring the temperature of the stator winding and motor bearings. 2T1 PT100 #2 2T3 2T2 3T1 PT100 #3 3T3 3T2 4T1 PT100 #4 4T3 4T2 5T1 PT100 #5 5T3 5T2 6T1 PT100 #6 6T3 PT100, #7 for indication and inclusion of the coolant/ambient temperature (cooling air) in the thermal image. If PT100 #7 is not connected, then a resistance of 120 Ω should be connected between T1 and T3. 6T2 7T1 PT100 #7 7T3 Tamb IN TH IMAGE OFF 7T2 Method of Installation • 6KRUWOLQNVXSWRPODLGVHSDUDWHIURPSRZHUFDEOHVQHHGQRVFUHHQLQJ • /RQJHUOHDGVPXVWEHVFUHHQHGVKLHOGHG • 6HSDUDWHO\VFUHHQHGFRQQHFWVFUHHQVWRLQGLYLGXDO7HJ77« • &RPPRQVFUHHQLQJFRQQHFWVFUHHQWR7DQGDOO7WRJHWKHUHJ77« Publication 825-UM001B-EN-P January 2001 Assembly and Installation 4-12 Option Communication ATTENTION 2QO\RQHRIWKHIROORZLQJRSWLRQVFDQEHLQVHUWHGDWDWLPH &DW1R0'1IRU'HYLFH1HW&RQQHFWLRQ 5HIHUWR3XEOLFDWLRQ80$863 )RUPRUH'HYLFH1HWFRPSRQHQWVUHIHUWR3XEOLFDWLRQ% &DW1R5,2IRU5,2&RQQHFWLRQ 5HIHUWR3UR6RIW5,28VHU0DQXDO &DW1R0%6IRU0RGEXV&RQQHFWLRQ 5HIHUWR3UR6RIW0%68VHU0DQXDO Publication 825-UM001B-EN-P January 2001 Chapter 5 Setting the Operational Parameters Menu Overview $OORSHUDWLQJSDUDPHWHUVFDQHDVLO\EHVHWRUDOWHUHGDWDQ\WLPHXVLQJWKHIRXURSHUDWLQJNH\V RQWKHIURQWRIWKHXQLW7KLVSURFHGXUHLVGHVFULEHGLQ&KDSWHU ATTENTION $OOSDUDPHWHUVRIRSWLRQFDUGVFDQEHSURJUDPPHGVHWHYHQZKHQ WKHRSWLRQFDUGVDUHQRWLQVWDOOHG9HULI\SURGXFWFRQILJXUDWLRQEHIRUH FRPPLVVLRQLQJ Main Settings 7KHPDLQVHWWLQJVKDYHWREHLQGLYLGXDOO\VHWIRUHDFKPRWRU Table 5.A Main Settings Parameter Rated motor current or service currente Current ratio of primary current transformer ➊ Locked-rotor current Locked-rotor time ➋ Setting range 0.5…2 000 A 1…2 000 2.5…12 e Factory setting 20 A 1 6 e 1…600 s 10 s ➊ Accessing this parameter requires that the parameter Primary CT be set to “yes”. ➋ If, instead of the permissible locked-rotor time, the maximum starting time is known, the approximate locked-rotor time is calculated as follows: Starting time Locked-rotor time ≈ --------------------------------1.4 $OORWKHUSDUDPHWHUVVXFKDVRYHUFXUUHQWXQGHUORDGDV\PPHWU\HWFDUHVHWLQWKHIDFWRU\WR YDOXHVWKDWDUHFRUUHFWIRUWKHPDMRULW\RIDSSOLFDWLRQV7KHVHIDFWRU\VHWYDOXHVFDQEH FKDQJHGLIUHTXLUHPHQWVGLIIHU7KHVDPHDSSOLHVWRVSHFLDOVHWWLQJV Publication 825-UM001B-EN-P January 2001 Setting the Operational Parameters 5-2 Special Settings 7KHVHYDOXHVDUHIDFWRU\VHWWRYDOXHVWKDWDUHFRUUHFWIRUWKHPDMRULW\RIDSSOLFDWLRQVDQG VKRXOGRQO\EHFKDQJHGZKHQUHTXLUHPHQWVDUHRXWVLGHWKHSDUDPHWHUVDOORZHGIRUE\WKH IDFWRU\VHWWLQJV Table 5.B Special Settings Parameter Connection of main relay (MR) Reset of thermal trip Reset at…% thermal utilization Reset PTC trip Cooling constant ratio motor off/on Motor insulation class ➊ Setting range Electrically held/non-fail-safe Manual/auto 10…100% Manual/auto 1…10 B, E, F Factory setting Electrically held Manual 50% Manual 2.5 B ➊ Motor insulation class needs to and can be set only if PT100 #7 (RTD) is included in the thermal image. ATTENTION 'RQRWH[FHHGWKHSHUPLVVLEOHYDOXHVTXRWHGE\WKHPRWRU PDQXIDFWXUHU Publication 825-UM001B-EN-P January 2001 5-3 Setting the Operational Parameters Table 5.C Communication Settings Parameter Setting Range Factory Setting 0…63 0…2 2 2 0…63 0…23 0…118 2 4 5 0…247 0…182 0…118 2 4 5 1…126 0…4 2 4 (500 kbd) DeviceNet Station number (MAC ID) Baud rate: 125/250/500 kbaud Remote I/O Station number Baud rate ➊ Baud rate ➋ Modbus Station number Baud rate ➌ Baud rate ➋ PROFIBUS Station number, Baud rate 9.6/19.2/73.75/187.5/500 kbaud ➊ Baud Rate for Remote I/O Calculated according to the following formula: Value = (8 x baud) + (4 x last_rack) + starting_mod_group Baud: 0 = 57.6 kbaud, 1 = 115.2 kbaud, 2 = 230.4 kbaud last_rack: 0 = no, 1 = yes starting_mod_group:0 = group 0, 1 = group 2, 2 = group 4, 3 = group 6 The rack_size is fixed to 1/4 rack. ➋ Baud Rate for DF1 Calculated according to the following formula: Value = (64 x mode) + (32 x stop_bits) + (8 x parity) + baud Mode: Data protection: 0 = CRC, 1 = BCC stop_bits: 0 = 1 stop bit, 1 = 2 stop bit parity: 0 = none, 1 = odd, 2 = even baud: 0 = 300 baud, 1 = 600 baud, 2 = 1 200 baud, 3 = 2 400 baud, 4 = 4 800 baud, 5 = 9 600 baud, 6 = 19 200 baud ➌ Baud Rate for Modbus Calculated according to the following formula: Value = (64 x mode) + (32 x stop_bits) + (8 x parity) + baud Mode: Protocol: 0 = RTU, 1 = ASCII 7 bit, 2 = ASCII 8 bit stop_bits: 0 = 1 stop bit, 1 = 2 stop bit parity: 0 = none, 1 = odd, 2 = even baud: 0 = 300 baud, 1 = 600 baud, 2 = 1 200 baud, 3 = 2 400 baud, 4 = 4 800 baud, 5 = 9 600 baud, 6 = 19 200 baud Publication 825-UM001B-EN-P January 2001 Setting the Operational Parameters 5-4 Operating Parameters Table 5.D Cat. No. 825-M… Operating Parameters Group Required Option Card Cat. No. LCD Setting Range Description — SET VALUES — FULL LOAD CURR 20 A 0.5…2 000 Rated motor current in A — PRIMARY C.T. #1 NO Use of the primary No/Yes ➊ transformer — PRIM. C.T. RATIO 1 Current ratio of the primary 1…2 000 current transformer e.g. 500 A/5 A, setting = 100 800 A/5 A, setting = 160 — LOCKED ROT CURR 6 x Ie 2.5…12 Locked rotor and starting current in …e — LOCKED ROT TIME 10 sec 1…600 Maximum permissible locked-rotor time of motor from cold — THERMAL TRIP MAIN RELAY Main relay/no relay Thermal trip, motor Choice between main output relay and no relay — THERMAL WARNING OFF On/Off ➋ Thermal warning (motor temp) On/Off — TH WARNING LEVEL 75 % — TH WARNING ALARM RELAY Main settings — Thermal overload 50…99 Mode: Set parameters Pickup value for thermal warning temperature rise as percent of thermal utilization All except Thermal warning main relay Assignment of output relay ➊ If Primary CT #1 is set to “no”, the programming menu skips to parameter Locked Rot Curr. ➋ If Thermal Warning is set to “off”, the programming menu skips to parameter Asymmetry Trip. Publication 825-UM001B-EN-P January 2001 5-5 Setting the Operational Parameters Table 5.D Cat. No. 825-M… Operating Parameters (Continued) Group Asymmetry Overcurrent Required Option Card Cat. No. LCD Setting Range Description Asymmetry protection On/Off ➊ (current measuring asymmetry) On/Off — ASYMMETRY TRIP ON — AS TRIP LEVEL 35 % 5…80 Asymmetry trip Tripping level in percent — AS TRIP TIME 2.5 sec 1…25 Asymmetry trip Tripping delay — ASYMMETRY TRIP MAIN RELAY All relays Asymmetry trip Assignment of relays — AS WARNING OFF Asymmetry warning On/Off ➋ On/Off — AS WARNING LEVEL 20 % — AS WARNING ALARM RELAY — OVERCURR TRIP ON On/Off Overcurrent/locked-rotor protection On/Off — OC TRIP LEVEL 2.4 X Ie 1.0…6.0 Overcurrent/locked-rotor Tripping level in … e — OC TRIP TIME 0.5 sec 0.1…5 Overcurrent/locked-rotor Tripping delay — OVERCURRENT TRIP MAIN RELAY All relays Overcurrent/locked-rotor Assignment of output relay — OC WARNING OFF Overcurrent/locked-rotor On/Off ➌ warning On/Off 5…80 Asymmetry warning Warning level in percent All except Asymmetry warning main relay Assignment of output relay ➊ If Asymmetry Trip is set to “off”, the programming menu skips to parameter AS Warning. ➋ If AS Warning is set to “off”, the programming menu skips to parameter Overcurr Trip. ➌ If OC Warning is set to “off”, the programming menu skips to parameter Earth Fault Prot. Publication 825-UM001B-EN-P January 2001 Setting the Operational Parameters 5-6 Table 5.D Cat. No. 825-M… Operating Parameters (Continued) ATTENTION (QVXUHWKDWWKHWULSIXQFWLRQLVUHVHWEHIRUHLWLVLQDFWLYDWHG Group Required Option Card Cat. No. Setting Range Description Overcurrent/locked-rotor Warning level in… e — OC WARNING LEVEL 2.0 x Ie 1.0…6.0 — OC WARNING ALARM RELAY All except Overcurrent/locked-rotor warning main relay Assignment of output relay — EARTH FAULT PROT ON Earth (ground) fault On/Off ➊ protection On/Off — EF HOLMG TRIP ON Earth (ground) fault On/Off ➋ protection (Holmgreen = residual) On/Off — EF H TRIP LEVEL 50 % 10…100 Earth (ground) fault trip (Holmgreen = residual Tripping level, percent of motor current — EF H TRIP TIME 0.50 sec 0.1…5 Earth (ground) fault trip (Holmgreen = residual) Tripping delay — EF HOLMG TRIP MAIN RELAY Overcurrent, continued Earth (ground) fault (Holmgreen/ residual) LCD Earth (ground) fault trip All relays (Holmgreen = residual) Assignment of output relay ➊ If Earth Fault Prot is set to “off”, the programming menu skips to parameter Short Circ Trip. ➋ If EF Holmg Trip is set to “off”, the programming menu skips to parameter EF CoreTrip. Publication 825-UM001B-EN-P January 2001 5-7 Setting the Operational Parameters Table 5.D Cat. No. 825-M… Operating Parameters (Continued) Group Required Option Card Cat. No. LCD On/Off ➊ Earth (ground) fault protection (core balance transformer) On/Off CORE C.T. RATIO 1 1…2 000 Core balance transformer current ratio EF C TRIP TIME 0.50 sec Short circuit Description EF CORE TRIP OFF EF C TRIP LEVEL 1A Earth (ground) fault Setting Range Earth (ground) fault trip 5…999 mA (core balance transformer) 1.00…50.00 A Tripping level 0.1…5 Earth (ground) fault trip (core balance transformer) Tripping delay EF CORE TRIP MAIN RELAY All relays Earth (ground) fault warning (core balance transformer) Assignment of output relay EF C WARNING OFF On/Off ➋ Earth (ground) fault warning (core balance transformer) On/Off 825-MST EF C WARN LEVEL 500 mA Earth (ground) fault 5…999 mA warning (core balance 1.00…50.00 A transformer) Tripping level EF C WARNING ALARM RELAY Earth (ground) fault All except main warning (core balance relay transformer) SHORT CIRC TRIP OFF On/Off ➌ Short-circuit protection On/Off (h.v. motors only) SC TRIP LEVEL 10.00 x Ie 4.0…12.0 Short-circuit trip Tripping level… e SC TRIP TIME 50 ms 20…990 Short-circuit trip Tripping delay SHORT CIRC TRIP AUX RELAY #1 Relay #1/ no relay Short-circuit trip, choice between output relay #1 and no relay 825-MST ➊ If EF Core Trip is set to “off”, the programming menu skips to parameter EF C Warning. ➋ If EF C Warning is set to “off”, the programming menu skips to parameter Short Circ Trip. ➌ If Short Circ Trip is set to “off”, the programming menu skips to parameter Underload Trip. Publication 825-UM001B-EN-P January 2001 Setting the Operational Parameters 5-8 Table 5.D Cat. No. 825-M… Operating Parameters (Continued) Group Underload Required Option Card Cat. No. Description UNDERLOAD TRIP OFF On/Off ➊ Underload protection On/Off — UL TRIP LEVEL 75 % Ie 25…100 Underload trip Tripping level…% e — UL TRIP TIME 10 sec 1…60 — UNDERLOAD TRIP MAIN RELAY — UL START-DELAY 0 sec — UL WARNING OFF Underload warning On/Off ➋ On/Off UL WARNING ALARM RELAY Underload warning, All except assignment of output relay (warning level is equal to main relay tripping level, without tripping delay) STAR DELTA OFF On/Off ➌ 825-MLV Underload trip Tripping delay All relays Underload trip Assignment of output relay 0…240 Underload trip Start delay Star-delta starting On/Off STAR AUX REL #4 Relay#4 Star-delta starting Assignment of star output relay DELTA AUX REL #5 Relay#5 Star-delta starting Assignment of delta output relay SET STAR TIME OFF STAR TIME 10 sec ➊ ➋ ➌ ➍ Setting Range — — Star-Delta (Wye-Delta) starting LCD On/Off ➍ Star-delta starting Max. time on star on/off 1…240 Star-delta starting Max. time on star If Underload Trip is set to “off”, the programming menu skips to parameter UL Warning. If UL Warning is set to “off”, the programming menu skips to parameter Star Delta. If Star Delta is set to “off”, the programming menu skips to parameter Warm Starting. If Set Star Time is set to “off”, the programming menu skips to parameter Warm Starting. Publication 825-UM001B-EN-P January 2001 5-9 Setting the Operational Parameters Table 5.D Cat. No. 825-M… Operating Parameters (Continued) Group Warm start Limiting number of starts per hour Monitoring startup time Required Option Card Cat. No. LCD — WARM STARTING OFF — WARM START EACH 60 min — Setting Range On/Off ➊ Description Warm start On/Off 4…60 Warm start possible every ___min. WARM TRIP TIME 70 % 50…100 Warm start tripping time as a percentage of tripping time from cold — START INHIBIT OFF Limiting number of On/Off ➋ starts/hour On/Off — MAX START/HOUR 2 — START INHIB TRIP MAIN RELAY Maximum number of All relays starts/hour reached Assignment of output relay — START CONTROL OFF Monitoring starting time On/Off ➌ On/Off — START TIME 10 sec — START CONT TRIP MAIN RELAY 1…10 1…240 All relays Maximum starts/hour Maximum starting time Starting time exceeded Assignment of output relay ➊ If Warm Starting is set to “off”, the programming menu skips to parameter Start Inhibit. ➋ If Start Inhibit is set to “off”, the programming menu skips to parameter Start Control. ➌ If Start Control is set to “off”, the programming menu skips to parameter Main Relay. Publication 825-UM001B-EN-P January 2001 Setting the Operational Parameters 5-10 Table 5.D Cat. No. 825-M… Operating Parameters (Continued) Group Special settings PTC temperature sensors Control input #1 ➊ ➋ ➌ ➍ Required Option Card Cat. No. LCD Setting Range Description Electrically Main output relay in held/non electrically held or fail-safe non fail-safe connection — MAIN RELAY ELECTR. HELD — ALARM RELAY NON-FAIL-SAFE Electrically Alarm relay in non-fail-safe held/non fail- or electrically held safe connection — TH TRIP RESET MANUAL Manual/auto Reset of thermal trip Manual/automatic — THE RESET LEVEL 50 % 10…100 — COOL-CONST RATIO 2.5 Cooling constant ratio 1.0…10.0 between “motor off” and “motor on” PTC TRIP ON Thermistor protection PTC On/Off ➊ On/Off PTC TRIP MAIN RELAY PTC trip All relays Assignment of output relay PTC RESET MANUAL Manual/ auto Reset PTC trip Manual/automatic CONTROL INPUT #1 OFF On/Off ➋ Control input #1 On/Off DELAY AUX REL #2 OFF Timer function of auxiliary On/Off ➌ relay #2 On/Off 825-MST 825-MST Thermal reset at ___% of thermal utilization ON DELAY AUX #2 1 sec 0…240 On-delay of auxiliary relay #2 OFF DELAY AUX #2 2 sec 0…240 Off-delay of auxiliary relay #2 ➍ If PTC Trip is set to “off”, the programming menu skips to parameter Control Input #1. If Control Input #1 is set to “off”, the programming menu skips to parameter Control Input #2. If Delay Aux Rel #2 is set to “off”, the programming menu skips to parameter Speed Switch. After Off Delay Aux #2 is set, the programming menu skips to parameter Control Input #2. Publication 825-UM001B-EN-P January 2001 5-11 Setting the Operational Parameters Table 5.D Cat. No. 825-M… Operating Parameters (Continued) Group Required Option Card Cat. No. LCD SPEED SWITCH OFF 825-MST Description Speed switch/stop indicator (locked-rotor during start) On/Off and/or auxiliary contact On/Off ➊ of motor contactor “motor switched on” for motors with m < 20% e. SS TRIP TIME 0.9 SEC Trip time tsp depends on the trip time chosen for the overcurrent tov as follows: tov < 400 ms, tsp = 600 ms tov ≥ 400 ms, tsp = tov + 400ms SS TRIP MAIN RELAY Trip on relay chosen for overcurrent/locked-rotor DISABLE FUNCTION OFF Control input #1, continued Setting Range On/Off ➋ Disable protective function On/Off ASYMMETRY PROT NOT DISABLED Not disabled/ Asymmetry protection disabled Active/locked out OVERCURRENT PROT NOT DISABLED Overcurrent/locked-rotor Not disabled/ disabled protection Active/locked out EARTH FAULT PROT NOT DISABLED Not disabled/ Earth-fault protection disabled Active/locked out SHORT CIRC PROT NOT DISABLED Not disabled/ Short-circuit protection disabled Active/locked out UNDERLOAD PROT NOT DISABLED Not disabled/ Underload protection disabled Active/locked out START INHIBIT NOT DISABLED Not disabled/ Limiting starts/hour disabled Active/locked out PTC PROT NOT DISABLED Not disabled/ PTC protection disabled Active/locked out PT100 PROT NOT DISABLED Not disabled/ PT100 (RTD) protection disabled Active/locked out ➊ If Speed Switch is set to “off”, the programming menu skips to parameter Disable Function. ➋ If Disable Function is set to “off”, the programming menu skips to parameter Control Input #2. Publication 825-UM001B-EN-P January 2001 Setting the Operational Parameters 5-12 Table 5.D Cat. No. 825-M… Operating Parameters (Continued) Group Control input #2 ➊ ➋ ➌ ➍ ➎ ➏ Required Option Card Cat. No. 825-MST LCD Setting Range Description CONTROL INPUT #2 OFF Control input #2 On/Off ➊ On/Off DELAY AUX REL #3 OFF Timer function of output On/Off ➋ relay #3 On/Off ON DELAY AUX #3 1 sec 0…240 On-delay of output relay #3 OFF DELAY AUX #3 2 sec 0…240 Off-delay of output relay #3 ➌ NEW FLC OFF Setting 2nd rated motor On/Off ➍ current Off/On PRIMARY C.T. #2 NO No/Yes ➎ Use of primary c.t. for 2nd rated motor current PRIMARY C.T. RATIO 1 1… 2 000 Current ratio of primary c.t. e.g. 800 A/5 A, setting = 160 NEW FLC 20 A 0.50… 2 000 Setting 2nd rated motor current On/Off DISABLE FUNCTION OFF Not disabled/ Disable protective function disabled ➏ On/Off ASYMMETRY PROT NOT DISABLED Not disabled/ Asymmetry protection disabled Active/locked out OVERCURRENT PROT NOT DISABLED Not disabled/ Overcurrent/locked-rotor protection disabled Active/locked out EARTH FAULT PROT NOT DISABLED Not disabled/ Earth-fault protection disabled Active/locked out SHORT CIRC PROT NOT DISABLED Not disabled/ Short-circuit protection disabled Active/locked out If Control Input #2 is set to “off”, the programming menu skips to parameter Phase-Rever Trip. If Delay Aux Rel #3 is set to “off”, the programming menu skips to parameter New FLC. After Off Delay Aux #3 is set, the programming menu skips to parameter Phase-Rever Trip. If New FLC is set to “off”, the programming menu skips to parameter Disable Function. If Primary C.T. #2 is set to “no”, the programming menu skips to parameter New FLC. If Disable Function is set to “off”, the programming menu skips to parameter Phase-Rever Trip. Publication 825-UM001B-EN-P January 2001 5-13 Setting the Operational Parameters Table 5.D Cat. No. 825-M… Operating Parameters (Continued) Group Control input #2, continued Phase sequence protection Phase failure PT 100 (RTD) temperature sensor Required Option Card Cat. No. LCD Setting Range Description UNDERLOAD PROT NOT DISABLED Not disabled/ Underload protection disabled Active/locked out START INHIBIT NOT DISABLED Not disabled/ Limiting starts/hour disabled Active/locked out PTC PROT NOT DISABLED Not disabled/ PTC protection disabled Active/locked out PT100 PROT NOT DISABLED Not disabled/ PT100 (RTD) protection disabled Active/locked out 825-MST On/Off ➊ PHASE-REVER TRIP MAIN RELAY All relays Phase sequence protection Assignment of output relay PHASE LOSS TRIP OFF Phase failure On/Off ➋ (based on motor supply voltage) On/Off PHASE LOSS TRIP MAIN RELAY Phase failure All relays Assignment of output relay PT100 PROT OFF PT100 protection On/Off ➌ (stator/bearings) On/Off 825-MLV 825-MLV 825-MMV Phase sequence protection (based on motor supply voltage) On/Off PHASE-REVER TRIP OFF PT100 #1 TRIP OFF On/Off PT100 #1 protection On/Off #1 TRIP TEMP 50 °C 50…200 PT100 #1 Tripping temperature PT100 #2 TRIP OFF On/Off PT100 #2 protection On/Off #2 TRIP TEMP 50 °C 50…200 PT100 #2 Tripping temperature ➊ If Phase-Rever Trip is set to “off”, the programming menu skips to parameter Phase Loss Trip. ➋ If Phase Loss Trip is set to “off”, the programming menu skips to parameter PT100 Prot. ➌ If PT100 Prot is set to “off”, the programming menu skips to parameter Output 4…20 mA. Publication 825-UM001B-EN-P January 2001 Setting the Operational Parameters 5-14 Table 5.D Cat. No. 825-M… Operating Parameters (Continued) Group PT 100 (RTD) temperature sensor, continued Required Option Card Cat. No. Setting Range Description PT100 #3 TRIP OFF On/Off PT100 #3 protection On/Off #3 TRIP TEMP 50 °C 50…200 PT100 #3 Tripping temperature PT100 #4 TRIP OFF On/Off PT100 #4 protection On/Off #4 TRIP TEMP 50 °C 50…200 PT100 #4 Tripping temperature PT100 #5 TRIP OFF On/Off PT100 #5 protection On/Off #5 TRIP TEMP 50 °C 50…200 PT100 #5 Tripping temperature PT100 #6 TRIP OFF On/Off PT100 #6 protection On/Off #6 TRIP TEMP 50 °C 50…200 PT100 #6 Tripping temperature PT100 #1-6 TRIP MAIN RELAY All relays PT100 #1…#6 ex 4, 5 Tripping PT100 #1-6 RESET MANUAL Manual/ auto PT100 #1 WARNING OFF On/Off #1 WARNING TEMP 50 °C 50…200 PT100 #2 WARNING OFF On/Off #2 WARNING TEMP 50 °C 50…200 LCD 825-MMV PT100 #1…#6, reset PT100 trip Manual/automatic PT100 #1 warning On/Off PT100 #1 Warning temperature PT100 #2 warning On/Off PT100 #2 Warning temperature Publication 825-UM001B-EN-P January 2001 5-15 Setting the Operational Parameters Table 5.D Cat. No. 825-M… Operating Parameters (Continued) Group PT 100 (RTD) temperature sensor, continued Required Option Card Cat. No. 825-MMV LCD PT100 #3 warning On/Off On/Off #3 WARNING TEMP 50 °C 50…200 PT100 #4 WARNING OFF On/Off #4 WARNING TEMP 50 °C 50…200 PT100 #5 WARNING OFF On/Off #5 WARNING TEMP 50 °C 50…200 PT100 #6 WARNING OFF On/Off #6 WARNING TEMP 50 °C 50…200 PT100 #6 Warning temperature #1-6 WARNING OFF AL, #1…#3 PT100, #1…#6 warning Assignment of output relay INSULATION CLASS B 825-MST Description PT100 #3 WARNING OFF Tamb IN TH IMAGE OFF Analog output Setting Range OUTPUT 4…20 mA THERMAL PT100 #3 Warning temperature PT100 #4 warning On/Off PT100 #4 Warning temperature PT100 #5 warning On/Off PT100 #5 Warning temperature PT100 #6 warning On/Off PT100 #7, allowance for On/Off ➊ ambient temperature in thermal simulation B, E, F Insulation class of winding ➋ Using the analog output for: Thermal utiliz thermal utilization, Motor PT100 max. motor current, max. PT100 temperature ➊ If Tamb in Thermal Image is set to “off”, the programming menu skips to parameter Output 4…20 mA. ➋ Limiting winding temperatures of the three insulations classes: E = 120°C, B = 130°C, F = 155°C. When the ambient temperature is taken into consideration, the insulation class needs to be programmed for correction of the thermal model. Without using PT100 #7 as the ambient temperature input, the thermal model bases the thermal calculation on an ambient temperature of 40°C. Publication 825-UM001B-EN-P January 2001 Setting the Operational Parameters 5-16 Table 5.D Cat. No. 825-M… Operating Parameters (Continued) Group Required Option Card Cat. No. LCD — STATION NUMBER 02 0…63 0…63 1…247 1…126 — BAUD RATE 04 0…2 0…23 0…182 0…4 Communication setting Relay control Clear recorded values Reset settings to factory settings (clear recorded values) End of setting parameters Setting Range Comm. option, REL #2-3 VIA COM 825-MST NO Description Basic unit station number (DeviceNet) (R I/O) (MODBUS) (PROFIBUS) Baud rate (DeviceNet) (R I/O) (MODBUS) (PROFIBUS) No/Yes ➊ Control of relays #2 and #3 via communication allowed Not clear/ Clear/do not clear all all clear recorded values — CLEAR REC VALUES NOT CLEAR — FACTORY SETTINGS NOT RESET TO — ARE YOU SURE? NO — FACTORY SETTINGS ALL IS RESET TO — Confirmation that all parameters are reset to the factory settings END SET VALUES — End of setting operating parameters Not reset to/ Reset/not reset to factory All reset to settings ➋ No/Yes Reset/not reset all parameters to factory settings ➊ If auxiliary relays #2 and #3 are assigned to the communication (refer to page 5-16) they cannot be selected here. ➋ If Factory Settings is set to “Not Reset To”, the programming menu skips to parameter End Set Value. Publication 825-UM001B-EN-P January 2001 Chapter 6 Commissioning and Operation Checking the Installation &DUHIXOFRUUHFWFRPPLVVLRQLQJRIWKH%XOOHWLQ6PDUW0RWRU0DQDJHULVDQLPSRUWDQW SUHUHTXLVLWHIRUUHOLDEOHSURWHFWLRQRIWKHPRWRUDQGHFRQRPLFRSHUDWLRQRIWKHLQVWDOODWLRQ )ROORZWKHSURFHGXUHVLQWKLVVHFWLRQWRHQVXUHWKDWSURJUDPPLQJDQGVHWXSDUHFRUUHFW ATTENTION &KHFNLQJDQGFRPPLVVLRQLQJPXVWEHFDUULHGRXWRQO\E\TXDOLILHG SHUVRQQHO'LVFRQQHFWWKHPDLQVZLWFKDQGLVRODWHWKHFRQWUROFLUFXLW EHIRUHFRPPLVVLRQLQJRULQVWDOOLQJWKHXQLW • &XUUHQW&RQYHUWHU&DW1R0&0 • 9HULI\WKDWWKHGHYLFH·VFXUUHQWUDQJHOLHVZLWKLQWKHIXOOORDGRUWKHVHUYLFHFXUUHQW • 3ULPDU\&XUUHQW7UDQVIRUPHULIXVHG • 7KHWUDQVIRUPHUUDWLQJPXVWEHJUHDWHURUHTXDOWRWKHIXOOORDGRUWKHVHUYLFH FXUUHQW • 7KHFXUUHQWUDWLRPXVWEHBBB$$RUBBB$$IRUXVHZLWK&DW 1R 0&0RU0&0FXUUHQWFRQYHUWHUVUHVSHFWLYHO\ • &RUH%DODQFH&XUUHQW7UDQVIRUPHU • 9HULI\WKDWWKHRXWSXWFXUUHQWRIWKHFRUHEDODQFHFXUUHQWWUDQVIRUPHULV « P$IRUWKHDODUPRUWULSVLJQDO • %DVLF8QLW&DW1R0« • 9HULI\WKDWWKHSRZHUVXSSO\YROWDJHKDVEHHQSURSHUO\VHOHFWHGIRUWKHFRQWURO FLUFXLWYROWDJH • 9HULI\WKDWWKHDSSURSULDWHRSWLRQFDUGVKDYHEHHQLQVWDOOHG • 9HULI\WKDWWKHLQGLFDWLRQPHWHULIUHTXLUHGLVFRQQHFWHG Publication 825-UM001B-EN-P January 2001 Commissioning and Operation 6-2 Checking the Wiring • • • • • • • • 3ULPDU\FXUUHQWWUDQVIRUPHUFRUHEDODQFHFXUUHQWWUDQVIRUPHUV &RQYHUWHUPRGXOH %DVLF8QLW /LQNEHWZHHQEDVLFXQLWDQGFRQYHUWHUPRGXOH ,QSXWVRXWSXWV 6XSSO\ &RPPXQLFDWLRQ &RQWDFWV«DUHPDUNHGDFFRUGLQJWR´HOHFWULFDOO\KHOGµ´QRQIDLOVDIHµ FRQQHFWLRQUHTXLUHG Checking the Installation with the Control Voltage Applied Switching on the Control Voltage $IWHUDSSO\LQJFRQWUROYROWDJHWKHFXUUHQWFRQYHUWHULVUHDG\IRURSHUDWLRQLQ DSSUR[LPDWHO\ V • /&'VKRZV´$&78$/9$/8(µ • 0DLQUHOD\FRQWDFWLVFORVHG Checking the Set Parameters Methods • :LWKWKHFXUUHQWFRQYHUWHULQ6HW9DOXHVPRGH $FFHVVWKHSDUDPHWHUVRUSULQWWKHPRXWDQGFRPSDUHWKHPZLWKWKHVHWYDOXHVLQWKHOLVWRI VHWWLQJV7KHPDLQVHWWLQJVDUH • 5DWHGRUVHUYLFHFXUUHQW • /RFNHGURWRURUVWDUWLQJFXUUHQW • 3HUPLVVLEOHORFNHGURWRUWLPH 7KHVHWKUHHVHWWLQJVPXVWEHPDGHLQGLYLGXDOO\IRUHDFKPRWRU5HIHUWRSDJH 2SHUDWLRQDO 3DUDPHWHUVIRUSURFHGXUH Publication 825-UM001B-EN-P January 2001 6-3 Commissioning and Operation Motor Current • (QVXUHWKDWWKHFXUUHQWFRQYHUWHU·VUDWHGFXUUHQWLQDPSHUHVLVHTXDOWRWKHDPSHUH UDWLQJRQWKHQDPHSODWHRIWKHPRWRU • 6HWWKHFXUUHQWFRQYHUWHUUDWHGFXUUHQWEDVHGRQWKHVHUYLFHFXUUHQWRIWKHPRWRULI WKHLQVWDOODWLRQRUPRWRUQDPHSODWHFXUUHQWLVQRWNQRZQ 6HWWKHPRWRUFXUUHQWDSSUR[LPDWHO\«KLJKHUWKDQWKHDVVXPHGVHUYLFH FXUUHQW :LWKWKHLQVWDOODWLRQUXQQLQJQRUPDOO\UHDGWKHPRWRUFXUUHQWRQWKH/&' 6HWWKHFXUUHQWFRQYHUWHUWRWKHVHUYLFHFXUUHQWUHDGLQJ EXAMPLE Set current: FULL LOAD CURR 140 A Measured motor current: I MOTOR 85 % Ie % ( ) × e 85 × 140 A e Service current = = = 119 A 100 100 Setting to service current ➊: FULL LOAD CURR 119 A The motor current is now ➊: I MOTOR 100 % Ie ➊ In software versions 3.11 and later, the motor current can be displayed in amperes (A) and be set directly. Publication 825-UM001B-EN-P January 2001 Commissioning and Operation 6-4 Locked Rotor or Starting Current • 6HWWKHORFNHGURWRURUVWDUWLQJFXUUHQWDVWKHPXOWLSOHRIUDWHGFXUUHQW,$,H DFFRUGLQJWRVSHFLILFDWLRQVJLYHQE\WKHPDQXIDFWXUHU • ,IQRVSHFLILFDWLRQVDUHDYDLODEOHWKHVWDUWLQJFXUUHQWFDQHLWKHUEHPHDVXUHGZLWKWKH FXUUHQWFRQYHUWHURUUHDGIURP)LJXUH • 7KHFXUUHQWFRQYHUWHUIDFWRU\VHWWLQJLV[,H /&' LOCKED ROT CURR 6.00 x Ie Figure 6.1 Range of Starting Currents of Standard Motors Expressed as Multiple of the Rated Service Current 1 IA 10 ⎯ Ie 8 2 3 4 6 4 3 2 1 0.2 PN 1 2 3 4 PN 0.4 1 2 4 10 20 40 100 200 kW Approximate value for 2-pole motors, speed 3 000 rpm Approximate value for 4-pole motors, speed 1 500 rpm Approximate value for 6-pole motors, speed 1 000 rpm Approximate value for 8-pole motors, speed 750 rpm Rated output power in service Locked Rotor Time • 1RUPDOVHWWLQJRIORFNHGURWRUWLPHLHZKHQXVLQJVWDQGDUGPRWRUVRUSHUPLVVLEOH ORFNHGURWRUWLPHLVNQRZQ • 7KHVHWWLQJRIWKHORFNHGURWRUWLPHPXVWEHHTXDOWRRUOHVVWKDQWKHYDOXHTXRWHGE\ WKHPDQXIDFWXUHU • 7KHFXUUHQWFRQYHUWHUIDFWRU\VHWWLQJLVV,IQRDSSOLFDWLRQGHWDLOVDUHDYDLODEOHDQG WKHVWDUWLQJFRQGLWLRQVDUHQRUPDOOHDYHWKHVHWWLQJDWV /&' LOCKED ROT TIME 10 sec Publication 825-UM001B-EN-P January 2001 6-5 Commissioning and Operation • 6HWWLQJORFNHGURWRUWLPHWRDPLQLPXPOHYHO 7KLVSURFHGXUHHQDEOHV\RXWRVHWWKHORFNHGURWRUWLPHWRDPLQLPXPVRWKDWWKH PRWRUDQGLQVWDOODWLRQDUHEHWWHUSURWHFWHG D &KRRVHDORFNHGURWRUWLPHWKDWLVOHVVWKDQWKHSUREDEOHVWDUWLQJWLPHHJVIRU WKHUPDOO\UDSLGXQGHUZDWHUPRWRUV E 6WDUWWKHPRWRUDQGDOORZLWWRFRROGRZQDIWHUDWKHUPDOWULS F ,QFUHDVHWKHORFNHGURWRUWLPHXQWLOVWDUWLQJVXFFHHGVUHOLDEO\ • 6HWWLQJWKHORFNHGURWRUWLPHZKHQWKHPRWRUVWDUWLQJWLPHLVNQRZQ EXAMPLE .QRZQVWDUWLQJWLPHRIWKHPRWRULVW$ VHF /RFNHGURWRUWLPHWREHVHW DSSUR[LPDWHO\ A 15 = ------= 11 1.4 1.4 6HWWLQJWKHORFNHGURWRUWLPHZLWKWKHDLGRIWKHLQGLFDWLRQRIWKHUPDOXWLOL]DWLRQ %DVLF8QLW´$&78$/9$/8(6µGLVSOD\ /&' TH UTILIZ 00 % 6HWWKHORFNHGURWRUWLPHVRWKDWWKHFXUUHQWFRQYHUWHUGRHVQRWWULS ZLWKWKHOHDVW IDYRUDEOHVHUYLFHORDGHJDWWKHHQGRIDKHDY\VWDUW1RWHWKDWIRUWKLVSURFHGXUHWKHPRWRU PXVWEHRIDGHTXDWHVL]HIRUWKHLQWHQGHGDSSOLFDWLRQ Programming, Setup, and Operation 'XULQJSURJUDPPLQJVHWXSDQGRSHUDWLRQWKHDFWXDORSHUDWLRQDOYDOXHVFDQEHFRQWLQXRXVO\ PRQLWRUHG7RGRWKLVVZLWFKWKHGLVSOD\WR´$FWXDO9DOXHVµUHIHUWR&KDSWHU Starting LCD I MOTOR 00 % Ie Operation Motor start Publication 825-UM001B-EN-P January 2001 Description The motor current, depending on the type of motor, must drop from about 400…800% e to the service current of 100% e. Commissioning and Operation 6-6 Operating Table 6.A Checking the Actual Values LCD ACTUAL VALUES Setting Range — Description Indication of actual values I MOTOR…A 0.00…49.99 50…24 000 TH UTILIZ…% 0…100 I MOTOR…% Ie 0/20…999 Motor current in…A Thermal utilization Motor current as a percentage of rated service current ( e) I 1…% Ie 0/20…1 200 Motor current 1 (phase L1), percentage of rated service current (e) I 2… % Ie 0/20…1 200 Motor current 2 (phase L2), percentage of rated service current (e) I 3… % Ie 0/20…1 200 Motor current 3 (phase L3), percentage of rated service current (e) TRIP IN…sec 1…9 999 Unit will trip in ___s. Publication 825-UM001B-EN-P January 2001 6-7 Commissioning and Operation Table 6.A Checking the Actual Values (Continued) LCD RESET IN…sec Setting Range 1…9 999 Description Unit can be reset in ___s ASYM…% 1…100 Current asymmetry in percent I earth-H…% I 1…100 Earth (ground) fault current (residual) as percentage of actual service current (I) I earth-C…mA 5… 999 mA 1.00… 50.00 A Earth (ground) fault current in mA/A with core balance current transformer Tambient…°C 0…210 Ambient temperature in °C (PT100, #7) PT100 #1…°C 0…210 Temperature in °C (PT100, #1) PT100 #2…°C 0…210 Temperature in °C (PT100, #2) PT100 #3…°C 0…210 Temperature in °C (PT100, #3) PT100 #4…°C 0…210 Temperature in °C (PT100, #4) PT100 #5…°C 0…210 Temperature in °C (PT100, #5) PT100 #6…°C 0…210 Temperature in °C (PT100, #6) DevNet : XX : YY : ZZZ END ACT VALUES DevNet R I/O MODBUS PROBUS — Publication 825-UM001B-EN-P January 2001 Display of communication option DeviceNet 825-MDN Remote I/O 3600-RIO Modbus 3600-MBS PROFIBUS 825-MPB End of actual values Chapter 7 Testing and Maintenance General 7KHFRUUHFWIXQFWLRQLQJRIWKH6PDUW0RWRU0DQDJHUFDQEHFKHFNHGE\VHYHUDOPHWKRGV GHSHQGLQJRQWKHUHTXLUHPHQWV • :LWKWKH7HVWEXWWRQ • :LWKWKHWHVWFRQGLWLRQVHW • :LWKDVLQJOHRUSKDVHFXUUHQWVRXUFH $WHVWPD\EHEHQHILFLDO • • • • 'XULQJFRPPLVVLRQLQJ )ROORZLQJDQLQWHUUXSWLRQLQRSHUDWLRQ )ROORZLQJRYHUKDXOV )ROORZLQJUHFRQVWUXFWLRQRIWKHLQVWDOODWLRQ $IWHUDWHVWLVFRQGXFWHGWKHGLVSOD\SURYLGHVLQIRUPDWLRQRQWKHUXQQLQJWLPHRIWKH6PDUW 0RWRU0DQDJHUDQGWKHPRWRUWKHQXPEHURIRSHUDWLRQVSHUIRUPHGE\WKHPRWRUWKH FRQWDFWRUHWF)URPWKLVLQIRUPDWLRQQHFHVVDU\PDLQWHQDQFHDQGLQVWDOODWLRQUHSODFHPHQWV FDQEHGHULYHG Checking without Test Equipment Functional Check with the Test Button :LWKWKHPRWRUDWVWDQGVWLOOWKHWKHUPDOSURWHFWLRQDOODODUPVWULSVDQGWULSSLQJWLPHVFDQEH FKHFNHGZLWKWKHDLGRIWKH7HVWEXWWRQ3DJH IRUWKHVSHFLILFSURFHGXUHV Publication 825-UM001B-EN-P January 2001 7-2 Testing and Maintenance Indication of Recorded Values $OOLPSRUWDQWVWDWLVWLFDOGDWDFDQEHUHDGRQWKH/&'RIWKHEDVLFXQLW5HIHUWRSDJH IRU SURFHGXUH )URPWKHUHFRUGHGYDOXHVGDWDFDQEHXVHGWRGHWHUPLQH • • • • • 5XQQLQJWLPHRIWKHPRWRUWKH6PDUW0RWRU0DQDJHUFRQWDFWRUHWF 1HFHVVDU\VHUYLFHMREV 2SHUDWLRQDOEHKDYLRURIPRWRUDQGLQVWDOODWLRQ &DXVHVVKRUWO\EHIRUHWULSSLQJDQGWKHPRPHQWRIWULSSLQJ 0LVXVHLQIRUPDWLRQVXFKDVWRRPDQ\HPHUJHQF\VWDUWVHWF 7KHWDEOHEHORZOLVWVWKHUHFRUGHGYDOXHVDFFHVVLEOHIURPWKH6PDUW0RWRU0DQDJHU Table 7.A List of Recorded Values LCD Description RECORDED VALUES Mode: Recorded values 825-M MAIN TIME --- H -- MIN Total basic unit running time (including interruption of control voltage) in hours, minutes MOT RUNNING TIME --- H -- MIN Total motor running time in hours, minutes SINCE LAST START --- H -- MIN Time since last start in hours, minutes SINCE 1PRV START --- H -- MIN Time since one start prior to last start in hours, minutes SINCE 2 PRV START --- H -- MIN Time since two starts prior to last start in hours, minutes SINCE 3 PRV START --- H -- MIN Time since three starts prior to last start in hours, minutes SINCE 4 PRV START --- H -- MIN Time since four starts prior to last start in hours, minutes SINCE LAST TRIP --- H -- MIN Time since last trip in hours, minutes Publication 825-UM001B-EN-P January 2001 Testing and Maintenance 7-3 Table 7.A List of Recorded Values (Continued) LCD Description SINCE 1 PRV TRIP --- H -- MIN Time since one trip prior to last trip in hours, minutes SINCE 2 PRV TRIP --- H -- MIN Time since two trips prior to last trip in hours, minutes SINCE 3 PRV TRIP --- H -- MIN Time since three trips prior to last trip in hours, minutes SINCE 4 PRV TRIP --- H -- MIN Time since four trips prior to last trip in hours, minutes CAUSE LAST TRIP ASYMMETRY TRIP Cause of last trip, e.g., asymmetry CAUSE 1 PRV TRIP ASYMMETRY TRIP Cause of one trip prior to last trip, e.g., asymmetry CAUSE 2 PRV TRIP OVERCURRENT TRIP Cause of two trips prior to last trip, e.g., overcurrent CAUSE 3 PRV TRIP THERMAL TRIP Cause of three trips prior to last trip, e.g., thermal CAUSE 4 PRV TRIP PTC TRIP Cause of four trips prior to last trip, e.g., thermistor SINCE EMG START --- H -- MIN Time elapsed since last emergency start in hours, minutes SINCE POWER OFF --- H -- MIN Time elapsed since last power failure in hours, minutes DURATION POW OFF --- H -- MIN Duration of power failure in hours, minutes I BEF LAST TRIP --- % IE Motor current before last trip as a percentage of rated service current (e) Short circuit = 999% AS BEF LAST TRIP --- % Asymmetry before last trip in percent EF BEF LAST TRIP --- % I Earth (ground) fault current before last trip as percentage of rated current or…mA Publication 825-UM001B-EN-P January 2001 7-4 Testing and Maintenance Table 7.A List of Recorded Values (Continued) LCD Description MAX T BEF L TRIP --- °C Maximum temperature before last trip in °C (PT100, #1…#6) TH BEF LAST TRIP --- % Thermal capacity used before last trip 100% = thermal trip NUMBER START --- Total number of motor starts NUMBER TH TRIP --- Total number of trips, thermal NUMBER AS TRIP --- Total number of trips, asymmetry NUMBER OC TRIP --- Total trips overcurrent/locked rotor NUMBER EF TRIP --- Total trips, earth (ground) fault NUMBER SC TRIP --- Total trips, short-circuit NUMBER UL TRIP --- Total trips, underload NUMBER PTC TRIP --- Total trips, overtemperature (PTC) NUMBER PR TRIP --- Total trips, phase sequence (motor supply) NUMBER PL TRIP --- Total trips, phase failure (motor supply) NUMB PT100 TRIP --- Total trips, overtemperature (PT100) TO CLEAR REC VAL GOTO END SET VAL To clear all recorded values (except running time of basic unit) go to “end set values” END REC VALUES End of recorded values Publication 825-UM001B-EN-P January 2001 Testing and Maintenance 7-5 Checking with Test Equipment $FRPSOHWHFKHFNRIWKH6PDUW0RWRU0DQDJHU·VFRPSRQHQWVFDQEHSHUIRUPHGZLWKWKHWHVW XQLWDQGDSKDVHFXUUHQWVRXUFH Test Unit :LWKWKHWHVWXQLWDOOSURWHFWLYHIXQFWLRQVVHWRQWKH6PDUW0RWRU0DQDJHUFDQEHFKHFNHG LQFOXGLQJWKHSLFNXSOHYHOVDQGWULSSLQJGHOD\V Test with 3-Phase Current Source 7KLVWHVWVKRXOGEHSHUIRUPHGRQO\E\TXDOLILHGSHUVRQQHO ATTENTION 8VLQJDSKDVHFXUUHQWVRXUFHWKHPDLQFLUFXLWDQ\SULPDU\FXUUHQWWUDQVIRUPHUDQGWKH FXUUHQWGHWHFWLRQPRGXOH&DW1R0&0FDQEHWHVWHG %HFDXVHWKHIXQFWLRQVRIWKH6PDUW0RWRU0DQDJHUKDYHDOUHDG\EHHQFKHFNHGZLWKWKHWHVW XQLWLWLVVXIILFLHQWWRVXSSO\DFXUUHQWRI[,HDIWHUDSSUR[LPDWHO\PLQWKHWKHUPDO XWLOL]DWLRQUHDFKHV$VDQDOWHUQDWLYH\RXFDQPHDVXUHWKHSKDVHFXUUHQWVH[DFWO\DQG FRPSDUHWKHUHDGLQJVZLWKWKHYDOXHVLQGLFDWHGE\WKH/&'RQWKH6PDUW0RWRU0DQDJHU Figure 7.1 Test with a 3-Phase Current Source 3-phase e A 1 3 4 M 3~ Measurement of phase currents 5 825-MCM 2 e 825-M 6 Connections (if current < rated motor current: e.g., 20 A when using 825-MCM180 Publication 825-UM001B-EN-P January 2001 7-6 Testing and Maintenance Test with Single-Phase Current Source 7KLVWHVWVKRXOGEHSHUIRUPHGRQO\E\TXDOLILHGSHUVRQQHO ATTENTION 7KHWHVWZLWKDSKDVHFXUUHQWVRXUFHGHVFULEHGRQSDJHFDQDOVREHSHUIRUPHGZLWKD VLQJOHSKDVHVRXUFH7RGRWKLVWKHHDUWKJURXQGIDXOWSURWHFWLRQE\WKH+ROPJUHHQPHWKRG PXVWEHVZLWFKHGRII Figure 7.2 Test with a Single-Phase Current Source e Connection A 1 3 5 825-MCM 2 Connection IMPORTANT 4 825-M 6 M 3~ 7KHWHVWFXUUHQWPD\QRWIORZWKURXJKWKHFRUHEDODQFHFXUUHQW WUDQVIRUPHU Publication 825-UM001B-EN-P January 2001 Chapter 8 Error Diagnosis and Troubleshooting Alarm, Warning ,IDQLPSHQGLQJGHIHFWLVGHWHFWHGHDUO\HQRXJKPRWRUGDPDJHFDQEHPLQLPL]HG7KLVOHDGV WR • /RZHUUHSDLUFRVWV • /HVVGRZQWLPHLQFUHDVHGSURGXFWLYLW\ $ODUPWKUHVKROGVFDQEHVHWIRU • • • • • • 7KHUPDOXWLOL]DWLRQRIWKHPRWRU 2YHUFXUUHQW $V\PPHWU\ 8QGHUORDG (DUWKJURXQGIDXOWZLWKFRUHEDODQFHWUDQVIRUPHU 6WDWRUDQGEHDULQJWHPSHUDWXUHZLWK37 :KHQWKHDODUPWKUHVKROGLVUHDFKHGWKH/('IODVKHVWKH/&'LQGLFDWHVWKHW\SHRIDODUP DQGWKHVHOHFWHGRXWSXWUHOD\SLFNVXS Procedure when Alarm/Warning Picks Up EXAMPLE $V\PPHWU\ :KHQDQDV\PPHWU\FRQGLWLRQRFFXUVDQGWKHUHODWHGWKUHVKROGLVUHDFKHGWKHIROORZLQJ UHVSRQVHVRFFXU • /('IODVKHV • /&' AS WARNING • 7KHDVVLJQHGRXWSXWUHOD\SLFNVXS Publication 825-UM001B-EN-P January 2001 8-2 Error Diagnosis and Troubleshooting &DXVHRIWKHZDUQLQJPD\EH • 8QEDODQFHGPDLQV • 'HIHFWLYHPRWRUZLQGLQJ • 'HIHFWLYHFRQWDFWV Actions ,IWKHLQVWDOODWLRQFDQEHVKXWGRZQZLWKRXWORVVRISURGXFWLRQRUZLWKRXWDIIHFWLQJVDIHW\ • 6ZLWFKRIIWKHLQVWDOODWLRQ • 6HDUFKIRUWKHIDXOWDQGUHSDLULW ,ILWLVLPSRUWDQWWRNHHSWKHRSHUDWLRQUXQQLQJ • &RQWLQXRXVO\PRQLWRUWKHOHYHORI$&78$/9$/8(6$6<0« • ,IWKHDODUPOHYHOFRQWLQXHVWRULVHPHDVXUHVVKRXOGEHWDNHQVRWKDWWKHLQVWDOODWLRQ FDQEHVKXWGRZQTXLFNO\ • ,IWKHDODUPOHYHOUHPDLQVVWHDG\LQWKHUHJLRQRIWKHVHWDODUPWKUHVKROGLWLV SHUPLVVLEOHWRZDLWXQWLOWKHQH[WSODQQHGLQWHUUXSWLRQLQRSHUDWLRQWRORFDWHDQG UHSDLUWKHIDXOW ATTENTION :KLOHWKHDODUPLVRQUHG/('IODVKLQJWKHDODUPIXQFWLRQFDQQRW EHGLVDEOHGUHIHUWRSDJH Trip EXAMPLE $V\PPHWU\ )DXOWVLQWKHPRWRURUWKHLQVWDOODWLRQFDQGHYHORSDQGOHDGWRWKHVHWWKUHVKROGEHLQJUDSLGO\ H[FHHGHG:KHQWKLVRFFXUVDQGWKHUHODWHGWKUHVKROGLVUHDFKHGWKHIROORZLQJUHVSRQVHV RFFXU • /('OLJKWV • /&' ASYMMETRY TRIP • 7KHDVVLJQHGRXWSXWUHOD\SLFNVXS Publication 825-UM001B-EN-P January 2001 Error Diagnosis and Troubleshooting 8-3 Actions 'HWHUPLQHWKHWULSFDXVHDQGFRUUHFWWKHSUREOHPEHIRUHUHVWDUWLQJWKHPRWRULQVWDOODWLRQ ATTENTION :KLOHWKHWULSLVRQUHG/('RQWKHSURWHFWLRQIXQFWLRQFDQQRWEH GLVDEOHGUHIHUWRSDJH Fault Codes Table 8.A Possible Causes and Actions LCD DEFECT #1 DEFECT #2 825-MCM NOT CON Designation Possible Causes Actions Ensure power supply is on. No supply voltage Check the supply. Insert correct supply module. If the voltage applied to the supply Wrong supply module module was too high, it and the in basic unit functions of the unit must be tested. If no fault is found or if in doubt, No indication Basic unit defective send the unit back to the factory for repair. Switch off control supply. Thermal trip of supply module Restore normal conditions and • Supply voltage too high let the unit cool down for • Ambient temp. too high approx. 30 min. • Current consumption too high Send the unit back to the factory • Supply module failed for repair. V2.17 and later: Watch Dog Microprocessor Send the basic unit back to the No indication, failure factory for repair. red LED on Send the basic unit back to the factory for repair. Real time RTC defective clock fault μP fault (RAM) Microprocessor RAM defective Send the basic unit back to the factory for repair. Open circuit Check connections. basic unit to Cable from basic unit to converter converter module not connected or broken Test cable (open/short-circuit). module Replace cable if necessary. Publication 825-UM001B-EN-P January 2001 8-4 Error Diagnosis and Troubleshooting Table 8.A Possible Causes and Actions (Continued) LCD 825-MCM ERROR Designation Possible Causes Link between basic unit and Converter converter module defective module cannot be correctly recognized Fault in basic unit Converter module rated current does not agree with basic unit setting IE OUT OF RANGE Rated current and setting do Wrong converter module not agree Wrong setting ERROR ACT VALUES ERROR REC VALUES Error in actual Data could not be saved when values supply last interrupted — Install the correct converter module Press “Values” until “SET Values” on LCD, correct “FULL LOAD CURR” (within about 5 s) Press Reset. Check power supply. If the fault repeatedly occurs, send the unit back to the factory for repair. Send the basic unit back to the factory for repair. Overloaded Reduce load. Switch off installation, remedy trouble. Mechanical damage, bearings, etc. THERMAL TRIP Check setting “FULL LOAD CURR” and converter module. Hardware fault Transported material jammed THERMAL WARNING Actions Check link between basic unit and converter module and replace if necessary. Switch supply off and on again If the fault cannot be remedied, send the unit back to the factory for repair. Repair the damage. Raise “FULL LOAD CURR”/”LOCKED ROT TIME” to permissible motor values. Thermal Wait until motor has cooled warning Interrupted start: motor down. (LCD: TH UTIL…% appr. inadequately cooled 20%) Thermal trip If permissible, increase More than one warm start/hour number of warm starts/h. Ambient temperature too high If possible, reduce load. (Function PT100, #7 ON) Very high third harmonic Raise e setting accordingly. (e.g., star-delta connection) Cooling constant ratio has been Check and reset to correct changed setting (factory setting 2.5). Settings of rated current or tripping time too low Publication 825-UM001B-EN-P January 2001 Error Diagnosis and Troubleshooting 8-5 Table 8.A Possible Causes and Actions (Continued) LCD ERROR SET VALUES Designation — Possible Causes Setting of locked rotor current and/or locked rotor time are outside the permissible range Mains unbalanced Blown fuse • Short-circuit/Earth (ground) fault • Failure during starting Motors idling (e.g., pumps) AS WARNING ASYMMETRY TRIP OC WARNING OVERCURRENT TRIP Actions Press “Values” until “SET VALUES” on LCD. Set “LOCKED ROT CURR” to 6 x e. Set “LOCKED ROT TIME” to 10 s. Set “LOCKED ROT CURR” and “LOCKED ROT TIME” correctly within permissible range (refer to Chapter. 3). If asymmetry inadmissibly high, clarify cause with electric company. If asymmetry has values usual for the area, raise threshold in the basic unit. • Repair the trouble, replace the fuse. • Redimension fuse (note short-circuit coordination). Raise threshold in basic unit to permissible level. Asymmetry Poor contacts (terminals, Repair trouble. warning contactor, breaker, etc.) Phase lead broken (motor lead, Replace or repair cable. Asymmetry link between basic unit and converter module) trip If asymmetry is acceptable, raise Asymmetrical motor winding threshold in basic unit; otherwise repair motor. Main current transformer error • Metering class current • Insert the correct current transformer. transformer instead of protection current transformer • Replace the current • Wrong current range transformer. • Current transformer rating • Replace the current too low transformer. • Incorrect current transformer • Check and correct wiring. wiring Reduce load or raise pickup Overload threshold. Overcurrent warning Transported material jammed Switch off installation, remedy cause. Pickup threshold set too low Raise pickup threshold. Mechanical damage to bearings Repair the damage. Overcurrent and transmission system trip Stalling during start (causes as Switch off installation, remedy for jamming when running) cause. Publication 825-UM001B-EN-P January 2001 8-6 Error Diagnosis and Troubleshooting Table 8.A Possible Causes and Actions (Continued) LCD EF HOLMG TRIP EF C WARNING EF CORE TRIP SHORT CIRC PROT Designation Possible Causes Earth (ground) fault motor winding or cable Earth (ground) Trip when running: • Primary current transformer fault wrongly wired (Holmgreen/ residual) trip • Primary current transformer saturated • High proportion of third harmonic in star-delta Trip during start: Primary and Earth (ground) core balance transformer wired fault warning incorrectly with core balance transformer Long motor cable Earth (ground) fault trip Earth (ground) fault in motor with core winding or cable due to: balance • Moisture transformer • Dirt • Mechanical damage Short-circuit or earth (ground) fault in motor winding or cable Short-circuit Trip when motor is switched on, trip due to inrush current Pickup threshold is < A Underwater pump running dry UL WARNING Underload warning Faulty fan blades UNDERLOAD TRIP Underload trip START INHIB TRIP Max. number of starts/h reached START CONT TRIP Start in max. starting time not possible Actions Repair damage. • Correct wiring. • Raise pickup threshold. • Raise pickup threshold to 50% or more. Correct the wiring (core balance transformer may only surround the three motor leads). Raise pickup threshold. Eliminate cause. Repair damage. Increase trip delay to > 0.1 s. Set pickup threshold to > A. Eliminate cause, lower pickup threshold if necessary or increase trip delay. If tripping takes place too soon after starting, increase the start delay. Torn conveyor belt Broken transmission elements Eliminate cause. Pumping against a closed valve Current setting e too high Set correct value. Wait until another start is permissible. Release will be Maximum number of starts has automatic. been exceeded. If another start is permissible, increase number of start/hour by “1” and start again. Reduce load or raise max. starting Overloaded time to permissible value. Transport material jammed Eliminate cause. Raise max. starting time to Viscous material permissible value. Publication 825-UM001B-EN-P January 2001 Error Diagnosis and Troubleshooting 8-7 Table 8.A Possible Causes and Actions (Continued) LCD PTC TRIP Designation PTC trip Possible Causes Actions Check leads, remove fault. PTC: PTC or PTC leads short-circuited Motor for repair. If not possible, or broken switch off PTC monitoring “PTC PROT/OFF“. Wait until motor has cooled down Stator winding overheated by: sufficiently for a reset. • Overload • Search for cause and eliminate. • Too many starts/hour • Reduce starts/hour. • Too many warm starts/hour • Reduce number of warm starts/hour. • Obstructed cooling • Clean motor and cooling air intake. • High ambient temperature • Protect against heat; reduce load or switch off installation. PHASE REVER TRIP Phase sequence Wrong phase sequence of supply Connect phase leads in correct protection to converter module sequence. (motor supply) PHASE LOSS TRIP Faulty fuse: Phase failure Short-circuit/earth (ground) fault trip (based on Failure during start motor supply) Broken lead PT100 #…WARNING PT100 #1…#6 (RTD) temperature warning PT100 #…TRIP PT100 SHORT CIRC PT100 NO CONNECT PT100 #1…#6 (RTD) temperature trip Remedy damage, replace the fuse. Redimension fuse (noting short-circuit coordination). Check cables and terminal connections. Wait until motor has cooled down Stator winding overheated by: sufficiently to permit reset. • Overload • Search for cause and remedy. • Too many starts/hour • Reduce start/hour • Too many warm starts/hour • Reduce warm starts/hour • Obstructed cooling • Clean motor and cooling air intake. • High ambient temperature • Protect against heat. Reduce load or shut down the installation, and wait until motor has cooled down sufficiently for a restart. PT100 (RTD) has been short- or opencircuited. This message may appear together with a PT100 #1…#6 (RTD) TRIP Failure in PT100 (RTD) circuit Check cables, terminal connection and PT100 (RTD) sensor Publication 825-UM001B-EN-P January 2001 8-8 Error Diagnosis and Troubleshooting Procedure if “ALARM” does not Reset Indication • /&''RHVQRWGLVSOD\WKHW\SHRIWKHDODUP/&'DFWLYH • 5HG/(')ODVKLQJ Cause for this Condition ,IWKHDIIHFWHGDODUPIXQFWLRQLVVZLWFKHG´2))µEHIRUHWKHDODUPKDVGLVDSSHDUHGRUWKH PRWRUKDVEHHQVZLWFKHGRIIWKHQWKHDODUPVWD\VRQZKHWKHUWKHPRWRULVVZLWFKHGRQRU RII How to Get Rid of Alarm • *RWR6(79$/8(6PRGH • 6ZLWFKRQDOODODUPIXQFWLRQVHJ´7+(50$/:$51,1*µ´21µ • $VVRRQDVWKHDIIHFWHGDODUPIXQFWLRQLVVZLWFKHGRQDJDLQWKHQWKHDODUPFRQGLWLRQ ZLOOGLVDSSHDU • 6ZLWFKDODUPIXQFWLRQRIILIQRWUHTXLUHG Procedure if “TRIP” cannot be Reset 7KHUHDUHWZRUHDVRQVZK\DWULSFDQQRWEHUHVHWLIWKHPRWRULVQRWUXQQLQJ Thermal Trip ,QGLFDWLRQ • /&'´7+(50$/75,3µ • 5HG/('2Q +RZWR5HVHW 7KHPRWRUPXVWKDYHFRROHGGRZQWRWKHSUHVHWOHYHOEHIRUHWKHUHVHWLVSRVVLEOH ´7+5(6(7/(9(/µVHWWLQJUDQJH«IDFWRU\VHWWLQJ Publication 825-UM001B-EN-P January 2001 Error Diagnosis and Troubleshooting 8-9 Other Trips ,QGLFDWLRQ • /&''RHVQRWGLVSOD\WKHW\SHRIWKHWULS/&'DFWLYH • 5HG/('21 &DXVHIRUWKLV&RQGLWLRQ ,IWKHWULSSHGSURWHFWLRQIXQFWLRQKDVEHHQVZLWFKHG´2))µEHIRUHWKHWULSKDVEHHQUHVHW WKHQWKHWULSFDQQRWEHUHVHWWKHQRUPDOZD\ +RZWR5HVHW • • • • • • • *RWR5(&25'('9$/8(6PRGH *RWR´&$86(/$6775,3µHJ´$6<00(75<75,3µ *RWR6(79$/8(6PRGH *RWRWULSSHG3URWHFWLRQ)XQFWLRQHJ´$6<00(75<75,3µ 6ZLWFK3URWHFWLRQ)XQFWLRQRQHJ´$6<00(75<75,3µ´21µ 5HVHW7ULS5HG/('JRHVRII 6ZLWFK3URWHFWLRQ)XQFWLRQRIILIQRWUHTXLUHG Publication 825-UM001B-EN-P January 2001 Chapter 9 Applications/Wiring Bulletin 825 Smart Motor Manager with Contactors 6WULFWO\REVHUYHWKHLQVWDOODWLRQLQVWUXFWLRQVDQGWKHVSHFLILFDWLRQVIRU WKHFRQWDFWRUVDX[LOLDU\UHOD\VHWF ATTENTION Main Circuit Figure 9.1 Basic Unit and Converter Module L1 L2 U1 Converter module Cat. No. 825-MCM2 Cat. No. 825-MCM20 Cat. No. 825-MCM180 Cat. No. 825-MCM630 Cat. No. 825-MCM630N L3 A1 K1 A2 1 U1 3 5 825-MCM 2 4 6 M 3~ Publication 825-UM001B-EN-P January 2001 825-M F1 Applications/Wiring 9-2 Control Circuit Figure 9.2 Control by Momentary Contact F7 Us L1 S0 S1 F1 K1 95 97 A1 96 98 A2 MR 13 825-M AL K1 F1 S1 S0 Us H1 H2 MR AL H3 Contactor Bulletin 825 Smart Motor Manager On push button Off push button Control voltage Indicator “Contactor closed“ Indicator “825-M tripped“ Main relay Alarm relay Indicator “Alarm/Warning“ 14 A1 H2 K1 (L2/F8) H1 H3 A2 N ATTENTION 7KHPRXQWLQJZLULQJGLUHFWLRQVDQGWKHVSHFLILFDWLRQVRIWKH FRQWDFWRUEHLQJXVHGPXVWEHFRQVLGHUHG Publication 825-UM001B-EN-P January 2001 9-3 Applications/Wiring Star-Delta Starter with Bulletin 825 Smart Motor Manager Main Circuit Figure 9.3 Basic Unit and Converter Module %DVLF8QLWVHWWLQJV L1 L2 L3 ➊ Ls 1) FLC x 0.5774 [A] FULL LOAD CURR K1H BLΔ (…x e) LOCKED ROT TIME BLΔ (…sec.) 5 K2D A2 LOCKED ROT CURR 3 1 A1 2 U1 4 6 A1 A2 K3Y 2 4 6 A1 A2 1 3 5 2 4 6 825-M F1 825-MCM U1 V1 W1 U1 Converter module Cat. No. 825-MCM2 Cat. No. 825-MCM20 Cat. No. 825-MCM180 Cat. No. 825-MCM630 Cat. No. 825-MCM630N M 3~ START TIME 1 3 5 > tstartY (…sec.) U2 V2 W2 ➊ Core balance installation position Control Circuit Figure 9.4 Control by Momentary Contact F7 Us L1 S0 S1 F1 53 K1 95 97 A1 96 98 A2 MR 63 54 64 A1 A1 A1 A2 A2 A2 H2 N K3 K2 D 825-M AL F1 825-MLV (L2/F8) 13 H1 K1 H Publication 825-UM001B-EN-P January 2001 H3 14 K1 F1 Contactor Electronic control and protection system Bulletin 825 with Cat. No. 825-MLV option card S1 On push button S0 Off push button Us Control voltage H1 Indicator “Contactor closed“ H2 Indicator “825-M tripped“ MR Main relay AL Alarm relay H3 Indicator “Alarm/Warning“ Applications/Wiring 9-4 Short-Circuit Protection of Medium/High-Voltage Motors Main Circuit (with Cat. No. 825-MST Option Card) 3-Phase Current Evaluation Figure 9.5 Basic Unit for Short-Circuit Protection L1 L2 Variants L3 • 2-phase current evaluation • 2-phase current evaluation and earth (ground) fault protection with core balance transformer QM QA U1 Converter module Cat. No. 825-MCM2 Cat. No. 825-MCM20 A1 K1 A2 1 5 825-MCM U1 U2 3 2 4 6 F1 825-M U2 Main current transformer …A/5 A or …A/1 A For choice refer to Chapter 2 M 3~ Publication 825-UM001B-EN-P January 2001 9-5 Applications/Wiring Control Circuit Figure 9.6 Control by Momentary Contact F7 QM QA K1 F1 Us L1 S0 S1 K1 QM 95 F1 97 MR 96 98 K1 825-M 24 A2 MR AL H3 #1 QM A1 (L2/F8) A1 23 #1 H2 QA H3 S1 S0 Us H1 H2 H1 A2 N Circuit-breaker Shunt trip coil Contactor Bulletin 825 Electronic control and protection system On push button Off push button Control voltage Indicator “Contactor closed“ Indicator “825-M tripped” (except for short-circuit protection Main relay Alarm relay Indicator “Alarm/Warning“ Aux. relay, short-circuit indication Two-Speed Motors 7KHIROORZLQJUDQJHVDUHSRVVLEOHIRUVSHHGV,DQG,, Speed I-II 0.5…2.5 A 2.5…20 A 20…180 A with with with 160…630 A with Publication 825-UM001B-EN-P January 2001 Converter Module 825-MCM2 825-MCM20 825-MCM180 825-MCM630 or 825-MCM630N Applications/Wiring 9-6 Main Circuit Figure 9.7 Two-Speed Application Utilizing One 825-MCM* L1 L3 L2 L 1 3 N 5 220...230V AC/DC: R = 27kΩ / 5W 110...120V AC/DC: R = 12kΩ / 4W R 825-M 825-MCM 2 4 24 V AC/DC + – 6 I II M Y41 Y42 825-MST 3~ )RUVHWWLQJWKHVHFRQGFXUUHQWVSHHG,,UHIHUWR&KDSWHU ´&RQWUROLQSXWµ Publication 825-UM001B-EN-P January 2001 9-7 Applications/Wiring Two-Speed Motor: 0.5 A < Speed I < 20 A < Speed II < 180 A Main Circuit Figure 9.8 Two-Speed Application Utilizing 825-MCM180 L L1 L3 L2 N R 220...230V AC/DC: R = 27kΩ / 5W 110...120V AC/DC: R = 12kΩ / 4W 24 V AC/DC + – 0.5 A < Speed I < 20 A Motor supply cables loop n-times through 825-MCM180 until n x e ≥ 20 A Current setting 825-M: n x e (I) I II 1 5 3 Y41 Y42 825-MST 825-MCM 180 2 4 a b 6 20 A < Speed II < 180 A Motor supply cables loop once through 825-MCM180 Current setting 825-M: e (II) c M 3~ a b c )RUVHWWLQJWKHVHFRQGUDWHGFXUUHQWVSHHG,,UHIHUWR&KDSWHU ´&RQWUROLQSXWµ Publication 825-UM001B-EN-P January 2001 Applications/Wiring 9-8 Two-Speed Motors with Primary Current Transformer :KHQDSULPDU\FXUUHQWWUDQVIRUPHULVXVHGWZRVSHHGPRWRUVRIDQ\UDWLQJFDQEH SURWHFWHG Primary Circuit Figure 9.9 Two-Speed Application Utilizing Primary Current Transformer 220...230V AC/DC: R = 27kΩ / 5W 110...120V AC/DC: R = 12kΩ / 4W 24V AC/DC R = 0Ω L1 L2 L3 L1 L2 L3 (I) R ... A / 1 (5) A K2 M 3~ 24 V AC/DC 8 mA Y42 For setting the second rated current (speed II) K2 N (-) (II) ... A / 1 (5) A K1 L (+) refer to Chapter 5 “Control input #2“ K1 Y41 825-MST Secondary circuit (I) (II) 100-M05 100-M05 825-MCM 2 (20) 825-M Separately Ventilated Motors %HFDXVHWKH\DUHFRROHGFRQVWDQWO\VHSDUDWHO\YHQWLODWHGPRWRUVH[KLELWWKHVDPHWKHUPDO EHKDYLRUZKHQVWDWLRQDU\DVZKHQUXQQLQJ&RQVHTXHQWO\WKHFRROLQJUDWLRPXVWEHVHWWR /&' COOL-CONST RATIO 1.00 )RUVHWWLQJWKHFRROLQJUDWLRUHIHUWR&KDSWHU Publication 825-UM001B-EN-P January 2001 9-9 Applications/Wiring Basic Unit and Converter Module with Primary Current Transformer and Core Balance Current Transformer Main Circuit Figure 9.10 Typical Application Utilizing Primary Current Transformers and Core Balance Current Transformer L1 L2 Converter module Cat. No. 825-MCM2 Cat. No. 825-MCM20 L3 1 3 5 825-MCM T1 2 4 6 825-M k l Σ T2 M 3~ T1 Primary Current Transformer …A/5 A or …A/1 A (Selection refer to Chapter 2, Specifications — Basic Unit and Converter Module, for setting refer to Chapter 5) T2 Core balance transformer: Earth/Ground Current Current ratio of core balance current transformer Output from core balance current transformer Publication 825-UM001B-EN-P January 2001 5 mA…60 A 1…2 000:1 0…500 mA Applications/Wiring 9-10 Basic Unit and Converter Module with Core Balance Current Transformer Main Circuit Figure 9.11 Typical Application Utilizing Core Balance Current Transformer L1 L2 L3 1 3 5 Converter module 825-MCM2 825-MCM20 825-MCM180 825-MCM630 825-MCM630N 825-MCM 2 4 825-M k 6 l Σ T2 M 3~ T2 Core balance transformer: Earth/Ground Current Current ratio of core balance current transformer Output from core balance current transformer 5 mA…60 A 1…2 000:1 0…500 mA Publication 825-UM001B-EN-P January 2001 9-11 Applications/Wiring Motors with Low Idling Current (< 20% ,e) Main Circuit Figure 9.12 Application with Low Idling Current L1 L2 L3 L 1 3 N 5 220...230V AC/DC: R = 27kΩ / 5W 110...120V AC/DC: R = 12kΩ / 4W R 825-M 825-MCM 2 4 24 V AC/DC + – 6 Y31 Y32 825-MST M 3~ Settings Display CONTROL INPUT #1 ON I MOTOR < 20 % IE SPEED SWITCH ON • Motor switched on • Motor current < 20% e ,IPRWRUVKDYHDQRSHUDWLRQDOLGOLQJFXUUHQWRIOHVVWKDQ,HWKHQWKHLQIRUPDWLRQ´PRWRU VZLWFKHGRQµPXVWEHIHGZLWKDQDX[LOLDU\FRQWDFWRIWKHFRQWDFWRULQWRFRQWUROLQSXW Publication 825-UM001B-EN-P January 2001 Applications/Wiring 9-12 Connecting the PT100 Temperature Sensors Using the 2/3/4-Conductor Technique 7KH%XOOHWLQ0092SWLRQ&DUGKDVEHHQGHVLJQHGIRUWKHFRQGXFWRUWHFKQLTXH*LYHQ WKHGLDPHWHURIWKHFRQGXFWRULWLVDOVRSRVVLEOHWRFRQQHFWWKH37WHPSHUDWXUHVHQVRUV E\XVLQJWKHFRQGXFWRUWHFKQLTXH Figure 9.13 2/3/4 Conductor Technique for PT100 Wiring xT1 xT3 PT100 3-conductor technique Option 825-MMV xT2 xT1 xT3 PT100 2-conductor technique Option 825-MMV xT2 xT1 xT3 PT100 4-conductor technique Option 825-MMV xT2 Publication 825-UM001B-EN-P January 2001 9-13 Applications/Wiring Basic Unit and Converter Module with Primary Current Transformer, 2-Phase Current Evaluation Figure 9.14 Typical Application Utilizing 2-Phase Current Evaluation with Primary Current Transformers L1 L2 L3 Converter module cat. nos. 825-MCM2 825-MCM20 1 T1 3 5 825-M 825-MCM 2 4 6 Σ T2 M 3~ Publication 825-UM001B-EN-P January 2001 k l Applications/Wiring 9-14 Time/Current Characteristic of Bulletin 825 Smart Motor Manager Figure 9.15 Trip Characteristics 100000.0 10000.0 c 100.0 b 10.0 a Trip time [s] 1000.0 c 1.0 0.1 1.0 1.1 2.0 3.0 4 Load current as multiple of full load current 5 6 7 8 9 10 nxI e a: Setting range for UL/CSA applications b: Setting range for IEC applications c: The setting of A/t tA must be outside the range “c” (e.g., when A = 6 x e, t tA must be ≤ 100 s and ≥ 1 s). Publication 825-UM001B-EN-P January 2001 Chapter 10 References $ 5RWDU\&UXVKHU$SSOLFDWLRQ3URILOH3XEOLFDWLRQ (1 % :DVWH:DWHU$SSOLFDWLRQ3URILOH3XEOLFDWLRQ (1 & 0XOWLIXQFWLRQDO0RWRU0DQDJHPHQW3XEOLFDWLRQ %5%(13 ' 6PDUW0RWRU0DQDJHU5HOD\6HOHFWLRQ*XLGH3XEOLFDWLRQ &$$(13 ( 6PDUW0RWRU0DQDJHU+RW7RSLFV3XEOLFDWLRQ ) 6PDUW0RWRU0DQDJHU8VHU0DQXDO3XEOLFDWLRQ * 'HYLFH1HW™&RPPXQLFDWLRQ&DUG8VHU0DQXDO3XEOLFDWLRQ Publication 825-UM001B-EN-P January 2001 References 10-2 Notes: Publication 825-UM001B-EN-P January 2001 10-3 References Notes: Publication 825-UM001B-EN-P January 2001 Back Cover Publication 825-UM001B-EN-P January 2001 Supersedes Publication 825-5.0EN dated June 1998 © 2001 Rockwell International Corporation. Printed in the U.S.A. Software Version 3.15 PN 40055-158-01(B) Supersedes PN 40055-158-01(A)