Download MODEL RL331X USER MANUAL
Transcript
02'(/5/; $8720$7('7(//(50$&+,1( 86(50$18$/ 7'16HSWHPEHU &25325$7(+($'48$57(56 %6WUHHW /RQJ%HDFK06 3KRQH )D[ &23<5,*+7127,&( 7ULWRQ$OO 5LJKWV 5HVHUYHG 75,721 ORJR LV D UHJLVWHUHGWUDGHPDUNRI7ULWRQ6\VWHPVRI'HODZDUH//& 02'(/5/;86(50$18$/ '2&80(1783'$7(6 6HS2ULJLQDO LL 02'(/5/;86(50$18$/ 127,&(6 &RS\ULJKW'HODZDUH&DSLWDO)RUPDWLRQ,QF $//5,*+765(6(59(' 7KLVSXEOLFDWLRQLVSURWHFWHGE\FRS\ULJKWDQGDOOULJKWVDUHUHVHUYHG1RSDUWRILWPD\EHUHSURGXFHG RUWUDQVPLWWHGE\DQ\PHDQVRULQDQ\IRUPZLWKRXWSULRUFRQVHQWLQZULWLQJIURP7ULWRQ6\VWHPVRI 'HODZDUH//& 7KHLQIRUPDWLRQLQWKLVSXEOLFDWLRQKDVEHHQFDUHIXOO\FKHFNHGDQGLVEHOLHYHGWREHDFFXUDWH+RZHYHU 7ULWRQ6\VWHPVRI'HODZDUH//&DVVXPHVQRUHVSRQVLELOLW\IRUDQ\LQDFFXUDFLHVHUURUVRURPLVVLRQV WKDWPD\EHFRQWDLQHGLQWKLVGRFXPHQW,QQRHYHQWZLOO7ULWRQ6\VWHPVRI'HODZDUH//&EHOLDEOHIRU GLUHFWLQGLUHFWVSHFLDOLQFLGHQWDORUFRQVHTXHQWLDOGDPDJHVUHVXOWLQJIURPDQ\GHIHFWRURPLVVLRQLQ WKLVPDQXDOHYHQLIDGYLVHGRIWKHSRVVLELOLW\RIVXFKGDPDJHV ,QWKHLQWHUHVWRIFRQWLQXHGSURGXFWGHYHORSPHQW7ULWRQ6\VWHPVRI'HODZDUH//&UHVHUYHVWKHULJKW WRPDNHLPSURYHPHQWVLQLWVGRFXPHQWDWLRQDQGWKHSURGXFWVLWGHVFULEHVDWDQ\WLPHZLWKRXWQRWLFHRU REOLJDWLRQ 75$'(0$5.$&.12:/('*(0(176 0LFURVRIW:LQGRZVLVDUHJLVWHUHGWUDGHPDUNRI0LFURVRIW&RUSRUDWLRQLQWKH8QLWHG6WDWHVDQGRURWKHU FRXQWULHV7ULWRQ&RQQHFWLVDWUDGHPDUNRI7ULWRQ6\VWHPVRI'HODZDUH//&9,6$LVDUHJLVWHUHG WUDGHPDUNRI9,6$RIWKH8QLWHG6WDWHVDQGRWKHUFRXQWULHV LLL 02'(/5/;86(50$18$/ &217(176 6(&7,21,1752'8&7,21 :+$7¶6,17+,60$18$/ )($785(+,*+/,*+76&+$1*(6 67$1'$5')($785(6 6(&7,21%$6,&23(5$7,21 ,1752'8&7,21 &21752/3$1(//$<287 )81&7,21.(<3$'6 0$,1.(<3$' 216&5((1.(<3$'23(5$7,21 0(18%$6('23(5$7,21 &86720(575$16$&7,216 92,&((1$%/('75$16$&7,216 6(&7,21&$66(77(&/26(&$6+5(3/(1,6+0(17 ,1752'8&7,21 ',63(16,1*0(&+$1,606 127(&21',7,21 35(3$5,1*127(6 &$66(77(&/26(352&('85(6 5(3/(1,6+&$66(77(6 6&'8 6'' 6(&7,21*(1(5$/0$,17(1$1&( ,1752'8&7,21 5(3/(1,6+,1*7+(5(&(,373$3(5 &/($1,1*7+((1&/2685( &/($1,1*7+(',63/$< &$5'5($'(5&/($1,1* LY 02'(/5/;86(50$18$/ &217(176 $33(1',;$62)7:$5(/,&(16($*5((0(17$ $33(1',;%:$55$17<67$7(0(17% $33(1',;&(/(&7521,&/2&.6& $33(1',;'0(&+$1,&$//2&.6' 6833/(0(17$77(33%$77(5<5(3/$&(0(17352&('85(66$ 6833/(0(17%.(<0$1$*(0(176% Y 02'(/5/;86(50$18$/ 7+,63$*(,17(17,21$//</()7%/$1. YL 6(&7,21 ,1752'8&7,21 02'(/5/;86(50$18$/ :+$7¶6,17+,60$18$/ 7KH8VHUPDQXDOGHVFULEHVWKHRSHUDWLQJIHDWXUHVRIWKH0RGHO5/;VHULHV$70DQGVKRZVKRZWR SHUIRUPWKHSURFHGXUHVWKDWZRXOGW\SLFDOO\EHSHUIRUPHGE\WKHRZQHURURSHUDWRUSHUVRQQHO 7KHPDQXDOLVGLYLGHGLQWRWKHIROORZLQJVHFWLRQV 6(&7,21,1752'8&7,216XPPDUL]HVWKHEDVLFIHDWXUHVRIWKH0RGHO5/;VHULHV$70 6(&7,21%$6,&23(5$7,21'HVFULEHVWKHEDVLFRSHUDWLRQRIWKHWHUPLQDO ¾ ¾ ¾ ¾ ¾ &RQWURO3DQHO/D\RXW .H\SDGV)XQFWLRQ0DLQ2Q6FUHHQ 0HQX%DVHG2SHUDWLRQ &XVWRPHU7UDQVDFWLRQ3URFHVV 9RLFH(QDEOHG7UDQVDFWLRQV 6(&7,21&$66(77(&/26(&$6+5(3/(1,6+0(17'HVFULEHVWKHPHQXIXQFWLRQVIRUFDVVHWWHFORVH SURFHGXUHV&DVKUHSOHQLVKPHQWVWHSVIRUHDFKGLVSHQVHUDQGVWDQGDUGVDUHFRYHUHGDVZHOO 6(&7,21*(1(5$/0$,17(1$1&('HVFULEHVQRUPDOSUHYHQWDWLYHDQGFRUUHFWLYHPDLQWHQDQFHSURFH GXUHVDSSURSULDWHIRUXVHUSHUVRQQHO ¾ ¾ 5HSOHQLVKLQJ5HFHLSW3DSHU &OHDQLQJWKH(QFORVXUH&DUG5HDGHU $33(1',;$62)7:$5(/,&(16($*5((0(17&203/,$1&(67$7(0(176 $33(1',;%:$55$17<67$7(0(17 $33(1',;&(/(&7521,&&20%,1$7,21/2&.6 $33(1',;'0(&+$1,&$/&20%,1$7,21/2&.6 6833/(0(17$77%$77(5<5(3/$&(0(17352&('85(6 ,03257$17 )ROORZ WKH LQVWUXFWLRQV SURYLGHG LQ 6833/(0(17$ RI WKLV PDQXDO IRU UHSODFLQJWKHEDWWHU\IRUWKH773&,(33)DLOXUHWRIROORZWKHH[SOLFLWLQVWUXFWLRQVZLOO SHUPDQHQWO\GDPDJHWKHNH\SDG 6833/(0(17%77.(<0$1$*(0(17)81&7,216 ,1752'8&7,21 )($785(+,*+/,*+76 ,PSRUWDQWIHDWXUHVRIWKH5/;VHULHV$70DUHKLJKOLJKWHGLQWKHIROORZLQJOLVW +LJKO\UHOLDEOHVWDWHRIWKHDUWRSHUDWLQJV\VWHP3&SODWIRUPGHVLJQ7KH5/;XVHV0LFURVRIW :LQGRZV&(RSHUDWLQJV\VWHPZLWK7ULWRQ¶V;WHFKQRORJ\6XSSRUWV:LQGRZV¿OHIRUPDWVIRU DGGLQJFXVWRPORJRVDQGDGYHUWLVHPHQWV,QDGGLWLRQLWIHDWXUHV7ULWRQ¶VFRPSOHWHO\FXVWRPGHVLJQ; PRWKHUERDUGZLWKLQWHJUDWHGPRGHP 0RGXODUDUFKLWHFWXUHHDVHVWURXEOHVKRRWLQJDQGVHUYLFLQJ )URQWDFFHVVXQLWDFFRPPRGDWHVVLQJOHFDVVHWWH6&'8RU6'' 2QO\RQHFDELQHWGHVLJQVKDOORZDFFRPPRGDWHVWKHGLVSHQVHUPHFKDQLVPRIIHUHG &DELQHWDYDLODEOHLQ8/%XVLQHVV+RXUVRQO\&DVKPXVWEHUHPRYHGDIWHUKRXUV ´PPZLGHVFUHHQFRORU/&'GLVSOD\ 7 7 3&,FRPSOLDQW (33 WR FRPSO\ ZLWK LQWHUQDWLRQDO HQFU\SWLRQ VWDQGDUGV DQG 7ULSOH '(6 FRPSOLDQW 02'(/5/;86(50$18$/ )($785(+,*+/,*+76 (DV\WRLQVWDOOVPDOOIRRWSULQWGHVLJQPDNHVSODFHPHQWHDVLHUDQGFRQ¿JXUHWHUPLQDOSDUDPHWHUV E\VRIWZDUH 6XSSRUWVFRPPXQLFDWLRQW\SHV7&3,3VWDQGDUGGLDOXS.EDXG7ULWRQ86%PRGHPLQWHJUDWHG RQPRWKHUERDUG96$7VDWHOOLWH5DGLR3DGDQGZLUHOHVVRSWLRQDO 1RWH)RUZLUHOHVVRSWLRQSOHDVHFRQWDFW\RXUDFFRXQWUHSUHVHQWDWLYHIRUPRUHLQIRUPDWLRQ 0XOWLIXQFWLRQGLSVW\OHFDUGUHDGHUVXSSRUWVPDJQHWLFVWULSHFDUGVRU³VPDUW´FDUGVWKDWFRQIRUP WRWKH(09VWDQGDUG6HULDO0&56WDQGDUG',3>86@RU,6(09',3>&DQDGD21/<@ *UDSKLFVFDSDEOHPPJUDYLW\IHGWKHUPDOSULQWHUGHVLJQHGIRUTXLHWRSHUDWLRQ3ULQWVUHFHLSWV FRXSRQVDQGPDQDJHPHQWUHSRUWV&XWVDQGSUHVHQWVUHFHLSW 0HFKDQLFDOVWDQGDUGRUHOHFWURQLFFRPELQDWLRQORFNRSWLRQDO 6XSSRUWVUHPRWHVHWXSFRQ¿JXUDWLRQDQGPRQLWRULQJYLD7ULWRQ&RQQHFW$70PRQLWRULQJVRIWZDUH 'LVSHQVHV86DQGLQWHUQDWLRQDOFXUUHQF\W\SHV +LJKFDSDFLW\HOHFWURQLFMRXUQDOVWRUHVWUDQVDFWLRQGHWDLOVIRUODWHUSULQWRXWDQGDQDO\VLV 6DWLV¿HV$PHULFDQVZLWK'LVDELOLWLHV$FW$'$VSHFL¿FDWLRQVIRUKHLJKWDQGDFFHVVDXGLRWUDQVDFWLRQV IRUWKHYLVXDOO\LPSDLUHG&RPSOLHVZLWK8.DFFHVVLELOLW\JXLGHOLQHV''$DQG&DOLIRUQLDDFFHVV FRPSOLDQFH7LWOH /('EDFNOLWVLJQDJHVWDQGDUG 67$1'$5')($785(6 0$1$*(0(17 )81&7,216 (QDEOH H[WHQVLYH FRQWURO DQG FXVWRPL]DWLRQ RI WKH$70¶V RSHUDWLQJ SDUDPHWHUV6HH³;6&$/(;&21),*85$7,210$18$/´RQZHEVLWH 3$66:25'3527(&7,21$FFHVVWR0DQDJHPHQW)XQFWLRQVDQG.H\0DQDJHPHQWDUHDVDUHSURWHFWHG ZLWKSDVVZRUGV 0$&(1&5<37,2168332570HVVDJH$XWKHQWLFDWLRQ&RGH0$&GDWDHQFU\SWLRQSURWRFRO3URYLGHV LQFUHDVHGSURWHFWLRQIRUPHVVDJHWUDI¿FWRDQGIURPWKH$707ULSOH'(6FRPSOLDQW 66/6XSSRUW7&3,3ZLWK6HFXUH6RFNHW/D\HUDGGVDQRWKHUOHYHORI$70WR+RVWFRPPXQLFDWLRQV VHFXULW\ 3&,&203/,$17(1&5<37,1*3,13$'(33(175<'(9,&(68332576HFXUH(33GHYLFHHQFU\SWV WKHFXVWRPHU3,1GXULQJDWUDQVDFWLRQ7ULSOH'(6DQG3&,FRPSOLDQW 08/7,/$1*8$*(6833257(QDEOHVWKHFXVWRPHUWRVHOHFWDSUHIHUUHGODQJXDJHVXFKDV)UHQFKRU 6SDQLVKIRUFXVWRPHUVFUHHQVDQGUHFHLSWV ,1752'8&7,21 75$16$&7,21 $1'$&&28177<3( &21),*85$7,21 (QDEOHV VHOHFWLRQRI WUDQVDFWLRQV WUDQVIHUV RU EDODQFHLQTXLULHVRUDFFRXQWVVDYLQJVRUFUHGLWFDUGWKDWZLOOEHSUHVHQWHGWRWKHFXVWRPHU'RHV QRWDIIHFWDYDLODELOLW\RIFKHFNLQJDFFRXQWZLWKGUDZDO &$66(77( $1''$<&/26(5(325763URYLGHVXPPDU\LQIRUPDWLRQDERXWWKHQXPEHUDQGW\SHRI WUDQVDFWLRQVEHLQJSHUIRUPHGE\WKH$70 (/(&7521,&-2851$/6WRUHVWKHGHWDLOVRIHDFKWUDQVDFWLRQLQVROLGVWDWHPHPRU\-RXUQDOGDWDFDQ EHUHWULHYHGSULQWHGVDYHGWRDQH[WHUQDOVWRUDJHGHYLFHRUWUDQVIHUUHGWRDUHPRWH7ULWRQ&RQQHFW FRPSXWHU $'6&5((16$Q$GVFUHHQLVDSURPRWLRQDORUDGYHUWLVLQJJUDSKLFWKDWLVGLVSOD\HGRQWKH/&' VFUHHQGXULQJLGOHSHULRGV$GVFUHHQVDUHGRZQORDGHGWRWKHWHUPLQDOE\HLWKHUXVLQJDQH[WHUQDO VWRUDJHGHYLFH86%MXPSGULYHRUDUHPRWH7ULWRQ&RQQHFWFRPSXWHU7H[WRQO\QRQJUDSKLF DGVFUHHQVFDQDOVREHGLVSOD\HG 5(&(,3735,17(5*5$3+,&67KLVIHDWXUHDOORZVLQIRUPDWLRQDORUSURPRWLRQDOJUDSKLFVWREHSULQWHG RQFXVWRPHUUHFHLSWV*UDSKLFVFDQEHORDGHGIURPDQH[WHUQDOVWRUDJHGHYLFHRU7ULWRQ&RQQHFW 0(66$*(6,QIRUPDWLRQDODQGSURPRWLRQDOPHVVDJHVWKDWDUHGLVSOD\HGWRWKHFXVWRPHURQVFUHHQRU SULQWHGRQUHFHLSWV &283216&RXSRQVFDQEHSULQWHGE\WKHUHFHLSWSULQWHU3UL]HVPD\EHDZDUGHGWRFXVWRPHUVEDVHG RQ UDQGRP DQGRU ZLWKGUDZDO DPRXQWEDVHG WUDQVDFWLRQV &RXSRQ WH[W FDQ EH HQWHUHG ORFDOO\ RU GRZQORDGHGDORQJZLWKFRXSRQJUDSKLFVXVLQJ7ULWRQ&RQQHFWVRIWZDUH 67$786021,725,1*7KH$70FDQSHULRGLFDOO\WUDQVIHUVWDWXVLQIRUPDWLRQWRWKHKRVWSURFHVVRU ,QDGGLWLRQ7ULWRQ&RQQHFWUHPRWHPRQLWRULQJVRIWZDUHFDQEHXVHGWRYLHZWKHMRXUQDOPRQLWRU RSHUDWLRQDQGDODUPFRQGLWLRQVXSGDWHRSHUDWLQJSDUDPHWHUVDQGUHVHWWKHWHUPLQDO 8/%86,1(66+28566(59,&(%XVLQHVVKRXUVFDELQHWPHDQVFXUUHQF\VKRXOGEHUHPRYHGIURP WKHGLVSHQVHUDQGVWRUHGLQDVDIHORFDWLRQZKHQWKHEXVLQHVVLVFORVHGWRWKHSXEOLF )5217$&&(66&$%,1(7$OORZVDFFHVVWRWKHGLVSHQVLQJPHFKDQLVPDQGFXUUHQF\FDVVHWWHIURPWKH FRQWUROSDQHOVLGHRIWKHXQLW :HLJKWRIWKH5/; $SSUR[LPDWH %XVLQHVV +RXUV OEV .LORV &RQ¿JXUDWLRQ 6KDOORZFDE 'LVSHQVHU 02'(/5/;86(50$18$/ 7+,63$*(,17(17,21$//</()7%/$1. 6(&7,21 %$6,&23(5$7,21 02'(/5/;86(50$18$/ ,1752'8&7,21 7KLVVHFWLRQGHVFULEHVWKHEDVLFRSHUDWLRQRIWKHWHUPLQDO7KHIROORZLQJWRSLFVDUHFRYHUHG &21752/3$1(//$<287'HVFULEHVWKHOD\RXWRIWKHWHUPLQDO¶VFRQWUROSDQHO .(<3$'23(5$7,21'HVFULEHVWKHXVHRIWKHDOSKDQXPHULFNH\SDGV 0(18%$6('23(5$7,21*LYHVDJHQHUDORYHUYLHZRIWKHWHUPLQDOGLVSOD\LQWHUIDFH &86720(575$16$&7,2166XPPDUL]HVWKHDFWLRQVLQYROYHGLQW\SLFDOFXVWRPHUWUDQVDFWLRQV,Q DGGLWLRQWKHYRLFHHQDEOHGWUDQVDFWLRQVIHDWXUHLVGHVFULEHG &21752/3$1(//$<287 7KHXVHULQWHUIDFHRIWKHWHUPLQDOFRQVLVWVRIWKH/&'VFUHHQUHFHLSWFKXWHFDUGUHDGHUVSHDNHUKHDGSKRQH MDFNYLVXDOO\LPSDLUHGDQGNH\VRQWKUHHNH\SDGV7KH)XQFWLRQNH\VDUHDUUDQJHGLQWZRIRXUNH\ JURXSVRQHJURXSRQHLWKHUVLGHRIWKH/&'GLVSOD\7KHPDLQNH\SDGFRQVLVWVRIDOSKDQXPHULFNH\V WZRDUURZNH\VDQGIRXUODUJHFRQWURONH\VDOOORFDWHGLQDNH\JURXSEHQHDWKWKH/&'VFUHHQ 7KHPDLQNH\SDGDQGFRQWURONH\VKDYHDQLQWHJUDOUDLVHG%UDLOOHV\PEROWRFRQIRUPWRWKHUHTXLUHPHQWV RIWKH$PHULFDQVZLWK'LVDELOLWLHV$FW)LJXUH /&'VFUHHQ )XQFWLRQ NH\V &DUG 5HDGHU 5HFHLSW FKXWH 0DLQ .H\SDG )LJXUH&RQWUROSDQHOOD\RXW %$6,&23(5$7,21 )81&7,21.(<6 7KHHLJKWNH\VDUUDQJHGLQWZRIRXUNH\JURXSVDUHFDOOHGVFUHHQIXQFWLRQNH\V$VFUHHQIXQFWLRQ NH\LVRQO\DFWLYHZKHQDFRUUHVSRQGLQJIXQFWLRQRUPHQXRSWLRQLVSUHVHQWQH[WWRWKDWNH\7KH)XQFWLRQ NH\VDUHGHVLJQDWHG)WKURXJK)DVVKRZQLQ)LJXUH ) ) ) ) ) ) ) ) )LJXUH)XQFWLRQNH\OD\RXW 0$,1.(<3$' 7KHHQWU\RIQXPHULFFKDUDFWHUVYLDWKHPDLQNH\SDGLVVWUDLJKWIRUZDUGVLPSO\SUHVVWKHGHVLUHGNH\ +RZHYHULQFHUWDLQ0DQDJHPHQW)XQFWLRQVFUHHQVLWPD\EHQHFHVVDU\WRHQWHUDOSKDEHWLFFKDUDFWHUVD SURFHGXUHWKDW¶VDYDLODEOHZLWKWKH2Q6FUHHQNH\SDGH[SODLQHGRQQH[WSDJH )LJXUH $OSKDQXPHULF NH\SDG &75/ 02'(/5/;86(50$18$/ 216&5((1.(<3$'23(5$7,21 7RHQWHUWH[WFKDUDFWHUVLQWRWKHGLDORJER[HVWKDWDUHGLVSOD\HGE\WKH0DQDJHPHQW)XQFWLRQVSUHVV WKH)NH\WRGLVSOD\WKHVFUHHQNH\ERDUG8VHWKHNH\VGHVFULEHGEHORZWRQDYLJDWHDQGHQWHUUHTXLUHG GDWDVHH)LJXUH 7KH$UURZNH\VDQG!WKH!NH\83DQGWKH!NH\'2:1QDYLJDWHWKHNH\ERDUG 3UHVVWKH(17(5!NH\WRVHOHFWWKHKLJKOLJKWHGNH\HQWU\ 3UHVVWKH&75/!NH\WRVZLWFKEHWZHHQXSSHUDQGORZHUFDVHFKDUDFWHUV 3UHVVWKH&$1&(/!NH\WR([LWWKHNH\ERDUG 3UHVVWKH&/($5!NH\IRUWKH%DFNVSDFHRSHUDWLRQ 3UHVVWKH!NH\WRUHSRVLWLRQWKHNH\ERDUGWRDQRWKHUORFDWLRQRQWKHGLVSOD\ 3UHVVWKH!NH\WRSRVLWRQWKHFXUVRURQDQHZOLQH )LJXUH2QVFUHHQNH\ERDUG %$6,&23(5$7,21 0(18%$6('23(5$7,21 7KHWHUPLQDORSHUDWHVDVDPHQXGULYHQV\VWHP0HVVDJHVDQGPHQXRSWLRQVSUHVHQWHGRQWKH/&'GLVSOD\ VFUHHQJXLGHWKHXVHU¶VDFWLRQV7KHGHVLUHGPHQXRSWLRQLVVHOHFWHGE\SUHVVLQJRQHRIWKHNH\VORFDWHG WRWKHOHIWDQGULJKWRIWKHGLVSOD\)RUWKHSXUSRVHRIVHFXULW\PDQ\VFUHHQVWLPHRXWDIWHUDSUHVHWWLPH LQWHUYDOXVXDOO\VHFRQGV7KHWLPHRXWOHQJWKPD\YDU\GHSHQGLQJRQWKHIXQFWLRQEHLQJSHUIRUPHG :KHQDVFUHHQWLPHRXWRFFXUVDVFUHHQLVSUHVHQWHGZKLFKDVNVWKHXVHULIPRUHWLPHLVQHHGHG,IWKH XVHUFKRRVHV12WKH&XVWRPHU:HOFRPHVFUHHQZLOOEHSUHVHQWHG,I<(6LVFKRVHQWKHXVHULVUHWXUQHG WRWKHIXQFWLRQWKDWZDVDFWLYHSULRUWRWKHWLPHRXW,IWKHXVHUGRHVQRWPDNHDVHOHFWLRQZLWKLQDQDG GLWLRQDOVHFRQGFRXQWGRZQSHULRGWKHWHUPLQDOZLOODXWRPDWLFDOO\JRWRWKH&XVWRPHU:HOFRPHVFUHHQ (QVXUHDOOSURFHGXUHVLQWKH,QVWDOODWLRQ*XLGHKDYHEHHQDFFRPSOLVKHG7KHXQLWVKRXOGEHRIIZLWKWKH SRZHUFRUGDQGFRPPXQLFDWLRQVFDEOHFRQQHFWHG3RZHURQWKHXQLWE\SODFLQJWKHSRZHUVZLWFKRQWKH SRZHUVXSSO\WRWKHRQSRVLWLRQ6KRUWO\DIWHUWKHXQLWLVWXUQHGRQWKHWRSPHQXZLOOEHGLVSOD\HG$Q H[DPSOHWRSPHQXLVVKRZQLQ)LJXUH$Q(UURU&RGHRI:,//EHGLVSOD\HGXSRQWKH¿UVWVWDUW XS<RX0867FKDQJHWKHPDVWHUSDVVZRUGEHIRUHDQ\RWKHUFRQ¿JXUDWLRQRSHUDWLRQVZLOOEHDOORZHG )URPWKHWRSPHQX\RXFDQHLWKHU $FWLYDWH WKH WHUPLQDO WR SHUIRUP FXVWRPHU WUDQVDFWLRQV E\ SUHVVLQJ WKH NH\ QH[W WR &86720(5 75$16$&7,216 (QWHUWKHWHUPLQDOV\VWHPPDQDJHPHQWDUHDE\SUHVVLQJWKHNH\QH[WWR0$1$*(0(17)81&7,216 1RWH<RXZLOOKDYHWRHQWHUDQDSSURSULDWHSDVVZRUGWRYLHZWKH0DQDJHPHQW)XQFWLRQVPHQX 7KHPDVWHUSDVVZRUGLVDFWXDOO\PDGHXSRIWZRSDUWVWKH,'DQGWKHSDVVZRUG7KHPDVWHU,'LV DQGFDQQRWEHFKDQJHG:KDWPXVWEHFKDQJHGLVWKHGHIDXOWPDVWHUSDVVZRUGIRU,'RI 0DQDJHPHQWIXQFWLRQVFDQEHHQWHUHGIURPWKH7RS0HQXVFUHHQXSRQVWDUWXSUHSUHVHQWDWLYHVFUHHQ RQWKHQH[WSDJHRUE\SUHVVLQJWKH³%ODQN.H\´ORZHUULJKWFRUQHUDQGWKHQXPEHU³´DWWKHVDPH WLPH ,WZLOODVN\RXWRHQWHUWKH,'DQG3DVVZRUG3UHVV ,WZLOOWKHQWDNH\RXWRWKHPDLQPDQDJHPHQWPHQX 6HOHFW3DVVZRUG0DLQWHQDQFH&KDQJH8VHU3DVVZRUG (QWHUWKHQHZSDVVZRUG21/<<RXDUHXVHUDQGDOUHDG\ORJJHGLQVRSXWWLQJKHUHLVQRWQHFHV VDU\7KHQHZSDVVZRUGFDQEHGLJLWV'RQRWXVHELUWKGD\VWHOHSKRQHQXPEHUVVRFLDOVHFXULW\ QXPEHUVRUWKHOLNH0DNHLWVRPHWKLQJ\RXFDQUHPHPEHUEXWQRWVRGLI¿FXOWDVWREHIRUJRWWHQ*XDUG LWFORVHO\,IWKHSDVVZRUGLVORVWRUIRUJRWWHQ7ULWRQFDQSURYLGHDUHVHWIRUDFKDUJH ,I\RXZLOOKDYHDGGLWLRQDOSHRSOHWKDWZLOOEHDFFRPSOLVKLQJFORVHVDQGUHSOHQLVKLQJFDVVHWHV\RXPD\ DGGWKHPDQGSURYLGHSDVVZRUGVKHUH1HZXVHUVFDQEH,' 5HIHUWRGRFXPHQW&RQ¿JXUDWLRQ0DQXDOIRUIXUWKHUWHUPLQDOVHWXSSURFHGXUHV 7DNHWKLVRSSRUWXQLW\WRFKDQJHWKHORFNFRPELQDWLRQ5HIHUWR$SSHQGL[&RU'IRU\RXUORFN7KH VDPHUXOHVIRUFRPELQDWLRQQXPEHUVDVSDVVZRUGVDSSO\ 02'(/5/;86(50$18$/ ,I\RXGRQRWVHOHFWDPHQXFKRLFHZLWKLQVHFRQGVWKHWHUPLQDOZLOODXWRPDWLFDOO\GHIDXOWWRWKH&XV WRPHU:HOFRPHVFUHHQDEHQH¿WRIWKLVIHDWXUHLVWKDWLQWKHHYHQWRIDSRZHULQWHUUXSWLRQWKHWHUPLQDO ZLOODXWRPDWLFDOO\EHJLQDFFHSWLQJFXVWRPHUWUDQVDFWLRQVVKRUWO\DIWHUSRZHULVUHVWRUHG )LJXUH7RSPHQXVFUHHQ &86720(575$16$&7,216 $FXVWRPHUEHJLQVDWUDQVDFWLRQE\VHOHFWLQJIURPWKH&XVWRPHUVFUHHQRSWLRQV7KH\LQVHUWWKHLU$70 FDUGLQWRWKHFDUGUHDGHURIWKHWHUPLQDO7KHFDUGPXVWEHLQVHUWHGVRWKDWWKHPDJQHWLFVWULSHFDQEH VFDQQHGE\WKHFDUGUHDGHU¶VVHQVRU,IWKHFXVWRPHULQVHUWVWKHFDUGLQFRUUHFWO\DZDUQLQJPHVVDJHZLOO EHGLVSOD\HGDFFRPSDQLHGE\VHYHUDOEHHSVWRJHWWKHLUDWWHQWLRQ ,IWKHUHLVDSUREOHPUHDGLQJDFDUGPDNHVXUHWKHFXVWRPHULVLQVHUWLQJWKHFDUGFRUUHFWO\0RVWSUREOHPV DUHWKHUHVXOWRILQVHUWLQJWKHFDUGLQFRUUHFWO\ 2QFHWKHFDUGKDVEHHQUHDGLQVXFFHVVIXOO\DVXUFKDUJHPHVVDJHLIDSSOLFDEOHPD\EHGLVSOD\HGWKH VXUFKDUJHPHVVDJHPD\EHGLVSOD\HGDWWKHHQGRIWKHFXVWRPHU¶VWUDQVDFWLRQVHOHFWLRQ7KHFXVWRPHU PXVWWKHQHQWHUWKHLUVHFUHW3HUVRQDO,GHQWL¿FDWLRQ1XPEHU3,1FRGH2QFHWKH3,1KDVEHHQHQWHUHG WKHWUDQVDFWLRQW\SHDQGDFFRXQWDUHVHOHFWHGDQGWKHGHVLUHGDPRXQWRIWKHWUDQVDFWLRQLIQHHGHG7KH WUDQVDFWLRQZLOOEHSURFHVVHGW\SLFDOO\LQDPDWWHURIVHFRQGV )LJXUHVKRZVKRZ$70WUDQVDFWLRQVDUHKDQGOHG,IWKHWUDQVDFWLRQZDVSURFHVVHGVXFFHVVIXOO\WKH FXVWRPHULVSURPSWHGWRUHWULHYHWKHUHTXHVWHGFDVKIRUZLWKGUDZDOWUDQVDFWLRQVDQGRUWKHDSSOLFDEOH WUDQVDFWLRQUHFHLSWDVQHHGHG,IWKHWUDQVDFWLRQZDVGHFOLQHGDVKRUWUHFHLSWLQGLFDWLQJWKHSUREOHPLV SULQWHG %$6,&23(5$7,21 )LJXUH$70WUDQVDFWLRQSURFHVVLQJ 7KH$70VHQGVWKHFXVWRPHUWUDQVDFWLRQUHTXHVWWRDSURFHVVRU$SURFHVVRULVD¿QDQFLDOLQWHUPHGL DU\VXFKDVDQ,QGHSHQGHQW6DOHV2UJDQL]DWLRQ,62EDQNRURWKHU¿QDQFLDOLQVWLWXWLRQWKDWSURYLGHV WUDQVDFWLRQSURFHVVLQJVHUYLFHVIRU$70V7KH$70PXVWEHVHWXSZLWKDSDUWLFXODUSURFHVVRUEHIRUH FXVWRPHUWUDQVDFWLRQVFDQWDNHSODFH 7KHSURFHVVRUURXWHVWKHWUDQVDFWLRQWRWKHDSSURSULDWH$70QHWZRUN$Q$70QHWZRUNLVDUHJLRQDOO\ RUQDWLRQDOO\RUJDQL]HGFOHDULQJKRXVHIRU¿QDQFLDOWUDQVDFWLRQVWKDWGHDOVGLUHFWO\ZLWKWKHDSSURSULDWH ¿QDQFLDOLQVWLWXWLRQVXFKDVWKHFXVWRPHU¶VEDQNRUFUHGLWFDUGFRPSDQ\LQRUGHUWRFRPSOHWHWKHWUDQVDF WLRQ7KHSURFHVVRUZLOOVHOHFWWKHDSSURSULDWH$70QHWZRUNWRXVHEDVHGRQIDFWRUVVXFKDVWKHW\SHRI $70RUFUHGLWFDUGXVHGORFDWLRQRIWKHFXVWRPHU¶VEDQNRURWKHUFRQVLGHUDWLRQV7KHWUDQVDFWLRQPD\ EHWUDQVIHUUHGEHWZHHQVHYHUDOQHWZRUNVEHIRUHXOWLPDWHO\UHDFKLQJWKHFXVWRPHU¶VEDQNRUFUHGLWFDUG FRPSDQ\ 7KH$70QHWZRUNURXWHVWKHWUDQVDFWLRQWRWKHDSSURSULDWHEDQNRURWKHULQVWLWXWLRQFRQ¿UPVVXFFHVVIXO FRPSOHWLRQRIWKHWUDQVDFWLRQDQGVHQGVDFRQ¿UPDWLRQPHVVDJHEDFNWRWKHSURFHVVRU,IWKHUHTXHVWZDV IRUDFDVKZLWKGUDZDODQ(OHFWURQLF)XQGV7UDQVIHU()7WDNHVSODFHWRGHELWWKHIXQGVLQFOXGLQJDQ\ VXUFKDUJHIHHLIDSSOLFDEOHIURPWKHFXVWRPHU¶VEDQNDFFRXQWDQGFUHGLWWKHIXQGVWRWKHSURFHVVRU¶V EDQNDFFRXQW 7KHSURFHVVRUIRUZDUGVDFRQ¿UPDWLRQPHVVDJHWRWKH$70DQGDQDXWKRUL]DWLRQWRGLVSHQVHFXUUHQF\ LQWKHFDVHRIDFDVKZLWKGUDZDO7KH$70GLVSHQVHVWKHUHTXHVWHGFXUUHQF\LIQHFHVVDU\DQGSURYLGHV WKHFXVWRPHUZLWKDSULQWHGUHFHLSWDVDUHFRUGRIWKHWUDQVDFWLRQ 7KHSURFHVVRUFUHGLWVWKHPHUFKDQW¶VDFFRXQWIRUWKHDPRXQWRIDQ\FDVKZLWKGUDZDOVSOXVVXUFKDUJH IHHVLIFROOHFWHGW\SLFDOO\E\WKHHQGRIWKHQH[WEXVLQHVVGD\ 02'(/5/;86(50$18$/ 92,&((1$%/('75$16$&7,21 7KH WHUPLQDO SURYLGHV YRLFH IHHGEDFN YLD DQ LQWHJUDWHGRXWSXW MDFN HQDEOLQJVLJKWLPSDLUHGXVHUV WR SOXJLQDVHWRIKHDGSKRQHVDQGUHFHLYHVSRNHQLQVWUXFWLRQVWRDVVLVWWKHPLQXVLQJWKH$70)LJXUH $ UDLVHG V\PERO KHOSV D XVHU ORFDWH WKH KHDGSKRQH MDFN7KH$70 ZLOO DXWRPDWLFDOO\ GHWHFW ZKHQ D KHDGSKRQHKDVEHHQSOXJJHGLQWRWKHMDFNDQGZLOOLPPHGLDWHO\VZLWFKLQWRYRLFHPRGH,QLWLDOO\DEULHI VSRNHQWXWRULDOZLOORULHQWDWHWKHFXVWRPHUWRWKH$70FRQWUROSDQHOLQWHUIDFH2QFHWKHFXVWRPHUEHJLQV DWUDQVDFWLRQVSRNHQSURPSWVZLOOSURYLGHIHHGEDFNDQGJXLGHWKHFXVWRPHUWKURXJKWKHVXFFHVVIXODF FRPSOLVKPHQWRIWKHWUDQVDFWLRQ )LJXUH+HDGSKRQHMDFNORFDWLRQ 7\SLFDO 6'' 6(&7,21 &$66(77(&/26( &$6+5(3/(1,6+0(17 6&'8 02'(/5/;86(50$18$/ ,1752'8&7,21 7KHSXUSRVHRIWKLVVHFWLRQRIWKHPDQXDOLVWRGHVFULEHWKHSURFHGXUHVIRUFDVVHWWHFORVLQJDQGUHSOHQLVK PHQW,QIRUPDWLRQFRQFHUQLQJQRWHKDQGOLQJDQGTXDOLW\LVVXHVDUHH[SODLQHGZKHUHDSSURSULDWH ',63(16,1*0(&+$1,606 3/($6(5($' 7KH0RGHO5/;SURGXFWLRQXQLWVDUHHTXLSSHGZLWKWKH6&'8RU6''GLVSHQVHU $OVRWKHUHZLOORQO\EHRQHVW\OHRIFDELQHWRIIHUHGZKLFKFDQDFFRPPRGDWHWKHGLVSHQVHUVPHQWLRQHG DERYH &XUUHQF\FDSDFLW\GHSHQGVXSRQWKHGLVSHQVHUPHFKDQLVPLQVWDOOHGLQWKH$70EXWLVDOVRDIIHFWHGE\ QRWHTXDOLW\DQGWKLFNQHVV7\SLFDOFDSDFLWLHVDUHSURYLGHGLQWKHIROORZLQJWDEOH'2127EHWHPSWHGWR RYHU¿OOWKHFDVVHWWH 5/;',63(16,1*0(&+$1,60 ',63(16(5 &$66(77( 6&'8 6'' 6LQJOH 6LQJOH 5(&200(1'(' 0$;,080&$3$&,7< 10001RWHV 1RWHV 5(-(&7('127( &$3$&,7< /HVVWKDQ /HVVWKDQ 7KHGLVSHQVLQJPHFKDQLVPGHOLYHUVWKHDSSURSULDWHQXPEHURIQRWHVIURPWKHQRWHFDVVHWWHWRIXO¿OOWKH FXVWRPHU¶VZLWKGUDZDOUHTXHVW7KHSXUSRVHRIWKHUHMHFWDUHDRUFDVVHWWHLVWRDFFHSWDQGKROGQRWHVWKDWKDYH EHHQWUDQVIHUUHGIURPWKHQRWHFDVVHWWHEXWQRWGLVSHQVHG6RPHVLWXDWLRQVWKDWFRXOGFDXVHWKHPHFKDQLVP WRUHMHFWQRWHVDUH 0XOWLSOHQRWHVVWXFNWRJHWKHU 1RWHZLGWKWRRVKRUWRUORQJ 2WKHUFRQGLWLRQVWKDWFRXOGFDXVHDUHMHFWDUHGHVFULEHGLQWKHQH[WVHFWLRQ1RWH&RQGLWLRQ &$87,21 '21275(&<&/(5(-(&7('127(6,172$&$66(77( 'RLQJVRFRXOGFDXVHPRUHUHMHFWVDQGRUFXUUHQF\MDPV &$66(77(&/26(&$6+5(3/(1,6+0(17 127(&21',7,21 7KHQXPEHURIUHMHFWVFDQEHGLUHFWO\LQÀXHQFHGE\WKHWHFKQLTXHXVHGWRORDGWKHFDVVHWWHVDQGWKHTXDO LW\RIWKHFXUUHQF\1RWHVORDGHGLQWRWKHPHFKDQLVPFDVVHWWHVPXVWEHLQ³¿W´FRQGLWLRQLIDKLJKOHYHORI SHUIRUPDQFHORZUHMHFWDQGIDLOXUHUDWHLVH[SHFWHGIURPWKHXQLW³)LW´QRWHVDUHGH¿QHGDVWKRVHWKDWGR QRWSRVVHVVDQ\RIWKHGHIHFWVOLVWHGKHUH 86('127('()(&76 Â$GKHVLYHRU³VWLFN\´VXEVWDQFHVRQWKHVXUIDFHRIWKHSDSHU Â7HDUVH[WHQGLQJPRUHWKDQ´IURPWKHHGJHRIWKHFXUUHQF\ Â7HDUVKROHVRUPLVVLQJVHFWLRQVLQWKHERG\RIWKHFXUUHQF\ Â7DSHRQWKHVXUIDFHRIWKHFXUUHQF\XVHGIRUUHSDLULQJSDWFKLQJRUDQ\RWKHUSXUSRVH Â6WDSOHVSLQVRUDQ\RWKHUIRUHLJQERG\DWWDFKHGWRWKHQRWHV Â&RUQHUIROGVRIDVL]HJUHDWHUWKDQ´RQHLWKHUD[LV Â7ZRRUPRUHQRWHVMRLQHGE\DQ\PHDQV Â([FHVVLYHO\FUXPSOHGRUFULQNOHGQRWHV 35(3$5,1*127(6 8VHWKHIROORZLQJSURFHGXUHVWRSUHSDUHQRWHVEHIRUHLQVHUWLQJWKHPLQWRDQRWHFDVVHWWH 35(3$5,1*86('127(6 Â5HPRYHWKHEDQGDURXQGHDFKEXQGOHRIQRWHV Â5HPRYHIRUHLJQREMHFWVHJSLQVSDSHUFOLSVFUXPEV HWF Â5HPRYHWRUQRUYHU\ZRUQQRWHV Â6WUDLJKWHQDQ\IROGHGQRWHV )LJXUH5HPRYLQJ EDQG )LJXUH5HPRYLQJ WRUQZRUQQRWHV 1(:2581&,5&8/$7('127(6 5HPRYHWKHEDQGDURXQGHDFKEXQGOHRIQRWHV6HSDUDWHWKHQRWHVIURPHDFKRWKHUE\ Â6WULNLQJWKHEXQGOHKDUGDJDLQVWWKHHGJHRIDWDEOHRUVLPLODUREMHFW Â)OLSSLQJWKURXJKHDFKEXQGOHRIQRWHVLQERWKGLUHFWLRQVDWHDFKHQG Â8VLQJDQRWHFRXQWHU 02'(/5/;86(50$18$/ &$66(77(&/26(352&('85(6 )ROORZ$FFHVVLQVWUXFWLRQVWRHQWHU0$1$*(0(17)81&7,2166HOHFW7(50,1$/&/26()81&7,2166HOHFW &$66(77(&/26( n6HOHFW FDVVHWWH WR &ORVH$ FKHFN PDUN LGHQWL¿HV ZKLFK FDVVHWWH LV VHOHFWHG ³$´ LV VHOHFWHGE\GHIDXOW3UHVV(QWHU! o$ &ORVH UHSRUW LV GLVSOD\HG WR EH SULQWHG RU VDYHG 7KLV RSHUDWLRQ ZLOO UHVHW WKH QXPEHU RI ELOOV LQ WKH FDVVHWWH WR =(52 3UHVV (QWHU! q$IWHU FDVVHWWH KDV EHHQ UHLQVHUWHG LQ WKH GLVSHQVHUSUHVV(QWHU! r3ODFHVHOHFWHGFDVVHWWH,16(59,&(³$´ZLOO EHLQVHUYLFH3UHVV(QWHU! s(QWHU&DVVHWWH4XDQWLW\WRWDOQXPEHURIQRWHV 127 YDOXH IRU WKH VHOHFWHG FDVVHWWH 3UHVV (QWHU!WRDFFHSWHQWU\ p5HPRYHDQG5HSOHQLVKWKHVHOHFWHGFDVVHWWH 3URFHGXUHVIRUFDVVHWWHUHSOHQLVKPHQWDUH RQWKHIROORZLQJSDJHV t$ 7ULDO &DVVHWWH &ORVH UHSRUW DXWRPDWLFDOO\ LVGLVSOD\HGWREHSULQWHGRUVDYHG3ULQWDQG UHWDLQDFRS\IRUVWDUWLQJSRLQWUHIHUHQFH3UHVV (QWHU!WRUHWXUQWR&ORVHIXQFWLRQV &$66(77(&/26(&$6+5(3/(1,6+0(17 5HSOHQLVK&DVVHWWH 6'&8 8QORFNDQGRSHQWKHVHFXULW\FDELQHWGRRU 7RUHPRYHWKHQRWHWUD\JUDVSWKHWUD\KDQGOHOLIWVOLJKWO\DQGVOLGHWKHWUD\RXWRI WKHPHFKDQLVP3ODFHWKHQRWHWUD\RQDÀDWOHYHOVXUIDFH8VHWKHVHFXULW\NH\WR XQORFNWKHFDVVHWWHDQGRSHQWKHOLG 5HPRYHDQ\UHMHFWHGQRWHV7KHUHMHFWFRPSDUWPHQWLVORFDWHGDERYHWKHFDVVHWWH 5HPRYLQJ QRWH WUD\ IURP WKH GLVSHQVLQJ PHFKDQLVP 5HPRYLQJUHMHFWHGQRWHV 1RWH<RXPD\ZLVKWRUHFRUGWKHQXPEHURIQRWHVUHPRYHGIURPWKHUHMHFWFRPSDUW PHQWIRUXVHZKHQEDODQFLQJWKHQRWHWUD\DJDLQVWWKHFDVVHWWHGD\FORVHUHFRUGV /RDGLQJWKH1RWH7UD\ 3XOOWKHSDFNHUSODWHWRWKHUHDURIWKHWUD\WRZDUGWKHKDQGOH(QVXUHWKHSDFNHU SODWHLVIXOO\EDFN0DLQWDLQSUHVVXUHRQWKHSDFNHUSODWHDVQHHGHGZKLOHORDGLQJ QRWHV &RXQWWKHQXPEHURIELOOVWKDWUHPDLQLQWKHFDVVHWWHLIDQ\1H[WFRXQWWKHQXPEHU RIELOOVWKDWDUHEHLQJDGGHGLQWRWKHFDVVHWWH $GGWKHQXPEHURIELOOVEHLQJSODFHGLQWR WKHFDVVHWWHWRWKHQXPEHUWKDWUHPDLQHG 7KH³7RWDO´QXPEHURIWKHVHELOOVZLOOEH HQWHUHG LQ WKH ³(QWHU &DVVHWWH 4XDQWLW\´ RSWLRQ /RDGQRWHWUD\ZLWKFXUUHQF\ 02'(/5/;86(50$18$/ 3ODFHWKHFXUUHQF\LQWRWKHFDVVHWWH$OORZDWOHDVWRQHLQFKRIFOHDUDQFHEHWZHHQWKH SDFNHUSODWHZKHQLWLVIXOO\UHWUDFWHGDQGWKHFXUUHQF\7KLVZLOODOORZWKHSDFNHU SODWHWRFRPSUHVVWKHFXUUHQF\ 5HOHDVHWKHSDFNHUSODWHDJDLQVWWKHQRWHV &ORVHWKHOLGDQGORFNZLWKWKHVHFXULW\NH\ 8VLQJWKHKDQGOHVOLGHWKHQRWHWUD\LQWRWKHGLVSHQVLQJPHFKDQLVP0DNHVXUHWKH QRWHWUD\LVIXOO\LQVHUWHG (QVXUHWKH5HMHFWGRRULVFORVHG&ORVHDQGORFNWKHVHFXULW\FRQWDLQHU &$66(77(&/26(&$6+5(3/(1,6+0(17 5HSOHQLVK&DVVHWWH 6'' 8QORFN2SHQ WKH GLVSHQVHU VHFXULW\ GRRU *UDVS WKH FDVVHWWH KDQGOH DQG UHPRYHWKHFDVVHWWH &DVVHWWH0867%(35,0('ZLWKWKHFDVVHWWHNH\EHIRUHLQVHUWLQJRQWKHORDGLQJ WUD\,QVHUWNH\DQGWXUQFORFNZLVHWRVKRZ*5((1LQGLFDWRULQZLQGRZ *UHHQZLQGRZ &DVVHWWH3ULPHG :$51,1* , ) 5(', 6 , 1 ' , & $7 ( ' , 1 7 + ( : , 1 ' 2 : 2 1 7 + ( 6 , ' ( 2 ) 7 + ( & 8 5 5 ( 1 & < & $ 6 6 ( 7 7 ( 1(9(5 $7 7 ( 0 3 7 72 , 1 6 ( 57 7 + ( & $ 6 6 ( 7 7 ( , 1 7 2 7 + ( ' , 6 3 ( 1 6 ( 5 2 5 7 + ( / 2 $ ' , 1 * 7 5 $< 6OLGH FDVVHWWH RQWR WKH ORDGLQJ WUD\ /LIW OLG WR H[SRVH WKH UHMHFW WUD\ 5HPRYH DQ\ UHMHFWHGQRWHV '2127UHF\FOHUHMHFWHGQRWHV &DVVHWWH RQ / R D G L Q J 7UD\ /LG RSHQ WR H[SRVH5HMHFW %LQ 02'(/5/;86(50$18$/ /LIWWKHUHMHFWWUD\3XVKWKHSDFNHUSODWH WRUHDURIFDVVHWWHDQGODWFKLQSODFH &RXQWWKHQXPEHURIELOOVWKDWUHPDLQLQWKHFDVVHWWHLIDQ\&RXQWWKHQXPEHURIELOOV WKDWDUHEHLQJDGGHGWRWKHUHPDLQLQJQRWHV7KH727$/RIWKHVHDPRXQWVZLOOEHHQWHUHG LQWKH³(QWHU&DVVHWWH4XDQWLW\´SURPSWIRU&DVVHWWH&ORVHSURFHGXUH 3ODFHFXUUHQF\LQWKHFDVVHWWHDQGVORZO\ UHOHDVH WKH KROGEDFN ODWFK DOORZLQJ WKH SDFNHUSODWHWRPRYHIRUZDUGDJDLQVWWKH QRWHV&ORVHWKHFDVVHWWHOLG 5HPRYH FDVVHWWH IURP ORDGLQJ WUD\ ,QVHUW WKH FDVVHWWH NH\ DQG ³35,0(´ WKH FDVVHWWH ³*UHHQ´ LQGLFDWRU ,QVWDOO WKH FDVVHWWHLQWRWKHGLVSHQVHU &ORVHDQGORFNWKHVHFXULW\FRQWDLQHU 6(&7,21 *(1(5$/0$,17(1$1&( 02'(/5/;86(50$18$/ ,1752'8&7,21 7KLVVHFWLRQRIWKHPDQXDOFRYHUVSUHYHQWLYHDQGFRUUHFWLYHPDLQWHQDQFHSURFHGXUHVDSSURSULDWHIRUXVHU SHUVRQQHO7KHIROORZLQJDUHDVDUHFRYHUHG 5(3/(1,6+,1*5(&(,373$3(5'HVFULEHVKRZWRUHSODFHDVSHQWUHFHLSWSDSHUUROO &/($1,1*7+((1&/2685(7KHSURSHUZD\WRFOHDQWKH$70KRXVLQJ &$5'5($'(5&/($1,1*7KHUHFRPPHQGHGFDUGUHDGHUFOHDQLQJWHFKQLTXH ,PSRUWDQW 2QO\TXDOL¿HGVHUYLFHSHUVRQQHODUHDXWKRUL]HGWRUHSDLURU VHUYLFHWKHWHUPLQDO6KRXOGDPDOIXQFWLRQRFFXU'2127 DWWHPSWWRVHUYLFHWKHXQLW\RXUVHOI&RQWDFW\RXU7ULWRQFHUWL ¿HGVHUYLFHSURYLGHU 5(3/(1,6+,1*7+(5(&(,373$3(5 127(7KLVRSHUDWLRQPXVWEHFRPSOHWHGZLWKWKH$&SRZHUDSSOLHGWRWKH$70 2SHQWKHFRQWUROSDQHOE\XQORFNLQJWKHWRSHQFORVXUHDQGSXOOLQJWKHGRRUDQGWUD\IRUZDUG ,ISDSHUUHPDLQVRQWKHUROOPRYHWKH*UHHQOHYHUGRZQWRUHOHDVHWKHSULQWKHDG&DUHIXOO\SXOOWKH H[FHVVSDSHUEDFNWKURXJKWKHSULQWHU &DXWLRQ '2 127 SXOO UHFHLSW SDSHU EDFNZDUGV WKURXJK WKH SULQWHU ZLWKWKH*5((1OHYHULQWKH83 SRVLWLRQ 7KLV PD\ OHDYH SDSHU IUDJPHQWV WKDW FDQ FDXVH SDSHU MDPV *(1(5$/0$,17(1$1&( 5HWXUQWKH*UHHQOHYHUEDFNWRWKH8SSRVLWLRQ HQVXUHLWFOLFNVVHFXUHO\<RXPD\SXVKXSRQ WKHSULQWUROOHUWRDLGLQWKLVRSHUDWLRQ 5HPRYHWKHSDSHUDQGVSRROIURPWKHSDSHUEUDFNHW 5HPRYHWKHWDEVHFXULQJWKHHQGRIWKHQHZSDSHUUROOWRLWVHOI8VHVFLVVRUVWRFXWRIIDOORIWKHSDSHU XSWRDQGLQFOXGLQJWKHJOXHWDESURGXFLQJDFOHDQVTXDUHFXW 5HPRYHWKHSODVWLFVSLQGOHIURPWKHROGSDSHUUROODQGLQVHUWLQWRWKHQHZUROORISDSHU8VHDLQFKUROO RIPPZLGHWKHUPDOSDSHUSULQWHUDSSOLFDEOHZLWKDVPDOOFHQWHU5HSODFHPHQWSDSHULVDYDLODEOH IURP7ULWRQ %HVXUHWKHVSLQGOHLVLQVHUWHGVRWKDWWKHSDSHUZLOOIHHGIURPWKH%27720RIWKHUROOZKHQLWLV LQVWDOOHGRQWKHSDSHUEUDFNHWDQGIDFLQJWKHUHDUZKHUHLWZLOOFXUOEDFNXQGHUWKHWHQVLRQEDU 5HDU )URQW 3DSHU*XLGH 3ODFHWKHQHZUROOEDFNRQWKHSDSHUEUDFNHWE\VOLGLQJWKHVPDOOVORWWHGHQGRIWKHVSLQGOHRQWRWKH VORWLQWKHEUDFNHWDVVKRZQ1RWHWKDWWKHSDSHUIHHGVIURPWKH%27720RIWKHUROOWRZDUGWKH UHDU 02'(/5/;86(50$18$/ )HHGWKHHQGRIWKHSDSHURYHUWKHVWDWLRQDU\ EDU DURXQG DQG XQGHU WKH WHQVLRQ EDU DQG LQWRWKH3ULQWHU3DSHU*XLGH,OOXVWUDWLRQIURP VWHS3XVKWKHSDSHUIRUZDUGLQWRWKHSULQWHU 7KH SULQWHU ZLOO DFWLYDWH DQG DXWRPDWLFDOO\ IHHGWKHSDSHUWKURXJKWKHSULQWHUDQGSUHVHQW DSSUR[LPDWHO\LQFKHVRISDSHURXWWKHIURQW 127( $ QHZ IXOO UROO RI SDSHU ZLOO EH KHDY\HQRXJKWRSURGXFHDORRSDVVKRZQ DWWKHULJKW7KLVLVQRUPDO$VWKHUROOGH SOHWHVWKHORRSZLOOJHWVPDOOHUDQGHYHQ WXDOO\FRQWDFWWKH7HQVLRQ%DU7KLVYLHZ IURPWKHRSSRVLWHVLGHIRUFODULW\ $GLDJUDPLVSRVWHGRQWKHOHIWVLGHRIWKH SULQWHU 6WDWLRQDU\%DU 7HQVLRQ%DU *(1(5$/0$,17(1$1&( &/($1,1*7+((1&/2685( 7KH$70IURQWSDQHOLVKLJKO\GXUDEOHUHVLVWLQJVFUDWFKHVDQG¿QJHUVPXGJHV+RZHYHURFFDVLRQDOFOHDQ LQJRIWKHIURQWSDQHODQGWKHSODVWLFHQFORVXUHPD\EHGHVLUDEOH$VRIWGU\RUVOLJKWO\GDPSFORWKPD\EH XVHGIRUFOHDQLQJ)RUEHVWUHVXOWVXVHDZHDNVROXWLRQRIDPLOGGHWHUJHQWDQGZDWHU &DXWLRQ $YRLGXVLQJDEUDVLYHFOHDQHUVRQDQ\VXUIDFHRIWKHWHUPLQDO 'RQRWVSUD\OLTXLGFOHDQHUGLUHFWO\RQWKHXQLWLQVLGHRURXW &/($1,1*7+(',63/$< 7KH/LTXLG&U\VWDO'LVSOD\/&'RQWKHIURQWRIWKH$70KDVDSODVWLFSURWHFWLYHZLQGRZWKDWVKRXOGEH FOHDQHGRQO\ZLWKDVRIWFORWKGDPSHQHGZLWKDZHDNVROXWLRQRIDPLOGGHWHUJHQWDQGZDWHU &DXWLRQ 'R QRW XVH DQ\ DEUDVLYH FOHDQHUV RQ WKH ZLQGRZ DV LW ZLOO VFUDWFK'RQRWVSUD\OLTXLGVRQWRWKHVFUHHQDVWKH\PD\UXQ GRZQLQVLGHWKHXQLWDQGFDXVHGDPDJH &$5'5($'(5&/($1,1* 6SHFLDOFOHDQLQJFDUGV31DUHDYDLODEOHIRUSURSHUPDLQWHQDQFHRIWKHFDUGUHDGHU7KH UHDGHUVKRXOGEHFOHDQHGDWOHDVWRQFHDPRQWKE\LQVHUWLQJDQGUHPRYLQJDFOHDQLQJFDUGDVVKRZQEHORZ ,WPD\EHQHFHVVDU\WRFOHDQWKHFDUGUHDGHUPRUHRIWHQLQORFDWLRQVWKDWVHHKHDY\XVDJH 5HPRYHWKHFOHDQLQJFDUGIURPWKHVHDOHGSRXFK ,QVHUWWKHFOHDQLQJFDUGLQWRWKHFDUGUHDGHUDQGPRYHLQDQGRXWVHYHUDOWLPHV 5HPRYHWKHFOHDQLQJFDUGDQGWXUQRYHUWRXVHRWKHUVLGH ,QVHUWDJDLQVHYHUDOWLPHV 5HPRYHFOHDQLQJFDUGDQGGLVFDUG7KH\DUHGHVLJQHGWREHXVHGRQO\RQFH 02'(/5/;86(50$18$/ 7+,63$*(,17(17,21$//</()7%/$1. Appendix A Software License Agreement Compliance / Emission Statements A-1 Appendix A Automated Teller Machine (“ATM”) Software End-User Agreement IMPORTANT: PLEASE READ CAREFULLY: BY INSTALLING OR OTHERWISE USING THE ATM, YOU (AS THE OWNER OR LESSEE OF THE ATM). AGREE TO BE BOUND BY THE FOLLOWING TERMS AND CONDITIONS, INCLUDING, WITHOUT LIMITATION, THE WARRANTY DISCLAIMERS, LIMITATIONS OF LIABILITY AND TERMINATION PROVISION WHICH APPLY TO YOUR USE OF THE ATM SOFTWARE CONTAINED IN THIS ATM AND IS HEREBY LICENSED BY TRITON SYSTEMS OF DELAWARE, INC. (“Triton”) TO YOU PURSUANT TO THIS AGREEMENT. IF YOU DO NOT AGREE TO OR ARE NOT WILLING TO BE BOUND BY THE TERMS AND CONDITIONS OF THIS AGREEMENT, DO NOT INSTALL OR OTHERWISE USE THIS ATM AND PROMPTLY CONTACT YOUR VENDOR. INSTALLING OR OTHERWISE USING THE ATM INDICATES THAT YOU ACCEPT THESE TERMS. This ATM is manufactured by, and utilizes proprietary software owned by Triton Systems of Delaware, Inc. and/or its suppliers. All right, title and interest in and to all component software installed or embedded in the ATM (“ATM Software”) including all associated intellectual property rights, are and will remain the property of Triton and/or its suppliers. LICENSE: Triton grants you a limited, nonexclusive license to use the ATM Software but only in connection with the operation of this ATM subject to the terms and restrictions set forth in this License Agreement. You are not permitted to use the ATM Software in any manner not expressly authorized by this License. You acknowledge and agree that ownership of the ATM Software and all subsequent copies thereof regardless of the form or media are held by Triton or its suppliers. The software is licensed for use on this specific Triton ATM product and may not be used on any other product. Otherwise, the supporting documentation, if any, may be copied only as essential for backup or archive purposes in support of your use of the ATM. You must reproduce and include all copyright notices and any other proprietary rights notices appearing on any copies that you make. ASSIGNMENT: NO REVERSE ENGINEERING: You may transfer the ATM Software to another party but only in connection with a transfer of all your right, title and interest in and to this ATM and if such party accepts the terms and conditions of this License Agreement. If you transfer the ATM, you must at the same time transfer the supporting documentation, if any, to the same party or destroy any such materials not transferred. Modification, reverse engineering, reverse compiling, or disassembly of the ATM and/or the ATM Software is expressly prohibited. A-2 Software License Agreement / Compliance/Emission Statements DISCLAIMER OF WARRANTIES AND LIMITATION OF DAMAGES TO THE EXTENT PERMITTED BY LAW, THIS ATM SOFTWARE, INCLUDING ALL INCORPORATED THIRD PARTY SOFTWARE, AND DERIVATIVES IS PROVIDED, “AS IS”. TRITON MAKES NO REPRESENTATIONS WITH RESPECT TO, AND DOES NOT WARRANT THE PERFORMANCE OR RESULTS YOU OR YOUR CUSTOMERS MAY OBTAIN BY USING THE ATM. TRITON SPECIFICALLY DISCLAIMS ANY AND ALL WARRANTIES, EXPRESS, IMPLIED OR STATUTORY, INCLUDING WITHOUT LIMITATION, WARRANTIES OF QUALITY, PERFORMANCE, NONINFRINGEMENT, AND MERCHANTABILITY OR FITNESS FOR ANY PARTICULAR PURPOSE. TRITON MAKES NO REPRESENTATIONS OR WARRANTIES AND ASSUMES NO OBLIGATIONS TO YOU OR YOUR CUSTOMERS WITH RESPECT TO ANY TRANSACTION OR SERVICES ACCESSED AND/OR UTILIZED IN CONSUMER-INITIATED TRANSACTIONS MADE FROM THIS ATM. IN NO EVENT WILL TRITON, ITS AFFILIATES, DIRECTORS, OFFICERS, EMPLOYEES, AGENTS OR SUPPLIERS BE LIABLE TO YOU UNDER ANY THEORY OF TORT, CONTRACT, STRICT LIABILITY OR OTHER LEGAL OR EQUITABLE THEORY FOR ANY PUNITIVE, CONSEQUENTIAL, INCIDENTAL, SPECIAL OR SIMILAR DAMAGES, INCLUDING ANY LOSS PROFITS OR LOST SAVINGS, EVEN IF A TRITON AGENT OR REPRESENTATIVE HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES, OR FOR ANY CLAIM BY ANY THIRD PARTY. YOUR SOLE REMEDY AGAINST TRITON FOR DEFECTIVE PERFORMANCE OF THE ATM SOFTWARE WILL BE LIMITED EXCLUSIVELY TO REPAIR OR REPLACEMENT OF THE ATM AND/OR THE ATM SOFTWARE, AT TRITON’S SOLE DISCRETION. Any warranty pertaining to the ATM, its mechanical components exclusive of the ATM software, shall be governed and controlled by any warranty given to you by Triton in a separate document accompanying this ATM. The foregoing limitation of liability and exclusion of certain damages will apply regardless of the success or effectiveness of other remedies. GOVERNING LAW: This License Agreement shall be governed by the laws of the State of Mississippi and by the laws of the United States, excluding their conflicts of laws principles. SEVERABILITY: In the event any provision of this License Agreement is found to be invalid, illegal or unenforceable, the validity, legality and enforceability of any of the remaining provisions shall not in any way be affected or impaired. ENTIRE AGREEMENT: This License Agreement and the accompanying Limited Warranty set forth the entire agreement between you and Triton, supersedes all prior agreements, whether written or oral, with respect to the ATM Software, and may be amended only in writing signed by both parties. A-3 Appendix A Compliance / Emission Statements DISCLAIMER The manufacturer of the Automated Teller Machine (ATM) product(s) described herein makes no representations or warranties, either expressed or implied, by or with respect to anything in this manual, and shall not be liable for any implied warranties of fitness for a particular purpose or for any indirect, special, or consequential damages. Information in this document is subject to change without notice and does not represent a commitment on the part of the manufacturer. Emissions (EMI) ** CAUTION ** (US Requirements) This device complies with Part 15 of the FCC rules. Operation is subject to the following two (2) conditions: 1) This device may not cause harmful interference. 2) This device must accept any interference received, including interference that may cause undesired operation. Changes or modifications not expressly approved by Triton Systems could void the regulatory compliance approval and the warranty. Use of this product in a manner other than those described in this manual may result in personal injury! Note: This equipment has been tested and found to comply with the limits for a Class A digital device pursuant to Part 15 of FCC rules. These limits are designed to provide reasonable protection against harmful interference when the equipment is operated in a commercial environment. This equipment generates, uses, and can radiate radio frequency energy and, if not installed and used in accordance with the instruction manual, may cause harmful interference to radio communications. Operation of this equipment in a residential area is likely to cause harmful interference in which case the user will be required to correct the interference at his own expense. Changes or modifications to this unit not expressly approved by the party responsible for compliance could void the user’s authority to operate the equipment. Canadian Requirements This digital apparatus does not exceed the Class A limits for radio noise emissions from digital apparatus set in the Radio Interference Regulations of the Canadian Department of Communications. This Class A digital apparatus complies with Canadian ICES-003. Le present appareil numerique n’emet pas de bruits radioelectriques depassant les limites applicables aux appareils numeriques de la Class A prescrites dans le Reglement sur le brouillage radioelectrique edicte par le ministere des Communications du Canada. Cet appareil numerique de la classe A est conforme a la norme NMB-003 Canada. UK / Australia / South Africa Requirements Warning: This is a Class A product. In a domestic environment, this product may cause radio interference in which case the user may be required to take adequate measures. A-4 Appendix B Warranty Service Statement B-1 Appendix B Warranty Statement Manufacturer warrants that the Products delivered to Distributor will perform in accordance with the Manufacturer’s published specifications, and as outlined in the Manufacturer’s booklet entitled “Thirteen Months Parts Only Limited Warranty” for thirteen months from date of shipment in Long Beach, MS. Distributor acknowledges that it has received a copy of such booklet, that it has read its entirety and that it understands and agrees with its contents. Manufacturer’s warranty shall not apply to any damage resulting from abuse, negligence, accident, or to any loss or damage to the products while in transit. Written notice and explanation of circumstances surrounding any claims that the goods have proved defective in material or workmanship shall be given promptly from the distributor to the manufacturer. No claim may be made, or action brought, by or through a distributor after the expiration of 14 months following any alleged breach of warranty. DISTRIBUTOR’S SOLE AND EXCLUSIVE REMEDY IN THE EVENT OF DEFECT IS EXPRESSLY LIMITED TO THE REPLACEMENT OR CORRECTION OF SUCH DEFECTIVE PARTS BY MANUFACTURER AT ITS ELECTION AND SOLE EXPENSE, EXCEPT THERE SHALL BE NO OBLIGATION TO REPLACE OR REPAIR ITEMS WHICH, BY THEIR NATURE, ARE EXPENDABLE. If Manufacturer is unable to replace or repair the defective parts, Manufacturer shall refund to Distributor that portion of the purchase price allocable pays to such goods. No representation or other affirmation of fact not set forth herein, including but not limited to statements regarding capacity, suitability for use, or performance of the goods, shall be or be deemed to be a warranty or representation by Manufacturer for any purpose, nor give rise to any liability or obligation of Manufacturer whatever. EXCEPT AS SPECIFICALLY PROVIDED IN THIS DOCUMENT, THERE ARE NO OTHER WARRANTIES EXPRESSED OR IMPLIED INCLUDING, BUT NOT LIMITED TO, ANY IMPLIED WARRANTIES OR MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURCHASE. LIMITATION OF LIABILITY IN NO EVENT SHALL MANUFACTURER BE LIABLE FOR LOSS OF PROFITS OR INCIDENTAL, INDIRECT, SPECIAL, CONSEQUENTIAL OR OTHER SIMILAR DAMAGES ARISING OUT OF ANY BREACH OF THIS CONTRACT OR OBLIGATIONS UNDER THIS CONTRACT. B-2 Warranty Statement Defense of Infringement Claims If notified promptly in writing of any action (and all prior claims relating to such action) brought against the Distributor based on a claim that Distributor’s use of the goods infringes a patent or other intellectual property right, and if given access by Distributor to any information distributor has regarding such alleged infringement, Manufacturer agrees to defend Distributor in such action at its expense and will pay any costs or damages finally awarded against Distributor in any such action, provided the Manufacturer shall have had sole control of the defense of any such action and all negotiations for its settlement or compromise. In the event that a final injunction shall be obtained against the Distributor’s use of the goods or any of their parts by reason of infringement of a patent or other intellectual property right or if in Manufacturer’s opinion the goods are likely to become the subject of a claim of infringement of a patent or other intellectual property right, Manufacturer will, at its option and at its expense, either procure for the Distributor the right to continue using the goods, replace or modify the same so they become non-infringing or grant the Distributor a credit for such goods as depreciated and accept their return. The depreciation shall be an equal amount per year over the lifetime of the goods as established by Manufacturer. Manufacturer shall not have any liability to the Distributor under any provision of this clause if any infringement, or claim thereof, is based upon: (i) the use of the goods in combination with other goods or devices which are not made by Manufacturer; (ii) the use of the goods in practicing any process; (iii) the furnishing to the Distributor of any information, date, service, or applications assistance; or (iv) the use of the goods with modifications made by the Distributor. The Distributor shall hold Manufacturer harmless against any expense, judgment or loss for infringement of any patent or other intellectual property right which results from Manufacturer’s compliance with the Distributor’s designs, specifications or instructions. No costs or expenses shall be incurred for the account of Manufacturer without the written consent of Manufacturer. THE FOREGOING STATES THE ENTIRE LIABILITY OF MANUFACTURER WITH RESPECT TO INFRINGEMENT OF PATENTS OR OTHER INTELLECTUAL PROPERTY RIGHT BY THE GOODS OR ANY PART THEREOF, OR BY THEIR OPERATION. B-3 Appendix B Interpretation and Other Parole Evidence This writing is intended by the parties as final expression of their agreement and is intended also as a complete and exclusive statement of the terms of their agreement. No course of prior dealing between the parties and no usage of the trade shall be relevant to supplement or explain any term used in these terms and conditions. Acceptance or acquiescence in a course of performance rendered under these terms and conditions shall not be relevant to determine the meaning of these terms and conditions even though the accepting or acquiescing party has knowledge of the performance and opportunity for objection. Whenever a term defined by the Uniform Commercial Code, as adopted in Mississippi, is used in these terms and conditions, the definition contained in the code is to control. Modifications These terms and conditions can be modified or rescinded only by writing signed by both the parties or their duly authorized agents. Waiver Ineffective No claim or right arising out of or relating to a breach of these terms and conditions can be discharged in whole or in part by a waiver or renunciation of the claim or right unless the waiver or renunciation is supported by consideration and is in writing signed by the aggrieved party. Waiver by either Manufacturer or Distributor of a breach by the other of any provision of these terms and conditions shall not be deemed a waiver of future compliance therewith, and such provisions shall remain in full force and effect. Statute of Limitations Any action by the Distributor or Manufacturer for breach of these terms and conditions must be commenced within one (1) year after the cause of action has accrued. Applicable Law These terms and conditions shall be governed by and construed in accordance with the provisions of the Uniform Commercial Code as adopted by the State of Mississippi. Bankruptcy In the event of any proceedings, voluntary or involuntary, in bankruptcy or insolvency by or against Distributor, or in the event of the appointment, with or without the Distributor’s consent, of an assignee for the benefit of creditors or of a receiver or of a liquidator, then Manufacturer shall be entitled to cancel any unfilled part of these terms and conditions without any liability whatsoever. Parts Only Limited Manufacturer’s Warranty Triton Systems of Delaware, Inc. warrants the components of each ATM, excluding software and related documentation, against any defect in materials and/or workmanship for a period of 13 months from the shipping date. If a component fails due to defects in materials and/or workmanship within the warranty period, Triton will furnish a new or refurbished component, at its discretion. Triton shall not be responsible for labor or other costs associated with installing the components and the failed component shall be returned to Triton at the purchaser’s expense. Triton shall not be responsible for misuse or abuse of a unit and any attempts to remove or deface the serial number or date code on a unit or any component thereof, or any attempt to repair a unit or to repair or replace any component by anyone other than a service technician authorized by Triton shall void this warranty. B-4 Warranty Statement Limited Warranty covers normal use. Triton does not warrant or cover damage: • occurring during shipment of the equipment or components from or to Triton’s facilities; • caused by accident, impact with other objects, dropping, falls, spilled liquids, or immersion in liquids; • caused by a disaster such as fire, flood, wind, earthquake, lightning, or other acts of God; • caused by failure to provide a suitable installation environment for the equipment, including but not limited to, faulty wiring in the building in which the equipment is installed, installation in a facility with uncontrolled environmental conditions, failure to provide a dedicated electrical circuit on which the equipment operates, and/or lack of proper earth grounding for the equipment; • caused by the use of the equipment for purposes other than those for which it was designed; • resulting from improper maintenance; • caused by any other abuse, misuse, mishandling, or misapplication. Under no circumstances shall Triton or its suppliers be liable for any special, incidental, or consequential damages based upon breach of warranty, breach of contract, negligence, strict liability, or any other legal theory. Such damages include, but are not limited to, loss of profits, loss of revenue, loss of data, loss of use of the equipment or any associated equipment, cost of capital, cost of substitute or replacement equipment, facilities or services, downtime, purchaser’s time, the claims of third parties, including customers, and injury to property. Disclaimer of Warranties The warranty stated above is the only warranty applicable to this product. All other warranties, expressed or implied (including all implied warranties of merchantability or fitness for a particular purpose or quality of service), are hereby disclaimed. No oral or written information, or advice given by Triton, its agents or employees shall create a warranty or in any way increase the scope of this warranty. Shipping Damage All equipment is shipped Free On Board (FOB), Triton’s facilities. The organization or individual who has purchased the equipment assumes responsibility for the equipment once it leaves Triton’s facilities. Should your equipment be damaged in the process of shipment or delivery to your place of destination, we recommend the following course of action: • If possible, call the shipping company before the driver leaves your delivery site. Make note of the damage on the “receipt of delivery” paperwork. If this is not possible, call them as soon as possible to report the damage. • Take photographs of the damaged packaging prior to opening the boxes. If this is not possible, make note of key points, such as whether the equipment is on a pallet, if the banding is intact, how the boxes are damaged, etc. Keep all of the packaging for inspection by the shipping company. • If you unpack the equipment, take photographs of the damaged equipment. If this is not possible, make note of the damages. • You must file a claim with the shipper for shipping damages immediately after reporting the damages. B-5 Appendix B Should you specify the carrier, we recommend that you explore with this chosen carrier the policies and procedures regarding shipping damage claims prior to selecting them as your preferred carrier. If the equipment receives structural damage and is in an un-installable condition, Triton will work with you to arrange for a replacement unit to be shipped as soon as possible. The purchaser will be billed for the replacement unit. Triton’s repair technicians will repair the damaged unit after it is returned to our facilities. We will credit the purchaser’s account for the full purchase price of the damaged unit, minus the cost of returning the unit to “like new” condition. Under no circumstances does Triton authorize anyone to complete structural damage repairs in the field. Therefore, we will not ship primary structural parts, such as a cabinet head or main cabinet body for repair in the field. Authorized Installation and Service Providers Triton utilizes several nationwide and regional authorized third party maintenance providers. Triton recommends all ATMs be installed and serviced by service technicians certified by Triton. This includes authorized third party service technicians and technicians who have been factory trained by Triton to service ATM equipment. Installation or repairs attempted by unauthorized service technicians may void the warranty or warranty claims denied on the product. Please contact Triton’s Technical Services department at (800) 259-6672 for a list of our third party service providers and/or to obtain information on the requirements and procedures for becoming a certified Triton service technician. Triton’s Technical Services Department The primary purpose of the Technical Services department is to provide assistance to customers in the operation, trouble shooting, and repair of equipment manufactured by Triton. A toll-free phone number (1-800-259-6672) is provided for convenience. The Technical Services department operates to serve our customers. The staff is trained to follow our policies and procedures to ensure fair and uniform treatment of all our customers. Automated Voice Mail System Our goal is to have a ‘live’ person answer 100% of all incoming calls (during regular support hours). On occasion, however, call loads may exceed the capacity of the staff. When this occurs, an automated voice mail system will answer the call, indicate to the caller that all Technical Support specialists are busy assisting others, and ask the caller to leave detailed information about the nature of the call. Should it become necessary to leave a voice mail message, the caller should state: • • • • • their name, the organization for which they work, the serial number of the equipment they are calling about, detailed description of the problem that they are experiencing, and phone number where they can be reached, including area code. As Technical Support specialists become available, they check for voice mail messages and return calls in the order in which they were received. By providing the information requested in the voice mail, the technician can be prepared when your call is returned. Triton asks you to be patient if you must leave voice mail and assures you that your call is important to us and that we will respond promptly. B-6 Warranty Statement Calls for Service or Repair Calls for service or repair will be accepted from authorized service technicians only. End users must contact either the sales organization that placed the equipment or an authorized third party service organization to obtain service. The sections that follow describe the policies and procedures that relate to the repair and replacement of malfunctioning equipment. Questions on Operation of Equipment Technical support is available to owners of Triton equipment and to qualified service personnel. When calling for help with the configuration or operation of a Triton product, the caller must provide either positive identification as a service technician or the serial number of a Triton terminal. Technical support is provided during normal business hours for the life of the product. When calling for help with an operational problem, please have available information pertaining to the nature of the trouble. This includes the type of equipment, examples of what is or is not happening, and the name of the processor that supports your terminal. All questions pertaining to the settlement of accounts, transaction inquiries, and fund status must be directed to the processor. Triton does not have access to the information needed to answer questions relating to specific transactions. Contact Information Triton Systems of Delaware, LLC. 21405 B Street Long Beach, MS 39560 Sales: 1 (800) 367-7191 1 (228) 868-1317 1 (228) 868-0437 (Fax) Service: 1 (800) 259-6672 (Technical Support) 1 (228) 868-9445 Fax (Technical Support) B-7 Appendix B This Page Intentionally Left Blank B-8 Appendix C Electronic Lock and Battery Appendix C Entering the Combination The electronic lock combination(s) consists of six digits. Upon arrival, the combination(s) of the lock should already be set at 1-2-3-4-5-6. After installation of the unit has been completed, perform the following steps: 1. Enter the preset combination and check for proper operation. After each keypress, the lock will beep. After the final digit has been entered, the lock will beep twice and the open period will begin. 2. Within four (4) seconds, turn the keypad clockwise to the open position. 3. After the lock is opened, the door may be opened. Invalid Code Entry - Lock will beep three (3) times. Changing the Combination * Important * Always perform this operation with the door open. If your unit is programmed for Dual Code (see Programmable Features), each code must be changed independently. Follow these instructions for each code change. To change the combination of the lock, simply follow these directions. 1. Enter six (6) zeros. 2. Enter the current combination (initially set at 1-2-3-4-5-6). 3. Enter the new six (6) digit combination twice. - If a mistake is made, wait thirty (30) seconds and repeat the first 3 steps. 4. Test lock combination several times before closing the door. The combination is now changed. Valid Code Entry - Double signal after valid six (6) digit code is entered. Invalid Code Entry - Triple signal and old code is still valid. Lockout Feature The lock includes a WRONG TRY PENALTY lockout feature that prevents entry from unauthorized personnel. This feature performs as follows: • Entry of four (4) consecutive invalid combinations starts a 5-minute delay period. - LED flashes RED at ten (10) second intervals. • At the end of the delay period, two (2) more consecutive invalid combinations will restart an additional 5-minute delay. Entry will not respond to a single keystroke during delay period. Programmable Features The locks are initially set with the standard features (a single 6-digit code). Based on your requirements, additional features may be added in the lock, BUT THEY MUST BE PRE-PROGRAMMED by Triton prior to shipment of the unit. The programmable features are listed below. C2 Electronic locks and Battery Manager (Factory set to 1-2-3-4-5-6): Add/remove second user Enable/disable second user Dual Code: Two (2) combinations required to open. Silent Signal Alarm (Optional alarm box required): Duress signal if last number of code(s) is entered using one (1) number higher or one (1) number lower.Time Delay: Delay period 1-99 minutes. Open period 1-19 minutes Time Delay Override: Ability to add second combination to override delay period Disable Lock (Optional alarm box required): Input signal disables opening of lock by valid code If your lock(s) have some of these features programmed in the lock, the following describe the operations of each: Add User (If Manager, Time Delay Override, Remote Override, or Dual Combination feature programmed) - Always perform this operation with the door(s) open! 1. Enter Manager Code and HOLD DOWN LAST DIGIT OF CODE until the lock signals with two (2) sets of double beeps. 2. PRESS 1. Lock signals twice. Lock will only signal twice if the User code is not already in use. It will beep once if a User is already installed and three (3) times if the function has not been programmed in the lock. 3. Enter User code twice. The lock signals twice after each valid entry. 4. If a mistake is made, wait thirty (30) seconds and repeat steps 1 through 3. Valid Code Entry - Double signal after valid six (6) digit code is entered. Invalid Code Entry - Triple signal and old code is still valid. Disable User (Manager feature only) - Always perform this operation with the door(s) open! 1. Enter Manager Code and HOLD DOWN LAST DIGIT OF CODE until the lock signals with two (2) sets of double beeps. 2. PRESS 2. Lock signals once. User is now temporarily disabled. 3. If a mistake is made, wait thirty (30) seconds and repeat steps 1 and 2. C3 Appendix C Reinstate User (Manager feature only) - Always perform this operation with the door(s) open! 1. Enter Manager Code and HOLD DOWN LAST DIGIT OF CODE until the lock signals with two (2) sets of double beeps. 2. PRESS 1. Lock signals once. User is now reinstated. 3. If a mistake is made, wait thirty (30) seconds and repeat steps 1 and 2. Remove User (Manager feature only) - Always perform this operation with the door(s) open! 1. Enter Manager Code and HOLD DOWN LAST DIGIT OF CODE until the lock signals with two (2) sets of double beeps. 2. PRESS 3. Lock signals once. User is now permanently removed. 3. If a mistake is made, wait thirty (30) seconds and repeat steps 1 and 2. Dual Code Operation (if feature is programmed) - Always perform this operation with the door(s) open! 1. Must add second user to open lock (See ADD USER). • Second user CAN NOT be Disabled or Removed. 2. After first code is entered, second code must be entered within ten (10) seconds. 3. If Time Delay f - Always perform this operation with the door(s) open! • Both codes required to open lock in Open period. Silent Signal Alarm (if feature is programmed AND optional Alarm Box is connected to an alarm system) - Always perform this operation with the door(s) open! 1. Enter last digit of code one (1) number higher or one (1) number lower. Example: Code: 1-2-3-4-5-6 Duress: 1-2-3-4-5-5 or 1-2-3-4-5-7 2. The lock will open without any indication that the duress signal has been sent. C4 Electronic locks and Battery Time Delay (if feature is programmed) - Always perform this operation with the door(s) open! 1. Enter valid code. • Delay period starts (1-99 minutes pre-programmed). • LED flashes RED at one (1) second intervals. - If valid code entered during delay, Delay period restarts. - If invalid code(s) entered during delay, Delay period aborts. 2. At end of delay period, Open period starts (1-19 minutes pre-programmed). • LED flashes RED at 1/2 second intervals. • Lock beeps at ten (10) second intervals 3. During Open period, enter valid code(s). • If invalid code entered during open, Open period continues. • If four (4) consecutive invalid codes entered, WRONG TRY PENALTY starts. Time Delay Override (if feature is programmed) - Always perform this operation with the door(s) open! 1. Must add second code (See ADD USER). • Second user CAN NOT be Disabled or Removed. 2. Entry of Over ride code during Delay period will open lock. Battery Low Warning Repeated beeping during an opening indicates that the battery is low and needs to be replaced. Recommend replacement of battery at least twice annually. The battery box is located on the inside of the door. Note: If the lock will not operate (i.e. repeated beeping or no beeping) while the door is closed and locked, the battery must be energized from the two external terminals on the front of the push-button panel. To energize the lock, connect a 9-volt alkaline battery on the external terminal points. Maintain contact, enter a valid combination, and turn the dial clockwise to open the lock. Note: You must maintain battery contact at all times throughout this procedure. Changing the Battery 1. Open the ATM vault door(s). Remove the battery box cover by pulling the front portion away from the vault door. 2. The connector is easily removed by unsnapping it from the two (2) terminal on the top of the battery. 3. Remove the old battery. Install/connect a new 9-volt alkaline battery. 4. Push the battery and the leads completely up into the battery compartment. 5. Reinstall the cover and test the unit several times before closing the vault door. C5 Appendix C This page Intentionally Left Blank C6 Appendix D Mechanical Locks Appendix D Entering the Combination There are two marks on the dial ring (Refer to Figure 1). The index at the top is used for opening the lock. The index 30 degrees to the left is used only when changing the combination. The dial should always be turned slowly and evenly. A revolution is counted each time the selected number is aligned with the opening index. DO NOT TURN THE DIAL BACK TO COMPENSATE FOR OVER DIALING A NUMBER. If, when dialing the combination, any number is turned beyond the index, the entire sequence must be repeated. Locks are shipped on a single number factory setting of ‘50’. To unlock, turn the dial to the left (counterclockwise) FOUR turns stopping on ‘50’. Then, turn the dial to the right until the bolt is retracted. The Mas Hamilton lock is the only mechanical lock shipped with a factory combination of “50-25-50”. Change Index Opening Index Figure 1. The changing and opening indices on the dial ring of the mechanical combination lock dial. Unlocking A 3-Number Combinations (Example, “25-10-25”) 1. Turn the dial to the LEFT, stopping when ‘25’ is aligned with the opening index, the FOURTH time. 2. Turn the dial to the RIGHT, stopping when ‘10’ is aligned with the opening index, the THIRD time. 3. Turn the dial to the LEFT, stopping when ‘25’ is aligned with the opening index, the SECOND time. 4. Turn the dial slowly to the RIGHT until the bolt retracts. Locking the Lock Turn the dial to the LEFT at least four full revolutions. Changing the Combination Select three new numbers. DO NOT use any number between 1 and 20 for the last number. For maximum security, do not use numbers that end in 0 or 5, and do not use numbers in sequence: e.g., ’2748-86' is not as good as ’27-86-48". Perform the following steps: 1. Dial the existing combination on the opening index (see steps 1-2-3 previously, or the directions for opening when on the factory setting). Open door of container. 2. Refer to Figure 1. Dial the existing combination again, using the changing index. 3. With the last number set at the changing index, hold the dial securely and insert the change key in the keyhole in the back of the lock. Make sure the wing is entirely inside the lock and comes to a positive stop (see Figure 2) Figure 2. Turn the change key one-quarter before turning the key. turn clockwise to allow a new combination 4. Turn key one-quarter turn to the LEFT (see Figure 2). With the change key to be entered. in this position, set the new combination as follows: a. Turn the dial to the LEFT, stopping when the first number of the new combination aligns with the changing index the FOURTH time. b. Turn the dial to the RIGHT, stopping when the second number is aligned with the changing index, the THIRD time. c. Turn the dial to the LEFT, stopping when the third number is aligned with the changing index, the SECOND time. Holding the dial in this position, turn the change key back to the RIGHT and remove it (See Figure Figure 3. After entering the last number of the combination, turn the change key 3). The new combination you have chosen is now set in the lock. one-quarter turn counterclockwise and remove the key. TEST THE NEW COMBINATION BEFORE CLOSING THE DOOR D2 SUPPLEMENT A T5 AND T7 PCI-EPP BATTERY REPLACEMENT PROCEDURES SA-1 T5 PCI-EPP BATTERY REPLACEMENT ** CAUTION ** You must not remove battery from EPP without FIRST connecting a new battery! This EPP will be permanently damaged if unpowered and battery is removed before connecting a new battery! Battery Case Spare battery connection EXISTING BATTERY - DO NOT REMOVE BEFORE CONNECTING A SPARE BATTERY FIRST! The spare battery for the T5 PCI-EPP may be purchased from Triton Systems: P/N 01300-00025 (T5 PCI-EPP Lithium Backup Battery) SA-2 SUPPLEMENT A - T5 / T7 PCI-EPP BATTERY REPLACEMENT PROCEDURES T7 PCI-EPP BATTERY REPLACEMENT * IMPORTANT* You may remove the battery without risk of damage to the EPP. You have approximately 1-2 minutes to replace with a spare battery before losing the data stored (keys, passwords) in the keypad. Battery Case The spare battery for the T7 PCI-EPP may be purchased from Triton Systems: P/N 01300-00023 (T7 PCI-EPP Lithium Battery) SA-3 THIS PAGE INTENTIONALLY LEFT BLANK SA-4 T5 PCI-EPP KEY SUPPLEMENT B MANAGEMENT PROCEDURES T7 PCI-EPP T5 - T7 PCI-EPP (T5) / KEY M ANAGEMENT P ROCEDURES DIFFERENCES WITH THE T5 PCI-EPP KEYPAD YOU MUST NOT REMOVE BATTERY FROM EPPWITHOUT FIRST CONNECTING A NEW BATTERY! THIS T5 EPP WILL BE PERMANENTLY DAMAGED IF UNPOWERED AND BATTERY IS REMOVED BEFORE CONNECTING A NEW BATTERY! USER PASSWORDS MUST BE AT LEAST 8 CHARACTERS, RATHER THAN 6. EPP WILL PROMPT WITH ERROR IF FEWER CHARACTERS ENTERED AND THEN TAKE YOU BACK TO PASSWORD ENTRY AT POINT YOU LEFT OFF. THERE IS NO WAY TO CLEAR THE PASSWORD . HIT <CANCEL > AND START OVER. NO <CLEAR> OR <BACKSPACE> ON KEY ENTRY. IF ERROR IS MADE IN KEY ENTRY, HIT <CANCEL> AND START KEY ENTRY OVER FROM BEGINNING OF FIRST KEY HALF. YOU MAY ONLY ENTER IN NEW KEYS - NO CHANGE KEY FUNCTIONALITY. YOU HAVE 10 MINUTES TO ENTER IN BOTH U SER PASSWORDS BEFORE TIMEOUT. – IF TIMEOUT OCCURS, YOU MUST START KEY ENTRY OVER FROM SCRATCH . – THIS WILL AFFECT STAGING OF UNITS! – CANNOT ENTER ONE KEY HALF AT WAREHOUSE AND OTHER HALF IN FIELD. PASSWORD ENTRY – CLEAR WILL TAKE YOU BACK TO KEY MANAGEMENT PAGE. – RE-ENTER PASSWORD. SB-2 SUPPLEMENT B - KEY MANAGEMENT PROCEDURES KEY MANAGEMENT PROCEDURES (W/T5 PCI-EPP INSTALLED) ENTER MANAGEMENT FUNCTIONS > MAIN MENU NOTE: PREVIOUSLY , USERS HAD TO ENTER THE INITIAL PASSWORD OF SIX (6) “ZEROS” BEFORE BEING ALLOWED TO SET THE PASSWORDS. THIS IS NO LONGER REQUIRED (FOR T5 PCI-EPP ONLY). > KEY MANAGEMENT. SELECT “S ET U SER 1 P ASSWORD ” OPTION. ENTER NEW PASSWORD FOR USER 1. PASSWORDS CAN BE ANYWHERE FROM ‘8’ TO ‘16’ DECIMAL DIGITS. PRESS <ENTER>. YOU WILL BE PROMPTED AGAIN TO CONFIRM THE NEW PASSWORD . PRESS <ENTER>. R E - ENTER NEW PASSWORD . AFTER THE PASSWORD IS INITIALIZED, THE “SET USER 1 PASSWORD ” OPTION CHANGES TO “CHANGE USER 1 P ASSWORD ”. THE “SET PASSWORD INITIALIZATION” PROMPT APPEARS. PRESS <ENTER>. SELECT “SET PASSWORD” OPTION. NEXT, SELECT “SET USER 2 P ASSWORD” OPTION. FOLLOW THE SAME PROCEDURE FOR ENTERING A NEW PASSWORD FOR U SER 2. WHEN COMPLETED, THE “SET USER 2 PASSWORD” OPTION WILL CHANGE TO “CHANGE USER 2 PASSWORD”. AFTER COMPLETION, HIT <CANCEL > TO ENTER MAS TER KEYS SCREEN (STEP 5). SB-3 T5 - T7 SELECT “ENTER MASTER KEYS” OPTION. USER 1 ENTERS THE FIRST KEY PART (32 CHARACTERS). REFERENCE THE KEY LAYOUT DISPLAY BELOW. THE MAIN KEYPAD WILL MIRROR THE NUMBER/ALPHANUMERIC KEYS. AFTER ENTERING THE KEYS, PRESS THE <ENTER> OPTION ON THE RIGHT-SIDE FUNCTION KEY <F7>. IMPORTANT: T HE REST OF THE PROCEDURES MUST BE COMPLETED WITHIN A 10 MINUTE PERIOD. I F T H E P R O C E S S TA K E S LONGER THAN THAT, THE KEY PARTS WILL NOT BE ABLE TO BE COMBINED ! ENTER U SER 1 PASSWORD. PRESS <ENTER>. ENTER U SER 2 PASSWORD. PRESS <ENTER>. F5 F7 SELECT “ENTER PIN MASTER KEY” OPTION. SB-4 SUPPLEMENT B - KEY MANAGEMENT PROCEDURES THE “CHECK DIGITS” PROMPT APPEARS. PRESS <ENTER>. 11 A PROMPT APPEARS TO ENTER THE SECOND KEY PART. PRESS <ENTER>. USER 2 ENTERS THE SECOND KEY PART (32 CHARACTERS). REFER TO STEP 8 FOR ENTERING KEYS. THE “CHECK DIGITS” PROMPT APPEARS. YOU WILL BE PROMPTED THAT THE KEY WAS SUCCESS FULLY CHANGED. REPEAT SEQUENCE FOR ENTERING MAC MASTER KEY , IF REQUIRED. SB-5 T5 - T7 KEY MANAGEMENT PROCEDURES (W/T7 PCI-EPP INSTALLED) ENTER MANAGEMENT FUNCTIONS > MAIN MENU THE T7 USER PASSWORDS ARE INITIALLY SET TO SIX (6) “ZEROS (SIMILAR TO VEPP) BEFORE BEING AL LOWED TO SET THE PASSWORDS . > KEY MANAGEMENT. SELECT “S ET U SER 1 P ASSWORD ” OPTION. ENTER NEW PASSWORD FOR USER 1. PASSWORDS CAN BE ANYWHERE FROM ‘6’ TO ‘14’ DECIMAL DIGITS. PRESS <ENTER>. YOU WILL BE PROMPTED AGAIN TO CONFIRM THE NEW PASSWORD . PRESS <ENTER>. R E - ENTER NEW PASSWORD . AFTER THE PASSWORD IS INITIALIZED, THE “SET USER 1 PASSWORD ” OPTION CHANGES TO “CHANGE USER 1 P ASSWORD ”. THE “SET PASSWORD INITIALIZATION” PROMPT APPEARS. PRESS <ENTER>. SELECT “SET PASSWORD” OPTION. NEXT, SELECT “SET USER 2 P ASSWORD” OPFOLLOW THE SAME PROCEDURE FOR ENTERING A PASSWORD FOR USER 2. TION. NEW WHEN COMPLETED, THE “SET USER 2 PASSWORD” OPTION WILL CHANGE TO “CHANGE USER 2 PASSWORD”. AFTER COMPLETION, HIT <CANCEL > TO ENTER MAS TER KEYS SCREEN (STEP 5). SB-6 SUPPLEMENT B - KEY MANAGEMENT PROCEDURES SELECT “ENTER MASTER KEYS” OPTION. USE THE <ARROW> KEY TO TOGGLE BETWEEN “NEW KEY” OR “ADD PART” (TO AN EXISTING KEY). PRESS <ENTER> FOR THE APPLICABLE ENTRY. ENTER USER 1 PASSWORD. PRESS <ENTER>. ENTER USER 2 PASSWORD. PRESS <ENTER>. USER 1 ENTERS THE FIRST KEY PART (32 CHARACTERS). REFERENCE THE KEY LAYOUT DISPLAY BELOW. THE MAIN KEYPAD WILL MIRROR THE NUMBER/ALPHA NUMERIC KEYS. AFTER ENTERING THE KEYS, PRESS THE <ENTER> OPTION ON THE RIGHT-SIDE FUNCTION KEY <F7>. SELECT “ENTER PIN MASTER KEY” OPTION. SB-7 THE “CHECK DIGITS” PROMPT APPEARS . PRESS <ENTER>. T5 - T7 A PROMPT APPEARS TO ENTER THE SECOND KEY PART. PRESS <ENTER>. USER 2 ENTERS THE SECOND KEY PART (32 CHARACTERS). REFER TO STEP 9 FOR ENTERING KEYS. 11 YOU WILL BE PROMPTED THAT THE KEY WAS SUCCESSFULLY CHANGED. 12 REPEAT SEQUENCE FOR ENTERING MAC MASTER KEY , IF REQUIRED. THE “CHECK DIGITS” PROMPT APPEARS. SB-8