Download Service Manual
Transcript
Change for Life Service Manual 02'(/6*:+5$.'1$$ *:+5$.'1$% *:+5$.'1$% *:+5%.'1$% *:+5%.'1$% *:+5%.'1$% 5HIULJHUDQW5$ GREE ELECTRIC APPLIANCES,INC.OF ZHUHAI 7DEOHRI&RQWHQWV 7DEOHRI&RQWHQWV 6XPPDU\DQG)HDWXUHV 6DIHW\3UHFDXWLRQV 6SHFL¿FDWLRQV 2SHUDWLRQ&KDUDFWHULVWLF&XUYH &DSDFLW\9DULDWLRQ5DWLR$FFRUGLQJWR7HPSHUDWXUH 2SHUDWLRQ'DWD 1RLVH&ULWHULD&XUYH7DEOHVIRU%RWK0RGHOV &RQVWUXFWLRQ9LHZV ,QGRRU8QLW 2XWGRRU8QLW 5HIULJHUDQW6\VWHP'LDJUDP 6FKHPDWLF'LDJUDP (OHFWULFDO:LULQJ 3ULQWHG&LUFXLW%RDUG )XQFWLRQDQG&RQWURO 5HPRWH&RQWURO2SHUDWLRQV 'HVFULSWLRQRI(DFK&RQWURO2SHUDWLRQ ,QVWDOODWLRQ0DQXDO 1RWLFHVIRU,QVWDOODWLRQ ,QVWDOODWLRQ'LPHQVLRQ'LDJUDP ,QVWDOO,QGRRU8QLW ,QVWDOO2XWGRRU8QLW &KHFNDIWHU,QVWDOODWLRQDQG7HVW2SHUDWLRQ ,QVWDOODWLRQDQG0DLQWHQDQFHRI+HDOWK\)LOWHU 7DEOHRI&RQWHQWV ([SORGHG9LHZVDQG3DUWV/LVW ,QGRRU8QLW 2XWGRRU8QLW 7URXEOHVKRRWLQJ 0DOIXQFWLRQ$QDO\VLV 0DOIXQFWLRQ&RGH 5HPRYDO3URFHGXUH 5HPRYDO3URFHGXUHRI,QGRRU8QLW 5HPRYDO3URFHGXUHRI2XWGRRU8QLW 6XPPDU\DQG)HDWXUHV 6XPPDU\DQG)HDWXUHV ,QGRRU8QLW *:+5$.'1$$, *:+5$.'1$%, *:+5%.'1$%, *:+5%.'1$%, *:+5$.'1$%, *:+5%.'1$%, 2XWGRRU8QLW *:+5$.'1$$2 *:+0$.'1$%2 *:+0%.'1$%2 5HPRWH&RQWUROOHU <$$)% 6DIHW\3UHFDXWLRQV 6DIHW\3UHFDXWLRQV Installing, starting up, and servicing air conditioner can be hazardous due to system pressure, electrical components, and equipment location, etc. Only trained, qualified installers and service personnel are allowed to install, start-up, and service this equipment. Untrained personnel can perform basic maintenance functions such as cleaning coils. All other operations should be performed by trained service personnel. Make sure the outdoor unit is installed on a stable, level surface with no accumulation of snow, leaves, or trash beside. When handling the equipment, observe precautions in the manual and on tags, stickers, and labels attached to the equipment. Follow all safety codes. Wear safety glasses andwork gloves. Keep quenching cloth and fire extinguisher nearby when brazing. Follow all the installation instructions to minimize the risk of damage from earthquakes, typhoons or strong winds. Read the instructions thoroughly and follow all warnings or cautions in literature and attached to the unit. Consult local building codes and current editions of national as well as local electrical codes. Recognize the following safety information: Warning Incorrect handling could result in personal injury or death. Caution Incorrect handling may result in minor injury,or damage to product or property. Warning All electric work must be performed by a licensed technician according to local regulations and the instructions given in this manual. Before installing, modifying, or servicing system, main electrical disconnect switch must be in the OFF position. There may be more than 1 disconnect switch. Lock out and tag switch with a suitable warning label. Never supply power to the unit unless all wiring and tubing are completed, reconnected and checked. This system adopts highly dangerous electrical voltage. Incorrect connection or inadequate grounding can cause personal injury or death. Stick to the wiring diagram and all the instructions when wiring. Have the unit adequately grounded in accordance with local electrical codes. Have all wiring connected tightly. Loose connection may lead to overheating and a possible fire hazard. All installation or repair work shall be performed by your dealer or a specialized subcontractor as there is the risk of fire, electric shock, explosion or injury. Make sure the ceiling/wall is strong enough to bear the weight of the unit. Make sure the noise of the outdoor unit does not disturb neighbors. Avoid contact between refrigerant and fire as it generates poisonous gas. Apply specified refrigerant only. Never have it mixed with any other refrigerant. Never have air remain in the refrigerant line as it may lead to rupture and other hazards. Make sure no refrigerant gas is leaking out when installation is completed. Should there be refrigerant leakage, the density of refrigerant in the air shall in no way exceed its limited value, or it may lead to explosion. Keep your fingers and clothing away from any moving parts. Clear the site after installation. Make sure no foreign objects are left in the unit. Always ensure effective grounding for the unit. Caution Never install the unit in a place where a combustible gas might leak, or it may lead to fire or explosion. Make a proper provision against noise when the unit is installed at a telecommunication center or hospital. Provide an electric leak breaker when it is installed in a watery place. Never wash the unit with water. Handle unit transportation with care. The unit should not be carried by only one person if it is more than 20kg. Never touch the heat exchanger fins with bare hands. Never touch the compressor or refrigerant piping without wearing glove. Do not have the unit operate without air filter. Should any emergency occur, stop the unit and disconnect the power immediately. Properly insulate any tubing running inside the room to prevent the water from damaging the wall. 6SHFL¿FDWLRQV 6SHFL¿FDWLRQV 0RGHO 3URGXFW&RGH 3RZHU 6XSSO\ *:+5$.'1$$ *:+5$.'1$% &% &% 5DWHG9ROWDJH 9a 5DWHG)UHTXHQF\ +] 3KDVHV 3RZHU6XSSO\0RGH ,QGRRU ,QGRRU &RROLQJ&DSDFLW\0LQa0D[ : a a +HDWLQJ&DSDFLW\0LQa0D[ : a a &RROLQJ3RZHU,QSXW0LQa0D[ : a a +HDWLQJ3RZHU,QSXW0LQa0D[ : a a &RROLQJ&XUUHQW,QSXW $ +HDWLQJ&XUUHQW,QSXW $ 5DWHG,QSXW : 5DWHG&XUUHQW $LU)ORZ9ROXPH6++0/6/ 'HKXPLGLI\LQJ9ROXPH $ PK /K ((5 :: &23 :: 6((5 +63) $SSOLFDWLRQ$UHD P ,QGRRU8QLW0RGHO ,QGRRU8QLW3URGXFW&RGH )DQ7\SH *:+5$.'1$$, *:+5$.'1$%, &%1 &%1 &URVVÀRZ &URVVÀRZ )DQ'LDPHWHU/HQJWK';/ PP ĭ; ĭ; &RROLQJ6SHHG6++0/6/ UPLQ +HDWLQJ6SHHG6++0/6/ UPLQ )DQ0RWRU3RZHU2XWSXW : )DQ0RWRU5/$ $ )DQ0RWRU&DSDFLWRU ȝ) (YDSRUDWRU)RUP (YDSRUDWRU3LSH'LDPHWHU ,QGRRU8QLW (YDSRUDWRU5RZ¿Q*DS (YDSRUDWRU&RLO/HQJWK/;';: PP )XVH&XUUHQW $OXPLQXP)LQFRSSHU7XEH ĭ ĭ PP PP ;; ;; 03$$ 03$$ 6ZLQJ0RWRU0RGHO 6ZLQJ0RWRU3RZHU2XWSXW $OXPLQXP)LQFRSSHU7XEH : $ 6RXQG3UHVVXUH/HYHO6++0/6/ G%$ 6RXQG3RZHU/HYHO6++0/6/ G%$ 'LPHQVLRQ:;+;' PP ;; ;; 'LPHQVLRQRI&DUWRQ%R[/;:;+ PP ;; ;; 'LPHQVLRQRI3DFNDJH/;:;+ PP ;; ;; 1HW:HLJKW NJ *URVV:HLJKW NJ 6SHFL¿FDWLRQV 2XWGRRU8QLW0RGHO 2XWGRRU8QLW3URGXFW&RGH *:+5$.'1$$2 *:+0$.'1$%2 &%: &%: =+8+$,/$1'$&2035(6625 =+8+$,/$1'$&2035(6625 &RPSUHVVRU0DQXIDFWXUHU &RPSUHVVRU0RGHO &RPSUHVVRU2LO &RPSUHVVRU7\SH &RPSUHVVRU/5$ &RPSUHVVRU5/$ &RPSUHVVRU3RZHU,QSXW &RPSUHVVRU2YHUORDG3URWHFWRU 7KURWWOLQJ0HWKRG 6HW7HPSHUDWXUH5DQJH &RROLQJ2SHUDWLRQ$PELHQW7HPSHUD WXUH5DQJH +HDWLQJ2SHUDWLRQ$PELHQW7HPSHUD WXUH5DQJH &RQGHQVHU)RUP &RQGHQVHU3LSH'LDPHWHU &RQGHQVHU5RZV¿Q*DS &RQGHQVHU&RLO/HQJWK/;';: )DQ0RWRU6SHHG 2XWGRRU )DQ0RWRU3RZHU2XWSXW 8QLW )DQ0RWRU5/$ )DQ0RWRU&DSDFLWRU 2XWGRRU8QLW$LU)ORZ9ROXPH )DQ7\SH )DQ'LDPHWHU 'HIURVWLQJ0HWKRG &OLPDWH7\SH ,VRODWLRQ 0RLVWXUH3URWHFWLRQ 3HUPLVVLEOH([FHVVLYH2SHUDWLQJ 3UHVVXUHIRUWKH'LVFKDUJH6LGH 3HUPLVVLEOH([FHVVLYH2SHUDWLQJ 3UHVVXUHIRUWKH6XFWLRQ6LGH 6RXQG3UHVVXUH/HYHO+0/ 6RXQG3RZHU/HYHO+0/ 'LPHQVLRQ:;+;' 'LPHQVLRQRI&DUWRQ%R[/;:;+ 'LPHQVLRQRI3DFNDJH/;:;+ 1HW:HLJKW *URVV:HLJKW 5HIULJHUDQW 5HIULJHUDQW&KDUJH &RQQHFWLRQ3LSH/HQJWK &RQQHFWLRQ3LSH*DV$GGLWLRQDO &RQQHFWLRQ 3LSH &KDUJH 2XWHU'LDPHWHU/LTXLG3LSH 2XWHU'LDPHWHU*DV3LSH 0D['LVWDQFH+HLJKW 0D['LVWDQFH/HQJWK & &2/7' 4;$%=&*5(( (3 5RWDU\ ,17/ &DSLOODU\ a &2/7' 4;$%=&*5(( (3 5RWDU\ ,17/ &DSLOODU\ a & a a & a a $OXPLQXP)LQFRSSHU7XEH ĭ ;; $[LDOÀRZ ĭ $XWRPDWLF'HIURVWLQJ 7 , ,3 $OXPLQXP)LQFRSSHU7XEH ĭ ;; $[LDOÀRZ ĭ $XWRPDWLF'HIURVWLQJ 7 , ,3 03D 03D G%$ G%$ PP PP PP NJ NJ NJ P ;; ;; ;; 5$ ;; ;; ;; 5$ JP PP PP P P ĭ ĭ ĭ ĭ $ $ : PP PP PP USP : $ ȝ) PK PP 7KHDERYHGDWDLVVXEMHFWWRFKDQJHZLWKRXWQRWLFH3OHDVHUHIHUWRWKHQDPHSODWHRIWKHXQLW 6SHFL¿FDWLRQV 0RGHO *:+5$.'1$% 3URGXFW&RGH 3RZHU 6XSSO\ &% 5DWHG9ROWDJH 9a 5DWHG)UHTXHQF\ +] 3KDVHV 3RZHU6XSSO\0RGH ,QGRRU &RROLQJ&DSDFLW\ : +HDWLQJ&DSDFLW\ : &RROLQJ3RZHU,QSXW : +HDWLQJ3RZHU,QSXW : &RROLQJ&XUUHQW,QSXW $ +HDWLQJ&XUUHQW,QSXW $ 5DWHG,QSXW : 5DWHG&XUUHQW $ PK $LU)ORZ9ROXPH6++0/6/ 'HKXPLGLI\LQJ9ROXPH /K ((5 :: &23 :: 6((5 +63) $SSOLFDWLRQ$UHD P ,QGRRU8QLW0RGHO *:+5$.'1$%, ,QGRRU8QLW3URGXFW&RGH &%1 )DQ7\SH &URVVÀRZ )DQ'LDPHWHU/HQJWK';/ PP &RROLQJ6SHHG UPLQ +HDWLQJ6SHHG UPLQ : )DQ0RWRU5/$ $ )DQ0RWRU&DSDFLWRU ȝ) +HDWHU3RZHU,QSXW : )DQ0RWRU3RZHU2XWSXW (YDSRUDWRU)RUP ,QGRRU8QLW ĭ; $OXPLQXP)LQFRSSHU7XEH (YDSRUDWRU3LSH'LDPHWHU PP ĭ (YDSRUDWRU5RZ¿Q*DS PP (YDSRUDWRU&RLO/HQJWK/;';: PP ;; 6ZLQJ0RWRU0RGHO 6ZLQJ0RWRU3RZHU2XWSXW )XVH&XUUHQW 03$$ : $ 6RXQG3UHVVXUH/HYHO6++0/6/ G%$ 6RXQG3RZHU/HYHO6++0/6/ G%$ 'LPHQVLRQ:;+;' PP ;; 'LPHQVLRQRI&DUWRQ%R[/;:;+ PP ;; 'LPHQVLRQRI3DFNDJH/;:;+ PP ;; 1HW:HLJKW NJ *URVV:HLJKW NJ 6SHFL¿FDWLRQV 2XWGRRU8QLW0RGHO *:+0$.'1$%2 2XWGRRU8QLW3URGXFW&RGH &%: &RPSUHVVRU0DQXIDFWXUHU =+8+$,/$1'$&2035(6625&2/7' &RPSUHVVRU0RGHO 4;$%=&*5(( &RPSUHVVRU2LO (3 &RPSUHVVRU7\SH 5RWDU\ &RPSUHVVRU/5$ $ &RPSUHVVRU5/$ $ &RPSUHVVRU3RZHU,QSXW : &RPSUHVVRU2YHUORDG3URWHFWRU ,17/ 7KURWWOLQJ0HWKRG &DSLOODU\ 6HW7HPSHUDWXUH5DQJH R & a &RROLQJ2SHUDWLRQ$PELHQW7HPSHUDWXUH5DQJH R & a +HDWLQJ2SHUDWLRQ$PELHQW7HPSHUDWXUH5DQJH R & a &RQGHQVHU)RUP PP ĭ &RQGHQVHU5RZV¿Q*DS PP &RQGHQVHU&RLO/HQJWK/;';: PP ;; )DQ0RWRU6SHHG USP : )DQ0RWRU5/$ $ )DQ0RWRU&DSDFLWRU ȝ) PK )DQ0RWRU3RZHU2XWSXW 2XWGRRU8QLW $OXPLQXP)LQFRSSHU7XEH &RQGHQVHU3LSH'LDPHWHU 2XWGRRU8QLW$LU)ORZ9ROXPH )DQ7\SH )DQ'LDPHWHU $[LDOÀRZ PP 'HIURVWLQJ0HWKRG &OLPDWH7\SH 7 ,VRODWLRQ 0RLVWXUH3URWHFWLRQ 3HUPLVVLEOH([FHVVLYH2SHUDWLQJ3UHVVXUHIRUWKH 'LVFKDUJH6LGH 3HUPLVVLEOH([FHVVLYH2SHUDWLQJ3UHVVXUHIRUWKH , ,3 03D 03D 6XFWLRQ6LGH 6RXQG3UHVVXUH/HYHO+0/ G%$ 6RXQG3RZHU/HYHO+0/ G%$ 'LPHQVLRQ:;+;' PP ;; 'LPHQVLRQRI&DUWRQ%R[/;:;+ PP ;; 'LPHQVLRQRI3DFNDJH/;:;+ PP ;; 1HW:HLJKW NJ *URVV:HLJKW NJ 5HIULJHUDQW NJ &RQQHFWLRQ3LSH/HQJWK P JP &RQQHFWLRQ 2XWHU'LDPHWHU/LTXLG3LSH PP ĭ PP ĭ 0D['LVWDQFH+HLJKW P 0D['LVWDQFH/HQJWK P 2XWHU'LDPHWHU*DV3LSH 7KHDERYHGDWDLVVXEMHFWWRFKDQJHZLWKRXWQRWLFH3OHDVHUHIHUWRWKHQDPHSODWHRIWKHXQLW 5$ 5HIULJHUDQW&KDUJH &RQQHFWLRQ3LSH*DV$GGLWLRQDO&KDUJH 3LSH ĭ $XWRPDWLF'HIURVWLQJ 6SHFL¿FDWLRQV 0RGHO 3URGXFW&RGH 3RZHU 6XSSO\ *:+5%.'1$% *:+5%.'1$% &% &% 5DWHG9ROWDJH 9a 5DWHG)UHTXHQF\ +] 3KDVHV 3RZHU6XSSO\0RGH ,QGRRU ,QGRRU &RROLQJ&DSDFLW\0LQa0D[ : a +HDWLQJ&DSDFLW\0LQa0D[ : a &RROLQJ3RZHU,QSXW0LQa0D[ : a +HDWLQJ3RZHU,QSXW0LQa0D[ : a &RROLQJ&XUUHQW,QSXW $ +HDWLQJ&XUUHQW,QSXW $ 5DWHG,QSXW : 5DWHG&XUUHQW $ $LU)ORZ9ROXPH6++0/6/ P K /K ((5 :: &23 :: 'HKXPLGLI\LQJ9ROXPH 6((5 +63) $SSOLFDWLRQ$UHD P ,QGRRU8QLW0RGHO ,QGRRU8QLW3URGXFW&RGH )DQ7\SH *:+5%.'1$%, *:+5%.'1$%, &%1 &%1 &URVVÀRZ &URVVÀRZ )DQ'LDPHWHU/HQJWK';/ PP ĭ; ĭ; &RROLQJ6SHHG6++0/6/ UPLQ +HDWLQJ6SHHG6++0/6/ UPLQ )DQ0RWRU3RZHU2XWSXW : )DQ0RWRU5/$ $ )DQ0RWRU&DSDFLWRU ȝ) (YDSRUDWRU)RUP (YDSRUDWRU3LSH'LDPHWHU ,QGRRU8QLW (YDSRUDWRU5RZ¿Q*DS (YDSRUDWRU&RLO/HQJWK/;';: PP $OXPLQXP)LQFRSSHU7XEH $OXPLQXP)LQFRSSHU7XEH ĭ ĭ PP PP ;; ;; 03$$ 03$$ 6ZLQJ0RWRU0RGHO 6ZLQJ0RWRU3RZHU2XWSXW : )XVH&XUUHQW $ 6RXQG3UHVVXUH/HYHO6++0/6/ G%$ 6RXQG3RZHU/HYHO6++0/6/ G%$ 'LPHQVLRQ:;+;' PP ;; ;; 'LPHQVLRQRI&DUWRQ%R[/;:;+ PP ;; ;; 'LPHQVLRQRI3DFNDJH/;:;+ PP ;; ;; 1HW:HLJKW NJ *URVV:HLJKW NJ 6SHFL¿FDWLRQV 2XWGRRU8QLW0RGHO 2XWGRRU8QLW3URGXFW&RGH *:+0%.'1$%2 *:+0%.'1$%2 &%: &%: =+8+$,/$1'$&2035(6625 =+8+$,/$1'$&2035(6625 &RPSUHVVRU0DQXIDFWXUHU &RPSUHVVRU0RGHO &RPSUHVVRU2LO &RPSUHVVRU7\SH &RPSUHVVRU/5$ &RPSUHVVRU5/$ &RPSUHVVRU3RZHU,QSXW &RPSUHVVRU2YHUORDG3URWHFWRU 7KURWWOLQJ0HWKRG 6HW7HPSHUDWXUH5DQJH &RROLQJ2SHUDWLRQ$PELHQW 7HPSHUDWXUH5DQJH +HDWLQJ2SHUDWLRQ$PELHQW 7HPSHUDWXUH5DQJH &RQGHQVHU)RUP &RQGHQVHU3LSH'LDPHWHU &RQGHQVHU5RZV¿Q*DS &RQGHQVHU&RLO/HQJWK/;';: )DQ0RWRU6SHHG 2XWGRRU )DQ0RWRU3RZHU2XWSXW 8QLW )DQ0RWRU5/$ )DQ0RWRU&DSDFLWRU 2XWGRRU8QLW$LU)ORZ9ROXPH )DQ7\SH )DQ'LDPHWHU 'HIURVWLQJ0HWKRG &OLPDWH7\SH ,VRODWLRQ 0RLVWXUH3URWHFWLRQ 3HUPLVVLEOH([FHVVLYH2SHUDWLQJ 3UHVVXUHIRUWKH'LVFKDUJH6LGH 3HUPLVVLEOH([FHVVLYH2SHUDWLQJ 3UHVVXUHIRUWKH6XFWLRQ6LGH 6RXQG3UHVVXUH/HYHO+0/ 6RXQG3RZHU/HYHO+0/ 'LPHQVLRQ:;+;' 'LPHQVLRQRI&DUWRQ%R[/;:;+ 'LPHQVLRQRI3DFNDJH/;:;+ 1HW:HLJKW *URVV:HLJKW 5HIULJHUDQW 5HIULJHUDQW&KDUJH &RQQHFWLRQ3LSH/HQJWK &RQQHFWLRQ3LSH*DV$GGLWLRQDO &RQQHFWLRQ 3LSH &KDUJH 2XWHU'LDPHWHU/LTXLG3LSH 2XWHU'LDPHWHU*DV3LSH 0D['LVWDQFH+HLJKW 0D['LVWDQFH/HQJWK & &2/7' 4;$%=&*5(( (3 5RWDU\ ,17/ &DSLOODU\ a &2/7' 4;$%=&*5(( (3 5RWDU\ ,17/ &DSLOODU\ a & a a & a a $OXPLQXP)LQFRSSHU7XEH ĭ ;; $[LDOÀRZ ĭ $XWRPDWLF'HIURVWLQJ 7 , ,3 $OXPLQXP)LQFRSSHU7XEH ĭ ;; $[LDOÀRZ ĭ $XWRPDWLF'HIURVWLQJ 7 , ,3 03D 03D G%$ G%$ PP PP PP NJ NJ NJ P ;; ;; ;; 5$ ;; ;; ;; 5$ JP PP PP P P ĭ ĭ ĭ ĭ $ $ : PP PP PP USP : $ ȝ) PK PP 7KHDERYHGDWDLVVXEMHFWWRFKDQJHZLWKRXWQRWLFH3OHDVHUHIHUWRWKHQDPHSODWHRIWKHXQLW 6SHFL¿FDWLRQV 0RGHO *:+5%.'1$% 3URGXFW&RGH 3RZHU 6XSSO\ &% 5DWHG9ROWDJH 9a 5DWHG)UHTXHQF\ +] 3KDVHV 3RZHU6XSSO\0RGH ,QGRRU &RROLQJ&DSDFLW\ : +HDWLQJ&DSDFLW\ : &RROLQJ3RZHU,QSXW : +HDWLQJ3RZHU,QSXW : &RROLQJ&XUUHQW,QSXW $ +HDWLQJ&XUUHQW,QSXW $ 5DWHG,QSXW : 5DWHG&XUUHQW $ $LU)ORZ9ROXPH6++0/6/ 'HKXPLGLI\LQJ9ROXPH P K /K ((5 :: &23 :: 6((5 +63) $SSOLFDWLRQ$UHD P ,QGRRU8QLW0RGHO *:+5%.'1$%, ,QGRRU8QLW3URGXFW&RGH &%1 )DQ7\SH &URVVÀRZ )DQ'LDPHWHU/HQJWK';/ PP ĭ; &RROLQJ6SHHG6++0/6/ UPLQ +HDWLQJ6SHHG6++0/6/ UPLQ )DQ0RWRU3RZHU2XWSXW : )DQ0RWRU5/$ $ )DQ0RWRU&DSDFLWRU ȝ) +HDWHU3RZHU,QSXW : (YDSRUDWRU)RUP ,QGRRU8QLW $OXPLQXP)LQFRSSHU7XEH (YDSRUDWRU3LSH'LDPHWHU PP (YDSRUDWRU5RZ¿Q*DS PP (YDSRUDWRU&RLO/HQJWK/;';: PP ;; 6ZLQJ0RWRU0RGHO ĭ 03$$ 6ZLQJ0RWRU3RZHU2XWSXW : )XVH&XUUHQW $ 6RXQG3UHVVXUH/HYHO6++0/6/ G%$ 6RXQG3RZHU/HYHO6++0/6/ G%$ 'LPHQVLRQ:;+;' PP ;; 'LPHQVLRQRI&DUWRQ%R[/;:;+ PP ;; 'LPHQVLRQRI3DFNDJH/;:;+ PP ;; 1HW:HLJKW NJ *URVV:HLJKW NJ 6SHFL¿FDWLRQV 2XWGRRU8QLW0RGHO *:+0%.'1$%2 2XWGRRU8QLW3URGXFW&RGH &%: &RPSUHVVRU0DQXIDFWXUHU =+8+$,/$1'$&2035(6625&2/7' &RPSUHVVRU0RGHO 4;$%=&*5(( &RPSUHVVRU2LO (3 &RPSUHVVRU7\SH 5RWDU\ &RPSUHVVRU/5$ $ &RPSUHVVRU5/$ $ &RPSUHVVRU3RZHU,QSXW : &RPSUHVVRU2YHUORDG3URWHFWRU 7KURWWOLQJ0HWKRG &DSLOODU\ 6HW7HPSHUDWXUH5DQJH R & a &RROLQJ2SHUDWLRQ$PELHQW7HPSHUDWXUH5DQJH R & a +HDWLQJ2SHUDWLRQ$PELHQW7HPSHUDWXUH5DQJH R & &RQGHQVHU)RUP 2XWGRRU8QLW PP ĭ &RQGHQVHU5RZV¿Q*DS PP &RQGHQVHU&RLO/HQJWK/;';: PP ;; )DQ0RWRU6SHHG USP )DQ0RWRU3RZHU2XWSXW : )DQ0RWRU5/$ $ )DQ0RWRU&DSDFLWRU ȝ) PK )DQ7\SH )DQ'LDPHWHU $[LDOÀRZ PP 'HIURVWLQJ0HWKRG 7 ,VRODWLRQ 0RLVWXUH3URWHFWLRQ 3HUPLVVLEOH([FHVVLYH2SHUDWLQJ3UHVVXUHIRUWKH'LVFKDUJH 6LGH 3HUPLVVLEOH([FHVVLYH2SHUDWLQJ3UHVVXUHIRUWKH6XFWLRQ ĭ $XWRPDWLF'HIURVWLQJ &OLPDWH7\SH , ,3 03D 6LGH 6RXQG3UHVVXUH/HYHO+0/ 03D G%$ 6RXQG3RZHU/HYHO+0/ G%$ 'LPHQVLRQ:;+;' PP ;; 'LPHQVLRQRI&DUWRQ%R[/;:;+ PP ;; 'LPHQVLRQRI3DFNDJH/;:;+ PP ;; 1HW:HLJKW NJ *URVV:HLJKW NJ 5HIULJHUDQW 5$ 5HIULJHUDQW&KDUJH NJ &RQQHFWLRQ3LSH/HQJWK P JP PP ĭ &RQQHFWLRQ3LSH*DV$GGLWLRQDO&KDUJH &RQQHFWLRQ 2XWHU'LDPHWHU/LTXLG3LSH 2XWHU'LDPHWHU*DV3LSH PP ĭ 0D['LVWDQFH+HLJKW P 0D['LVWDQFH/HQJWK P 7KHDERYHGDWDLVVXEMHFWWRFKDQJHZLWKRXWQRWLFH3OHDVHUHIHUWRWKHQDPHSODWHRIWKHXQLW a $OXPLQXP)LQFRSSHU7XEH &RQGHQVHU3LSH'LDPHWHU 2XWGRRU8QLW$LU)ORZ9ROXPH 3LSH ,17/ 6SHFL¿FDWLRQV 2SHUDWLRQ&KDUDFWHULVWLF&XUYH Cooling Heating 8 10 9 7 8 6 12K 12K 7 5 Current(A) Current(A) 6 09K 5 4 3 Condition Indoor:DB 27 WB19 Indoor air flow: Turbo Pipe length:5m Voltage:230V 2 09K 4 3 Condition Indoor:DB 20 Indoor air flow:Turbo Pipe length:5m Voltage:230V 2 1 1 0 0 0 20 40 60 80 100 0 120 20 Compressor Speed(rps) 40 60 80 100 120 Compressor Speed(rps) &DSDFLW\9DULDWLRQ5DWLR$FFRUGLQJWR7HPSHUDWXUH Heating 110 120 100 100 90 80 Capacity ratio(%) Capacity ratio(%) Cooling 80 70 60 Condition Indoor:DB27℃ WB19℃ Indoor air flow: Turbo Pipe length:5m 50 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 Outdoor temp. (°C) 60 40 Condition Indoor:DB20℃ Indoor air flow: Turbo Pipe length:5m 20 0 -7 -5 0 5 10 Outdoor temp. (°C) 6SHFL¿FDWLRQV 2SHUDWLRQ'DWD &RROLQJ 7HPSHUDWXUH FRQGLWLRQ& ,QGRRU 2XWGRRU 6WDQGDUG +HDWH[FKDQJHUSLSH QDPH SUHVVXUH 303D . . a WHPS 7& 7& LQa LQa 0RGHO RXWa RXWa ,QGRRUIDQ 2XWGRRUIDQ PRGH &RPSUHVVRU PRGHUSP UHYROXWLRQ+] 7XUER 7XUER +HDWLQJ 7HPSHUDWXUH FRQGLWLRQ& ,QGRRU 2XWGRRU 6WDQGDUG +HDWH[FKDQJHUSLSH QDPH SUHVVXUH 303D . . a WHPS 7& 7& LQa LQa 0RGHO RXWa RXWa ,QGRRUIDQ 2XWGRRUIDQ &RPSUHVVRU PRGH PRGHUSP UHYROXWLRQ+] 7XUER 7XUER 7,QOHWDQGRXWOHWSLSHWHPSHUDWXUHRIHYDSRUDWRU 7,QOHWDQGRXWOHWSLSHWHPSHUDWXUHRIFRQGHQVHU 33UHVVXUHRIDLUSLSHFRQQHFWLQJLQGRRUDQGRXWGRRUXQLWV 127(6 0HDVXUHVXUIDFHWHPSHUDWXUHRIKHDWH[FKDQJHUSLSHDURXQGFHQWHURIKHDWH[FKDQJHUSDWK8 EHQW7KHUPLVWRUWKHPRPHWHU &RQQHFWLQJSLSLQJFRQGLWLRQP 1RLVH&ULWHULD&XUYH7DEOHVIRU%RWK0RGHOV Indoor side noise when blowing 54 45 Heating 52 12K Noise dB(A) Noise dB(A) 50 35 48 46 Cooling 44 09K 42 25 40 Low Middle Indoor fan motor rotating speed High 20 30 40 50 60 Compressor frequency(Hz) 70 80 &RQVWUXFWLRQ9LHZV &RQVWUXFWLRQ9LHZV ,QGRRU8QLW *:+5$.'1$%,*:+5$.'1$%, *:+5$.'1$$,*:+5%.'1$%, *:+5%.'1$%,*:+5%.'1$%, 8QLWPP &RQVWUXFWLRQ9LHZV 2XWGRRU8QLW 712 540 257 320 776 286 510 8QLWPP 5HIULJHUDQW6\VWHP'LDJUDP 5HIULJHUDQW6\VWHP'LDJUDP INDOOR UNIT OUTDOOR UNIT 4-Way valve HEAT EXCHANGER (EVAPORATOR) Accumlator Compressor HEAT EXCHANGER (EVAPORATOR) Strainer Capillary Strainer COOLING HEATING 5HIULJHUDQWSLSHGLDPHWHU /LTXLGPP *DVPP 6FKHPDWLF'LDJUDP 6FKHPDWLF'LDJUDP (OHFWULFDO:LULQJ (OHFWULFDO'DWD Symbol Color symbol Symbol Parts name BU BLUE COMP COMPRESSOR YE YELLOW CT12 OVERLOAD 4V RD RED OG ORANGE BN BROWN BK BLACK YEGN YELLOW GREEN WH WHITE 4-WAY VALVE PROTECTIVE EARTH ELECTRONIC EXPANSION VALVE EKV ,QGRRU8QLW 0 RT1 DISPLAY TUBE TEM.SENSOR L1 AP1 CN1 CN2 0 RT2 L1 DISP-1 TUBE DISP-2 COM-OUT W1 BU W2 BK W3 BN CAP AP2 AC-L W4 YEGN EVAPORATOR PE SWING-UD HEALTH-L HEALTH-N M M RD BU COOL PLASMA GENERATOR YEGN FAN MOTOR SWING MOTOR(U.D) PE L N XT1 N(1) 2 3 L-OUT K4 JUMP PGF PG POWER 13 N ROOM BN YEGN BU OUTDOOR UNIT ROOM TEM.SENSOR 6FKHPDWLF'LDJUDP 2XWGRRU8QLW *:+5$.'1$$2&%: ROOM DISCHARGE TUBE TEMP. TEMP. TEMP. SENSOR SENSOR SENSOR W8 YEGN RT1 0 PE W9 YEGN XT INDOOR UNIT BU N(1) BK 2 BN 3 YEGN RT3 0 RT2 0 L3 CN2 CN1 L1 L4 N W2 BK W3 BN L4 COM-OUT L1 L4 AC-L 4V CN3 N1 W6 BU AC-N W5 BN AC-N2 AC-L OVC-COMP V W W13 W14 W15 BU YE RD PE W12 BU OFAN U CLAPBOARD SUB-ASSY ELECTRICAL BOX AC-L3 AC-N1 AP2 AC-L1 PE L3 W11 BN W10 BU LX1-1 LX1-2 W21 AC-L2 BN E W7 PE AP1 W1 BU L REACTOR 4YV HEAT-L HEAT-N1 W22 RD HEAT-N2 EH1 EH2 PE W20 L2 L2 L2 W16 W17 W18 BU YE RD YEGN W19 YEGN V U BOTTOM BAND HEATER M SAT W COMP.BAND HEATER FAN MOTOR YEGN PE OVERLOARD PROTECTOR OUTDOOR UNIT COMP. PE COMP. *:+0$.'1$%2&%: *:+0%.'1$%2&%: ROOM DISCHARGE TUBE TEMP. TEMP. TEMP. SENSOR SENSOR SENSOR RT1 0 PE RT3 0 RT2 0 L3 W9 YEGN INDOOR UNIT BU BK BN YEGN XT W1 BU N(1) L1 2 3 AP1 PE W23 BN AC-L1 AC-L L1 N1 W5 BN W6 BU W2 BK PE W24 BU CLAPBOARD SUB-ASSY ELECTRICAL BOX PE L3 W10 BU W11 BN LX1-1 LX1-2 N W3 BN REACTOR L 4YV CN2 AC-L5 AC-L4 AC-L 4V AC-L2 AC-L3 AC-N1 AP2 AC-N COMU AC-N3 OVC-COMP U V W W13 W14 W15 W22 BU YE RD RD W21 BN AC-N2 W12 BU OFAN HEAT-L HEAT-N1 EH2 HEAT-N2 EH1 PE YEGN W19 YEGN W20 BOTTOM BAND COMP.BAND L2 L2 L2 M HEATER HEATER SAT W16 W17 W18 FAN MOTOR BU YE RD YEGN OVERLOARD V W PE PROTECTOR U COMP OUTDOOR UNIT PE COMP. 6FKHPDWLF'LDJUDP *:+0$.'1$%2&%: *:+0%.'1$%2&%: TUBE ROOM DISCHARGE TEMP. TEMP. TEMP. SENSOR SENSOR SENSOR RT1 0 XT INDOOR UNIT BU W1 BU N(1) BK 2 3 BN YEGN W9 YEGN PE AP1 L1 L4 W3 BN L4 L1 L4 W23 BN AC-L1 PE L4 ELECTRICAL BOX PE L3 L3 W5 BN CN2 AC-L5 AC-L4 AC-L W6 BU AC-N W2 BK COMU W24 BU AC-N3 U V W CLAPBOARD W13 W14 W15 BU YE RD SUB-ASSY 4V AC-L2 AP2 AC-L3 AC-N1 N1 AC-N2 OVC-COMP W21 BN W12 BU OFAN W22 RD PE YEGN W19 YEGN W20 L2 L2 L2 W16 W17 W18 BU YE RD WARNING Please don't touch any terminal when the voltage of terminal DC+ and DC- at AP2 is higher than 30V to prevent the risk of electrical shock! 4YV RT3 0 W10 BU W11 BN LX1-1 LX1-2 N AC-L RT2 0 REACTOR L V U PE W SAT M FAN MOTOR OVERLOARD PROTECTOR YEGN PE COMP COMP. 7KHVHFLUFXLWGLDJUDPVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFHSOHDVHUHIHUWRWKHRQHVXSSOLHGZLWKWKHXQLW 6FKHPDWLF'LDJUDP 3ULQWHG&LUFXLW%RDUG ,QGRRUXQLW TOP VIEW Solid-state relay Port of neutral wire Auto button Feedback of indoor fan Live wire of health function Port of indoor fan Port of motor for vertical swing Port of motor for horizontal swing Protective tube Buzzer Port of indoor ambient temp sensor Port of indoor pipe temp sensor Power of switch Port of display High-frequency transformer Communication port Main chip BOTTOM VIEW 6FKHPDWLF'LDJUDP 2XWQGRRUXQLW *:+5$.'1$$2&%: Ɣ7239,(: inductance pin1 inductance pin2 fan neilsbed four-way valve compressor electric heater chassis e ectric heater 10-core communication cable compressor Ɣ%277209,(: temp. sensor overload protection electric expansion valve 6FKHPDWLF'LDJUDP *:+0$.'1$%2&%:*:+0%.'1$%2&%: *:+0$.'1$%2&%:*:+0%.'1$%2&%: Ɣ7239,(: inductance pin1 inductance pin2 fan four-way valve compressor electric heater chassis e ectric heater communication cable compressor temp. sensor low pressure valve overload protection electric expansion valve Ɣ%277209,(: )XQFWLRQDQG&RQWURO )XQFWLRQDQG&RQWURO 5HPRWH&RQWURO2SHUDWLRQV 1 ON/OFF Press it to start or stop operation. 2 Press it to decrease temperaturesetting. 3 + Press it to increase temperaturesetting. 4 • • MODE Press it to select operation mode(AUTO/COOL/DRY/FAN/HEAT). 1 5 FAN Press it to set fan speed. 3 2 6 SWING Press it to set swing angle. 7 I FEEL 8 4 Press it to set HEALTH or AIR function. 5 6 9 10 7 8 9 10 11 11 SLEEP TEMP TIMER ON Press it to set auto-on timer. 12 CLOCK Press it to set clock function. 12 13 13 14 16 14 TIMER OFF Press it to set auto-off timer. 15 15 TURBO LIGHT Press it to turn on/off the light. 16 X-FAN 25 17 24 23 22 18 19 20 21 17 MODE icon: If MODE button is pressed,current operation mode icon pumpmodels) will show. 18 SLEEP icon : 19 LIGHT icon: 20 TEMP icon: (AUTO), ( COOL), (DRY), (FAN) or (HEAT only for heat is displayed by pressing the SLEEP button. Press this button again to clear the display. is displayed by pressing the LIGHT button. Press LIGHT button again to clear the display. Pressing TEMP button, circularly. 21 (set temperature), (indoor ambient temperature), (outdoor ambient temperature) and blank is displayed Up & down swing icon: is displayed when pressing the up & down swing down button. Press this button again to clear the display. )XQFWLRQDQG&RQWURO 22 LOCK icon: is displayed by pressing "+" and “-” buttons simultaneously. Press them again to clear the display. 23 SET TIME display: After pressing TIMER button,ON or OFF will blink.This area will show the set time. 24 DIGITAL display: This area will show the set temperature. In SAVE mode,"SE" will be displayed. 25 AIR icon: is displayed when pressing the AIR button.Press this button again to clear the display. 30 29 28 31 26 27 26 HEALTH icon: is displayed when pressing the HEALTH button.Press this button again to clear the display. 27 X-FAN icon: 28 TURBO icon: 29 FAN SPEED display: is displayed when pressing the X-FAN button. Press this button again to clear the display. is displayed when pressing the TURBO button.Press this button again to clear the display. Press FAN button to select the desired fan speed setting(AUTOLow-Med-High).Your selection will be displayed in the LCD windows, except the AUTO fan speed. 30 I FEEL icon: is displayed when pressing the I FEEL button.Press this button again to clear the display. 31 8℃ Heating icon: is displayed when Pressing “TEMP” and “CLOCK” simultaneously in Heat mode. 1 Remote Controller Description ON/OFF : Press this button to turn on the unit. Press this button again to turn off the unit. 2 -: Press this button to decrease set temperature. Hold it down for above 2 seconds to rapidly decrease set temperature. In AUTO mode, set temperature is not adjustable. 3 +: Press this button to increase set temperature. Hold it down for above 2 seconds to rapidly increase set temperature. In AUTO mode, set temperature is not adjustable. 4 MODE : Each time you press this button, a mode is selected in a sequence that goes from AUTO, COOL,DRY, FAN,and HEAT *, as the following: AUTO COOL DRY FAN HEAT* *Note:Only for models with heating function. After energization, AUTO mode is defaulted. In AUTO mode, the set temperature will not be displayed on the LCD, and the unit will automatically select the suitable operation mode in accordance with the room temperature to make indoor room comfortable. 5 FAN : This button is used for setting Fan Speed in the sequence that goes from AUTO, to then back to Auto. Auto Low speed Medium speed High speed )XQFWLRQDQG&RQWURO 6 SWING: Press this button to set up & down swing angle, which circularly changes as below: OFF This remote controller is universal. If any command , or is sent out,the unit will carry out the command as indicates the guide louver swings as: 7 I FEEL: Press this button to turn on I FEEL function. The unit automatically adjust temperature according to the sensed temperature. Press this button again to cancel I FEEL function. 8 / Press this button to achieve the on and off of healthy and scavenging functions in operation status. Press this button for the first time to start scavenging function; LCD displays“ ”. Press the button for the second time to start healthy and scavenging functions simultaneously; LCD displays“ ” and “ ” . Press this button for the third time to quit healthy and scavenging functions simultaneously. Press the button for the fourth time to start healthy function; LCD display “ ”. Press this button again to repeat the operation above. 9 SLEEP: Press this button to go into the SLEEP operation mode. Press it again to cancel this function. This function is available in COOL , HEAT (Only for models with heating function) or DRY mode to maintain the most comfortable temperature for you. 10 TEMP: Press this button, could select displaying the indoor setting temperature or indoor ambient temperature.When the indoor unit firstly power on it will display the setting temperature, if the temperature's displaying status is changed from other status to" ",displays the ambient temperature, 5s later or within 5s, it receives other remote control signal that will return to display the setting temperature. if the users haven't set up the temperature displaying status,that will display the setting temperature. 11 TIMERON : Press this button to initiate the auto-ON timer. To cancel the auto-timer program, simply press this button again. After press of this button, disappear sand " ON " blinks .00:00 is displayed for ON time setting. Within 5 seconds, press + or - button to adjust the time value. Every press of either button changes the time setting by 1 minute. Hold down either button to rapidly change the time setting by 1 minute and then 10 minutes. Within 5 seconds after setting, press TIMER ON button to confirm. 12 CLOCK : Press CLOCK button, blinking. Within 5 seconds, pressing + or - button adjusts the present time. Hold down either button for above 2 seconds to increase or decrease the time by 1 minute every 0.5 second and then by 10 minutes every 0.5 second. During blinking after setting, press CLOCK button again to confirm the setting, and then will be constantly displayed. 13 TIMER OFF : Press this button to initiate the auto-off timer. To cancel the auto-timer program, simply press the button again. TIMER OFF setting is the same as TIMER ON. 14 TURBO: Press this button to activate / deactivate the Turbo function which enables the unit to reach the preset temperature in the shortest time. In COOL mode, the unit will blow strong cooling air at super high fan speed. In HEAT mode, the unit will blow strong heating air at super high fan speed. 15 LIGHT: Press LIGHT button to turn on the display's light and press this button again to turn off the display 's light. If the light is turned on , displayed. If the light is turned off, disappears. 16 is X-FAN: Pressing X-FAN button in COOL or DRY mode, the icon is displayed and the indoor fan will continue operation for 10 minutes in order to dry the indoor unit even though you have turned off the unit. After energization, X-FAN OFF is defaulted. X-FAN is not available in AUTO, FAN or HEAT mode. 17 Combination of "+" and "-" buttons: About lock Press "+ " and "-" buttons simultaneously to lock or unlock the keypad. If the remote controller is locked, is displayed. In this case, pressing any button, blinks three times. 18 Combination of "MODE " and "-" buttons : About switch between Fahrenheit and centigrade At unit OFF, press "MODE" and "- " buttons simultaneously to switch between ℃ an d ℉ . 19 Combination of " TEMP " and "CLOCK" buttons : About Energy-saving Function Press “TEMP” and “CLOCK” simultaneously in COOL mode to start energy-saving function. Nixie tube on the remote controller displays “SE”. Repeat the operation to quit the function. 20 Combination of " TEMP " and "CLOCK" buttons : About 8℃ Heating Function )XQFWLRQDQG&RQWURO Press “TEMP” and “CLOCK” simultaneously in HEAT mode to start 8℃ Heating Function Nixie tube on the remote controller displays “ and a selected temperature of “ 8℃”. (46 if Fahrenheit is adopted). Repeat the operation to quit the function. 21 ” About Back-lighting Function The unit lights for 4s when energizing for the first time, and 3s for later press. Replacement of Batteries 1.Remove the battery cover plate from the rear of the remote controller. (As shown in the figure) 2.Take out the old batteries. 3.Insert two new AAA1.5V dry batteries, and pay attention to the polarity. 4. Reinstall the battery cover plate. ★Notes: ●When replacing the batteries, do not use old or different types of batteries, otherwise, it may cause malfunction. ●If the remote controller will not be used for a long time, please remove batteries to prevent batteries from leaking. ●The operation should be performed in its receiving range. ●It should be kept 1m away from the TV set or stereo sound sets. ●If the remote controller does not operate normally, please take the batteries out and reinsert them after 30 seconds.If it still can't operate properly, replace the batteries. Sketch map for replacing batteries )XQFWLRQDQG&RQWURO 'HVFULSWLRQRI(DFK&RQWURO2SHUDWLRQ 1. Temperature Parameters Indoor preset temperature (Tpreset) Indoor ambient temperature (T amb.) 2. Basic Functions Once energized, in no case should the compressor be restarted within less than 3 minutes. In the situation that memory function is available, for the first energization, if the compressor is at stop before de-energization, the compressor will be started without a 3-minute lag; if the compressor is in operation before de-energization, the compressor will be started with a 3-minute lag; and once started, the compressor will not be stopped within 6 minutes regardless of changes in room temperature; (1)COOL mode The condition and process of cooling If Tamb. ≥Tpreset COOL mode will act, the compressor and outdoor fan will run, and the indoor fan will run at the set speed. If Tamb. ≤Tpreset-2 , the compressor will stop, the outdoor fan will delay 30 seconds to stop, and the indoor fan will run at the set speed. If Tpreset-2 ≤Tamb ≤Tpreset , the unit will keep running in the previous mode. In this mode, the reversal valve will not be powered on and the temperature setting range is 16 ~30 . Start cooling Tamb. Tpreset +1 ˚C Original operating status Tpreset –1 ˚C ≥ 6 min. ≥ 3 min. ≥ 6 min. Stop cooling Compressor Outdoor fan Setting fan speed Indoor fan Run Protection function Overcurrent protection Stop If total current is high, the compressor will run in limited frequency. If total current is too high, the compressor will stop, the outdoor fan will delay 30 seconds to stop, indoor unit will display E5 and outdoor yellow light will blink 5 times. Antifreezing protection When the antifreezing protection is detected, the compressor will stop, the outdoor fan will stop after 30 seconds, and the indoor fan and swing motor will keep running in the original mode. When antifreezing protection is eliminated and the compressor has stopped for 3 minutes, the compressor will resume running in the original mode. During antifreeze protection min Compressor Outdoor fan Preset speed Indoor fan Run Stop (2) Dehumidifying Mode Working conditions and process of dehumidifying If T amb. T preset, the unit will enter cooling and dehumidifying mode, in which case the compressor and the outdoor fan will operate and the indoor fan will run at low speed. If T preset -2 T amb. T preset, the compressor remains at its original operation state. If T amb.< T preset -2 , the compressor will stop, the outdoor fan will stop with a time lag of 30s, and the indoor fan will operate at low speed. Protection Protection is the same as that under the cooling mode. )XQFWLRQDQG&RQWURO (3) HEAT mode The condition and process of heating If Tamb≤Tpreset+2 , HEAT mode will act, the compressor, outdoor fan and reversal valve will run, the indoor fan will delay 3min to stop at the latest If Tpreset +2 Tamb Tpreset +5 If Tamb≥Tpreset +5 ,the unit will keep running in the original mode. , the compressor will stop, the outdoor fan will delay 30sec to stop and indoor fan will blow 60S at low speed, the fan speed cannot be shifted within blow residual heat. In this mode, the temperature setting range is 16 ~30 . The air conditioner will adjust the running frequency of the compressor automatically according to the change of ambient temperature. When the unit is turned off in HEAT mode, or switched to other mode from HEAT mode, the four-way valve will be powered off after the compressor stops. Stop heating Tpreset+4 Original operating status Tpreset+2 Tamb. min. min. min. Start heating Compressor Outdoor fan Indoor fan preset wind min. min. preset wind Reversing valve Run Stop The condition and process of defrosting When frost is detected in the condenser, the system will enter into defrosting state. When defrosting starts, the compressor and indoor fan will stop, and the outdoor fan and four-way valve will delay 30 seconds to stop. The compressor will start after 15 seconds and then defrosting will be started. When the compressor has run for 7 minutes or defrosting is finished, the compressor will stop. After 30 seconds the four-way valve opens and after another 60 seconds, the compressor and outdoor fan resume running. The indoor fan will delay 3 minutes to run at the latest and temperature on the display panel shows H1. The period of defrosting 30s 30s Four-way valve Compressor 15s 7min 60s 30s Outdoor Unit Indoor Unit 3min Set fan speed Run Stop Protection function Anti-cold-wind protection In HEAT mode, in order to prevent the indoor unit from blowing out cold wind, each time the compressor starts, the indoor fan will delay 3 minutes after the compressor to run at the latest and it can adjust fan speed automatically when temperature is low. Overcurrent protection Overcurrent protection is the same with that in COOL mode. 3.Protection Cold air prevention The unit is started under heating mode (the compressor is ON): In the case of Tindoor amb. <24 : if T tube 40 and the indoor fan is at stop state, the indoor fan will begin to run at low speed with a time lag of 2 minutes. Within 2 minutes, if T tube 40 , the indoor fan also will run at low speed; and after 1-minute operation at low speed, the indoor fan will be converted to operation at preset speed.Within 1-minute low speed operation or 2-minute non-operation, if T tube 42 , the fan will run at present speed. In the case of T indoor amb. 24 : if T tube 42 , the indoor fan will run at low speed, and after one minute, the indoor fan will be converted to preset speed. Within one-minute low speed operation, if T tube 42 , the indoor fan will be converted to preset speed. )XQFWLRQDQG&RQWURO Note: Tindoor amb. indicated in 1 and 2 refers to, under initially heating mode, the indoor ambient temperature before the command to start the compressor is performed according to the program, or after the unit is withdrawn from defrost, the indoor ambient temperature before the defrost symbol is cleared. Total current up and frequency down protection If the total current Itotal W, frequency rise will be allowed; if I total X, frequency rise will not be allowed; if I total Y, the compressor will run at reduced frequency; and if I total Z, the compressor will stop and the outdoor fan will stop with a time lag of 30s. (4) Fan Mode Under the mode, the indoor fan will run at preset speed and the compressor, the outdoor fan, the four-way valve and the electric heater will stop. Under the mode, temperature can be set within a range of 16 - 30 . (5) AUTO Mode a. When Tamb.26ć, the unit will operate under cooling mode, while the implied setting temperature is 25ć. b. When Tamb.22ć, the heat pump unit will operate under heating mode, while the implied setting temperature is 20ć; the cooling only unit will operate under fan mode, while the displaying setting temperature is 25ć. c. When 23ćTamb.25ć, the unit will operate as previous mode. If it is the first time energized, the unit will operate under fan mode. d. When the unit is operating under auto mode, the compressor frequency is the same as cooling/heating mode when the unit is under cooling/heating operation. 2.Protection a. In cooling operation, protection is the sam e as that under the cooling mode; b. In heating operation, protection is the same as that under the heating mode; c. When ambient temperature changes, operation mode will be converted preferentially. Once started, the compressor will remain unchanged for at least 6 minutes. (6) Common Protection Functions and Fault Display under COOL, HEAT, DRY and AUTO Modes Overload protection T tube: measured temperature of outdoor heat exchanger under cooling mode; and measured temperature of indoor heat exchanger under heating mode. 1) Cooling overload a. If T tube 52 , the unit will return to its original operation state. b. If T tube 55 , frequency rise is not allowed. c. If T tube 58 , the compressor will run at reduced frequency. d. If T tube 62 , the compressor will stop and the indoor fan will run at preset speed. 2) Heating overload a. If T tube 52 , the unit will return to its original operation state. b. If T tube 55 , frequency rise is not allowed. c. If T tube 58 , the compressor will run at reduced frequency. d. If T tube 62 , the compressor will stop and the indoor fan will blow residue heat and then stop. Exhaust temperature protection of compressor If exhaust temperature 98 , frequency is not allowed to rise. If exhaust temperature 103 , the compressor will run at reduced frequency. If exhaust temperature 110 , the compressor will stop. If exhaust temperature 90 and the compressor has stayed at stop for at least 3 minutes, the compressor will resume its operation. Communication fault If the unit fails to receive correct signals for durative 3 minutes, communication fault can be justified and the whole system will stop. Module protection Under module protection mode, the compressor will stop. When the compressor remains at stop for at least 3 minutes, the compressor will resume its operation. If module protection occurs six times in succession, the compressor will not be started again. Overload protection If temperature sensed by the overload sensor is over 115 , the compressor will stop and the outdoor fan will stop with a time lag of 30 seconds. If temperature is below 95 , the overload protection will be relieved. If voltage on the DC bus is below 150V or over 420V, the compressor will stop and the outdoor fan will stop with a time lag of 30 seconds. When voltage on the DC bus returns to its normal value and the compressor has stayed at stop for at least 3 minutes, the compressor will resume its operation. Faults of temperature sensors )XQFWLRQDQG&RQWURO Designation of sensors Indoor ambient temperature Indoor tube temperature Outdoor ambient temperature Outdoor tube temperature Exhaust Overload Faults The sensor is detected to be open-circuited or short-circuited for successive 30 seconds The sensor is detected to be open-circuited or short-circuited for successive 30 seconds The sensor is detected to be open-circuited or short-circuited for successive 30 seconds The sensor is detected to be open-circuited or short-circuited for successive 30 seconds, and no detection is performed within 10 minutes after defrost begins. After the compressor has operated for 3 minutes, the sensor is detected to be open-circuited or short-circuited for successive 30 seconds. After the compressor has operated for 3 minutes, the sensor is detected to be open-circuited or short-circuited for successive 30 seconds. 3. Other Controls (1) ON/OFF Press the remote button ON/OFF: the on-off state will be changed once each time you press the button. (2) Mode Selection: Press the remote button MODE, then select and show in the following ways: AUTO, COOL, DRY, FAN, HEAT, AUTO. (3) Temperature Setting Option Button Each time you press the remote button TEMP+ or TEMP-, the setting temperature will be up or down by 1 . Regulating Range: 16~30 , the button is useless under the AUTO mode. (4) Time Switch You should start and stop the machine according to the setting time by remote control. (5) SLEEP State Control a. When the air conditioner is under the mode of COOL, DRY, and the SLEEP mode has been set well, after the SLEEP state keeps about 1 hour, the pre-setting T will raise 1 , and it will raise 1 again after 2 hours, so it raise 2 in 2 hours, then it will run on at the setting temperature and wind speed. b. When the air conditioner is under the mode of HEAT, and the Timer has been set well, after the SLEEP state keeps about 1 hour, the pre-setting T will reduce 1 , and it will reduce 1 again after 2 hours, so it reduce 2 in 2 hours, then it will run on at the setting temperature and wind speed. c. The setting temperature keeps the same under the FAN mode and AUTO mode. (6) Indoor Fan Control Indoor fan could be set at ultra-high, high, medium, low speed by wireless remote controller and operated as that speed. Auto fan speed could be set as well, indoor fan will operate under auto fan speed as following: 1. Under heating mode: auto speed under heating or auto heating mode: a. When Tamb.Tpreset+1ć, indoor fan will operate at high speed; b. When Tpreset+1ć˘Tamb.˘Tpreset+3ć, indoor fan will operate at medium speed; c. When Tamb.Tpreset+3ć, indoor fan will operate at low speed; There should be at least 180s operation time during switchover of each speed. 2. Under cooling mode: auto speed under cooling or auto cooling mode: a. When Tamb.Tpreset+2ć, indoor fan will operate at high speed; b. When Tpreset˘Tamb.˘Tpreset+2ć, indoor fan will operate at medium speed; c. When Tamb.Tpreset, indoor fan will operate at low speed There should be at least 180s operation time during switchover of each speed. (7) Buzzer Control The buzzer will send a “Di” sound when the air conditioner is powered up or received the information sent by the remote control or there is a button input, the single tube cooler doesn’t receive the remote control ON signal under the mode of heating mode. (8) Auto button If the controller is on, it will stop by pressing the button, and if the controller is off, it will be automatic running state by pressing the button, swing on and light on, and the main unit will run based on the remote control if there is remote control order. (9) Up-and-Down Swinging Control When power on, the up-and-down motor will firstly move the air deflector to o counter-clockwise, close the air outlet. After starting the machine, if you don’t set the swinging functi on, heating mode and auto-heating mode, the up-and-down air deflector will move to D clockwise; under other modes, the up-and-down air deflector will move to L1. If you set the swinging function when you start the machine, then the wind blade will swing between L and D. The air deflector has 7 )XQFWLRQDQG&RQWURO swinging states: Location L, Location A, Location B, Location C, Location D, Location L to Location D, stop at any location between L-D (the included angle between L~D is the same). The air deflector will be closed at 0 Location, and the swinging is effectual only on condition that setting the swinging order and the inner fan is running. The indoor fan and compressor may get the power when air deflector is on the default location. Heating angle O(0°) Cooling angle O(0°) L A B C D L1 A1 B1 C1 D1 (10) Display Operation pattern and mode pattern display All the display patterns will display for a time when the poweron, the operation indication pattern will display in red under standby status. When the machine is start by remote control, the indication pattern will light and display the current operation mode (the mode light includes: Cooling, heating and dehumidify). If you close the light key, all the display patterns will close. Double-8 display According to the different setting of remote control, the nixie light may display the current temperature (the temperature scope is from 16 to 30 ) and indoor ambient temperature. The heating and air supply temperature will display 25 under auto-mode, the temperature will display 20 under the auto-heating mode, and the temperature will display H1 under the defrosting mode.(If you set the fahrenheit temperature display, the nixie light will display according to fahrenheit temperature) (11) Protection function and failure display E2: Freeze-proofing protection E4: Exhausting protecti on E5: Overcurrent protection E6: Communication failure F1: Indoor ambient sensor start and short circuit (continuously measured failure in 30S) F2: Indoor evaporator sensor start and short circuit (continuously measured failure in 30S) F3: Outdoor ambient sensor start and short circuit (continuously measured failure in 30S) F4: Outdoor condenser sensor start and short circuit (continuously measured failure in 30S, and don’t measure within 10 minutes after defrosted) F5: Outdoor exhausting sensor start and short circuit (continuously measured failure in 30S after the compressor operated 3 minutes) H3: Overload protection of compressor H5: Module protection PH: High-voltage protection PL: Low-voltage protection P1: Nominal cooling and heating test P2: Maximum cooling and heating test P3: Medium cooling and heating test P0: Minimum cooling and heating test (12) Drying Function You may start or stop the drying function under the modes of cooling and dehumidify at the starting status (The modes of automatism, heating and air supply do not have drying function). When you start the drying function, after stop the machine by pressing the switch button, you should keep running the inner fans for 10 minutes under low air damper (The swing will operate as the former status within 10 minutes, and other load is stopped), then stop the entire machine; When you stop the drying function, press the switch button will stop the machine directly. When you start the drying function, operating the drying button will stop the inner fans and close the guide louver. (13) Memory Function When interrupting the power supply memory content: mode, swing function, light, set temperature and wind speed. After interrupted the power supply, the machine will start when recovering the power according to the memory content automatically. ,QVWDOODWLRQ0DQXDO ,QVWDOODWLRQ0DQXDO 1RWLFHVIRU,QVWDOODWLRQ 7KHXQLWLQVWDOODWLRQZRUNPXVWEHGRQHE\TXDOL¿HGSHUVRQQHODFFRUGLQJWRWKHORFDOUXOHVDQGWKLVPDQXDO %HIRUH LQVWDOODWLQJ SOHDVH FRQWDFW ZLWK ORFDO DXWKRUL]HG PDLQWHQDQFH FHQWHU LI XQLW LV QRW LQVWDOOHG E\ WKH DXWKRUL]HG PDLQWHQDQFHFHQWHUWKHPDOIXQFWLRQPD\QRWVROYHG GXHWRGLVFRPPRGLRXVFRQWDFWV :KHQUHPRYLQJWKHXQLWWRWKHRWKHUSODFHSOHDVH¿UVWO\FRQWDFWZLWKWKHDXWKRUL]HG0DLQWHQDQFH&HQWHULQWKHORFDODUHD WKHDSSOLDQFHPXVWEHSRVLWLRQHGVRWKDWWKHSOXJLVDFFHVVLEOH $IWHUSXOORXWWKHSRZHUSOXJWKHQPDNHWKHDSSOLDQFH RSHUDWLRQ DJDLQWR DYRLG WKH LFLQJ RI RXWGRRU XQLW GDPDJH D[LDOÀRZ IDQVKRXOGHOHFWULI\WKHDSSOLDQFHEXWQRWRSHUDWLRQIRUKRXUVIRUZDUPXSSXUSRVH ,QVWDOODWLRQ6LWH,QVWUXFWLRQV ,QVWDOOLQWKHIROORZLQJSODFHPD\FDXVHPDOIXQFWLRQ,ILWLVXQDYRLGDEOHFRQWDFWZLWKVHUYLFHFHQWHUSOHDVH ƔVWURQJKHDWVRXUFHVYDSRXUVÀDPPDEOHJDVRUYRODWLOHOLTXLGVDUHHPLWWHG ƔKLJKIUHTXHQF\HOHFWURPDJQHWLFZDYHVDUHJHQHUDWHGE\UDGLRHTXLSPHQWZHOGHUVDQGPHGLFDOHTXLSPHQW ƔVDOWODGHQDLUSUHYDLOVVXFKDVFORVHWRFRDVWDODUHDV ƔWKHDLULVFRQWDPLQDWHGZLWKLQGXVWULDOYDSRXUVDQGRLOV ƔWKHDLUFRQWDLQVVXOSKXUHVJDVVXFKDVLQKRWVSULQJ]RQHV ƔFRUURVLRQRUSRRUDLUTXDOLW\H[LVWV ,QVWDOODWLRQ6LWHRI,QGRRU8QLW 7KHDLULQOHWDQGRXWOHWVKRXOGEHDZD\IURPWKHREVWUXFWLRQV(QVXUHWKHDLUFDQEHEORZQWKURXJKWKHZKROHURRP 6HOHFWDVLWHZKHUHWKHFRQGHQVDWHFDQEHHDVLO\GUDLQHGRXWDQGZKHUHLWLVHDVLO\FRQQHFWHGWRRXWGRRUXQLW 6HOHFWDSODFHZKHUHLWLVRXWRIUHDFKRIFKLOGUHQ 6HOHFWDSODFHZKHUHWKHZDOOLVVWURQJHQRXJKWRZLWKVWDQGWKHIXOOZHLJKWDQGYLEUDWLRQRIWKHXQLW %HVXUHWROHDYHHQRXJKVSDFHWRDOORZDFFHVVIRUURXWLQHPDLQWHQDQFH7KHLQVWDOODWLRQVLWHVKRXOGEHFPRUPRUHDERYH WKHÀRRU 6HOHFWDSODFHDERXWPRUPRUHDZD\IURP79VHWRUDQ\RWKHUHOHFWULFDSSOLDQFH 6HOHFWDSODFHZKHUHWKH¿OWHUFDQEHHDVLO\WDNHQRXW 0DNHVXUHWKDWWKHLQGRRUXQLWLVLQVWDOOHGLQDFFRUGDQFHZLWKLQVWDOODWLRQGLPHQVLRQLQVWUXFWLRQV 'RQRWXVHWKHXQLWLQWKHODXQGU\RUE\VZLPPLQJSRROHWF ,QVWDOODWLRQ6LWHRI2XWGRRU8QLW 6HOHFWDVLWHZKHUHQRLVHDQGRXWÀRZDLUHPLWWHGE\WKHXQLWZLOOQRWDQQR\QHLJKERUV 6HOHFWDVLWHZKHUHWKHUHLVVXI¿FLHQWYHQWLODWLRQ 6HOHFWDVLWHZKHUHWKHUHLVQRREVWUXFWLRQEORFNLQJWKHLQOHWDQGRXWOHW 7KHVLWHVKRXOGEHDEOHWRZLWKVWDQGWKHIXOOZHLJKWDQGYLEUDWLRQ 6HOHFWDGU\SODFHEXWGRQRWH[SRVHWKHXQLWWRGLUHFWVXQOLJKWRUVWURQJZLQG 0DNHVXUHWKDWWKHRXWGRRUXQLWLVLQVWDOOHGLQDFFRUGDQFHZLWKWKHLQVWDOODWLRQLQVWUXFWLRQVDQGLVFRQYHQLHQWIRUPDLQWHQDQFH DQGUHSDLU 7KHKHLJKWGLIIHUHQFHEHWZHHQLQGRRUDQGRXWGRRUXQLWVLVZLWKLQPDQGWKHOHQJWKRIWKHFRQQHFWLQJWXELQJGRHVQRWH[FHHG P.RUP. 6HOHFWDSODFHZKHUHLWLVRXWRIUHDFKRIFKLOGUHQ 6HOHFWDSODFHZKHUHWKHXQLWGRHVQRWKDYHQHJDWLYHLPSDFWRQSHGHVWULDQVRURQWKHFLW\ ,QVWDOODWLRQ0DQXDO 6DIHW\3UHFDXWLRQVIRU(OHFWULF$SSOLDQFHV $GHGLFDWHGSRZHUVXSSO\FLUFXLWVKRXOGEHXVHGLQDFFRUGDQFHZLWKORFDOHOHFWULFDOVDIHW\UHJXODWLRQV 'RQ WGUDJWKHSRZHUFRUGZLWKH[FHVVLYHIRUFH 7KHXQLWVKRXOGEHUHOLDEO\HDUWKHGDQGFRQQHFWHGWRDQH[FOXVLYHHDUWKGHYLFHE\WKHSURIHVVLRQDOV 7KHDLUVZLWFKPXVWKDYHWKHIXQFWLRQVRIPDJQHWLFWULSSLQJDQGKHDWWULSSLQJWRSUHYHQWVKRUWFLUFXLWDQGRYHUORDG 7KHPLQLPXPGLVWDQFHEHWZHHQWKHXQLWDQGFRPEXVWLYHVXUIDFHLVP 7KHDSSOLDQFHVKDOOEHLQVWDOOHGLQDFFRUGDQFHZLWKQDWLRQDOZLULQJUHJXODWLRQV $QDOOSROHGLVFRQQHFWLRQVZLWFKZLWKDFRQWDFWVHSDUDWLRQRIDWOHDVWPPLQDOOSROHVVKRXOGEHFRQQHFWHGLQ¿[HGZLULQJ 1RWH Ɣ0DNHVXUHWKHOLYHZLUHQHXWUDOZLUHDQGHDUWKZLUHLQWKHIDPLO\SRZHUVRFNHWDUHSURSHUO\FRQQHFWHG Ɣ7KHUHVKRXOGEHUHOLDEOHFLUFXLWLQWKHGLDJUDP,QDGHTXDWHRULQFRUUHFWHOHFWULFDOFRQQHFWLRQVPD\FDXVHHOHFWULFVKRFNRU¿UH (DUWKLQJ5HTXLUHPHQWV $LUFRQGLWLRQHULVW\SH,HOHFWULFDSSOLDQFH3OHDVHHQVXUHWKDWWKHXQLWLVUHOLDEO\HDUWKHG 7KH\HOORZJUHHQZLUHLQDLUFRQGLWLRQHULVWKHHDUWKLQJZLUHZKLFKFDQQRWEHXVHGIRURWKHUSXUSRVHV,PSURSHUHDUWKLQJPD\ FDXVHHOHFWULFVKRFN 7KHHDUWKUHVLVWDQFHVKRXOGDFFRUGWRWKHQDWLRQDOFULWHULRQ 7KHSRZHUPXVWKDYHUHOLDEOHHDUWKLQJWHUPLQDO3OHDVHGRQRWFRQQHFWWKHHDUWKLQJZLUHZLWKWKHIROORZLQJ ķ :DWHUSLSHĸ *DVSLSHĹ &RQWDPLQDWLRQSLSHĺ 2WKHUSODFHWKDWSURIHVVLRQDOSHUVRQQHOFRQVLGHULVXQUHOLDEOH 7KHPRGHODQGUDWHGYDOXHVRIIXVHVVKRXOGDFFRUGZLWKWKHVLONSULQWRQIXVHFRYHURUUHODWHG3&% ,QVWDOODWLRQ0DQXDO ,QVWDOODWLRQ'LPHQVLRQ'LDJUDP Space to the ceiling 15 cm Above Space to the wall 15 cm Above 15 cm Above Space to the wall 300 cm Above 250 cm Above Air outlet side Space to the floor The dimensions of the space necessary for proper installation of the appliance include the minimum permissible distances to adjacent structures. Space to the obstruction 50 cm Above ● Air inlet side e ov 30 cm Above 30 cm Ab Space to the wall Space to the wall 50 cm Above ve o m 0c Ab 20 Air outlet side ,QVWDOODWLRQ0DQXDO ,QVWDOO,QGRRU8QLW ,QVWDOODWLRQRI0RXQWLQJ3ODWH 0RXQWLQJ SODWH VKRXOG EH LQVWDOOHG KRUL]RQWDOO\$V WKH ZDWHU WUD\ V RXWOHW IRU WKH LQGRRU XQLW LV WZRZD\ W\SH GXULQJ LQVWDOODWLRQWKHLQGRRUXQLWVKRXOGVOLJKWO\VODQWWRZDWHUWUD\ VRXWOHWIRUVPRRWKGUDLQDJHRIFRQGHQVDWH )L[WKHPRXQWLQJSODWHRQWKHZDOOZLWKVFUHZV %HVXUHWKDWWKHPRXQWLQJSODWHKDVEHHQ¿[HG¿UPO\HQRXJKWRZLWKVWDQGDERXWNJ0HDQZKLOHWKHZHLJKWVKRXOG EHHYHQO\VKDUHGE\HDFKVFUHZ Wall Wall Mark on the middle of it Space to the wall 150 above Gradienter Φ55 Space to the wall 150 above Φ55 Right Left (Rear piping hole) 8QLWPP (Rear piping hole) 'ULOO3LSLQJ+ROH Outdoor Indoor Wall pipe 6ODQWWKHSLSLQJKROHRQWKHZDOOVOLJKWO\GRZQZDUGWRWKHRXWGRRUVLGH ĭ Seal pad ,QVHUWWKHSLSLQJKROHVOHHYHLQWRWKHKROHWRSUHYHQWWKHFRQQHFWLRQSLSLQJDQG Φ55 ZLULQJIURPEHLQJGDPDJHGZKHQSDVVLQJWKURXJKWKHKROH ,QVWDOODWLRQRI'UDLQ+RVH &RQQHFWWKHGUDLQKRVHWRWKHRXWOHWSLSHRIWKHLQGRRUXQLW%LQGWKHMRLQWZLWK UXEEHUEHOW 3XWWKHGUDLQKRVHLQWRLQVXODWLQJWXEH outlet pipe of indoor unit drain hose outlet pipe of indoor unit rubber belt :UDS WKH LQVXODWLQJ WXEH ZLWK ZLGH UXEEHU EHOW WR SUHYHQW WKH VKLIW RI LQVXODWLQJ outlet pipe of indoor unit WXEH 6ODQWWKHGUDLQKRVHGRZQZDUGVOLJKWO\IRUVPRRWKGUDLQDJHRIFRQGHQVDWH drain hose rubber belt insulating tube rubber belt outlet pipe of indoor unit 1RWH7KHLQVXODWLQJWXEHVKRXOGEHFRQQHFWHGUHOLDEO\ZLWKWKHVOHHYHRXWVLGHWKHRXWOHW SLSH7KHGUDLQKRVHVKRXOGEHVODQWHGGRZQZDUGVOLJKWO\ZLWKRXWGLVWRUWLRQEXOJHRU ÀXFWXDWLRQ'RQRWSXWWKHRXWOHWLQWKHZDWHU connected bulge insulating tube distortion Flooded &RQQHFWLQJ,QGRRUDQG2XWGRRU(OHFWULF:LUHV 2SHQWKHIURQWSDQHO Wiring Cover 5HPRYHWKHZLULQJFRYHUFRQQHFWDQG¿[SRZHUFRQQHFWLRQFRUG WRWKHWHUPLQDOERDUGDVVKRZQLQ)LJ 0DNHWKHSRZHUFRQQHFWLRQFRUGSDVVWKURXJKWKHKROHDWWKH EDFNRILQGRRUXQLW N(1) 5HLQVWDOOWKHFRUGDQFKRUDJHDQGZLULQJFRYHU 5HLQVWDOOWKHIURQWSDQHO yellow-green outdoor unit connection Fig 2 3 brown ,QVWDOODWLRQ0DQXDO 127( $OOZLUHVEHWZHHQLQGRRUDQGRXWGRRUXQLWVPXVWEHFRQQHFWHGE\WKHTXDOL¿HGHOHFWULFFRQWUDFWRU Ɣ(OHFWULFZLUHVPXVWEHFRQQHFWHGFRUUHFWO\,PSURSHUFRQQHFWLRQPD\FDXVHPDOIXQFWLRQ Ɣ7LJKWHQWKHWHUPLQDOVFUHZVVHFXUHO\ Ɣ$IWHUWLJKWHQLQJWKHVFUHZVSXOOWKHZLUHVOLJKWO\WRFRQ¿UPZKHWKHULWLV¿UPRUQRW Ɣ0DNHVXUHWKDWWKHHOHFWULFFRQQHFWLRQVDUHHDUWKHGSURSHUO\WRSUHYHQWHOHFWULFVKRFN Ɣ0DNHVXUHWKDWDOOZLULQJFRQQHFWLRQVDUHVHFXUHDQGWKHFRYHUSODWHVDUHUHLQVWDOOHGSURSHUO\3RRULQVWDOODWLRQPD\ FDXVH¿UHRUHOHFWULFVKRFN ,QVWDOODWLRQRI,QGRRU8QLW Ɣ7KHSLSLQJFDQEHRXWSXWIURPULJKWULJKWUHDUOHIWRUOHIWUHDU Gas side pipe :KHQURXWLQJWKHSLSLQJDQGZLULQJIURPWKHOHIWRUULJKWVLGHRILQGRRUXQLW FXWRIIWKHWDLOLQJVIURPWKHFKDVVLVZKHQQHFHVVDU\$VVKRZQLQ)LJ External connection electric wire Liquid side piping Tailing 2 side piping Tailing 1 Gas insulation &XWRIIWDLOLQJZKHQURXWLQJWKHZLULQJRQO\ Fig.3 Liquid side Piping insulation Finally wrap it Water drainage pipe with tape &XWRIIWDLOLQJDQGWDLOLQJZKHQURXWLQJERWKWKHZLULQJDQGSLSLQJ 7DNHRXWWKHSLSLQJIURPERG\FDVHZUDSWKHSLSLQJSRZHUFRUGVGUDLQKRVH ZLWKWKHWDSHDQGWKHQPDNHWKHPSDVVWKURXJKWKHSLSLQJKROH$VVKRZQLQ Left )LJ Left rear Right Fig.4 Right rear +DQJ WKH PRXQWLQJ VORWV RI WKH LQGRRU XQLW RQ WKH XSSHU KRRNV RI WKH Fixing hook PRXQWLQJSODWHDQGFKHFNLILWLV¿UPHQRXJK$VVKRZQLQ)LJ Mounting plate 7KHLQVWDOODWLRQVLWHVKRXOGEHFPRUPRUHDERYHWKHÀRRU Mounting plate Fig.5 ,QVWDOODWLRQRI&RQQHFWLRQ3LSH $OLJQWKHFHQWHURIWKHSLSHÀDUHZLWKWKHUHODWHGYDOYH 6FUHZ LQ WKH IODUH QXW E\ KDQG DQG WKHQ WLJKWHQ WKH QXW ZLWK VSDQQHU DQG WRUTXHZUHQFKE\UHIHUULQJWRWKHIROORZLQJ Hex nut diameter Tightening torque Ф6.35 Ф9.52 Ф12.7 Ф15.88 Ф19.05 15 31 50 60 70 (N·m) Indoor unit piping 20 35 55 65 75 Taper nut Piping Spanner Torque wrench 127(&RQQHFWWKHFRQQHFWLRQSLSHWRLQGRRUXQLWDW¿UVWDQGWKHQWRRXWGRRUXQLW +DQGOHSLSLQJEHQGLQJZLWKFDUH'RQRWGDPDJHWKHFRQQHFWLRQSLSH(QVXUHWKDW WKHMRLQWQXWLVWLJKWHQHG¿UPO\RWKHUZLVHLWPD\FDXVHOHDNDJH ,QVWDOO2XWGRRU8QLW (OHFWULF:LULQJ 5HPRYHWKHKDQGOHRQWKHULJKWVLGHSODWHRIRXWGRRUXQLW 7DNHRIIZLUHFRUGDQFKRUDJH&RQQHFWDQG¿[SRZHUFRQQHFWLRQFRUG WRWKHWHUPLQDOERDUG:LULQJVKRXOG¿WWKDWRILQGRRUXQLW )L[ WKH SRZHU FRQQHFWLRQ FRUG FODPSV DQG WKHQ FRQQHFW WKH FRUUHVSRQGLQJFRQQHFWRU &RQ¿UPLIWKHZLUHKDVEHHQ¿[HGSURSHUO\ 5HLQVWDOOWKHKDQGOH Handle N(1) 2 3 blue black brown yellowgreen Indoor unit connection 127( Ɣ,QFRUUHFWZLULQJPD\FDXVHPDOIXQFWLRQRIVSDUHSDUW Ɣ$IWHUWKHZLUHKDVEHHQ¿[HGHQVXUHWKHUHLVIUHHVSDFHEHWZHHQWKHFRQQHFWLRQDQG¿[LQJSODFHVRQWKHOHDGZLUH 6FKHPDWLFGLDJUDPEHLQJUHIHUHQFHRQO\SOHDVHUHIHUWRUHDOSURGXFWIRUDXWKHQWLFLQIRUPDWLRQ ,QVWDOODWLRQ0DQXDO $LU3XUJLQJDQG/HDNDJH7HVW &RQQHFWFKDUJLQJKRVHRIPDQLIROGYDOYHWRFKDUJHHQGRIORZSUHVVXUH YDOYHERWKKLJKORZSUHVVXUHYDOYHVPXVWEHWLJKWO\VKXW Liquid pipe Vacuum gauge Gas pipe &RQQHFWMRLQWRIFKDUJLQJKRVHWRYDFXXPSXPS Valve cap )XOO\RSHQWKHKDQGOHRI/RPDQLIROGYDOYH 2SHQ WKH YDFXXP SXPS IRU YDFXXPL]DWLRQ$W WKH EHJLQQLQJ VOLJKWO\ ORRVHQMRLQWQXWRIORZSUHVVXUHYDOYHWRFKHFNLIWKHUHLVDLUFRPLQJLQVLGH,I QRLVHRIYDFXXPSXPSKDVEHHQFKDQJHGWKHUHDGLQJRIPXOWLPHWHULV 7KHQWLJKWHQWKHQXW Vacuum pump .HHS YDFXXPLQJ IRU PRUH WKDQ PLQV DQG PDNH VXUH WKH UHDGLQJ RI PXOWLPHWHULV;SDFP+J )LJ )XOO\RSHQKLJKORZSUHVVXUHYDOYHV 5HPRYHFKDUJLQJKRVHIURPFKDUJLQJHQGRIORZSUHVVXUHYDOYH 7LJKWHQOLGRIORZSUHVVXUHYDOYH$VVKRZQLQ)LJ 2XWGRRU&RQGHQVDWH'UDLQDJHRQO\IRUKHDWSXPSXQLW 'XULQJ KHDWLQJ RSHUDWLRQ WKH FRQGHQVDWH DQG GHIURVWLQJ ZDWHU VKRXOG EH Drain-water hole Bottom frame GUDLQHGRXWUHOLDEO\WKURXJKWKHGUDLQKRVH,QVWDOOWKHRXWGRRUGUDLQFRQQHFWRU LQDĭKROHRQWKHEDVHSODWHDQGDWWDFKWKHGUDLQKRVHWRWKHFRQQHFWRUVR WKDWWKHZDVWHZDWHUIRUPHGLQWKHRXWGRRUXQLWFDQEHGUDLQHGRXW7KHKROH Drain connecter Hose (available commercially, inner dia. 16mm) GLDPHWHUPXVWEHSOXJJHG &KHFNDIWHU,QVWDOODWLRQDQG7HVW2SHUDWLRQ &KHFNDIWHU,QVWDOODWLRQ Items to be checked Possible malfunction Has it been fixed firmly? The unit may drop, shake or emit noise. Have you done the refrigerant leakage test? It may cause insufficient cooling(heating) capacity Is heat insulation sufficient? It may cause condensation and dripping. Is water drainage satisfactory? It may cause condensation and dripping. Is the voltage in accordance with the rated voltage marked on the nameplate? Is the electric wiring and piping connection installed correctly and securely? Has the unit been connected to a secure earth connection? It may cause electric malfunction or damage the product. It may cause electric malfunction or damage the part. It may cause electrical leakage. Is the power cord specified? It may cause electric malfunction or damage the part. Are the inlet and outlet openings blocked? It may cause insufficient cooling(heating) capacity. Is the length of connection pipes and refrigerant capacity been recorded? The refrigerant capacity is not accurate. ,QVWDOODWLRQ0DQXDO &KHFNDIWHU,QVWDOODWLRQ %HIRUH2SHUDWLRQ7HVW 'RQRWVZLWFKRQSRZHUEHIRUHLQVWDOODWLRQLV¿QLVKHGFRPSOHWHO\ (OHFWULFZLULQJPXVWEHFRQQHFWHGFRUUHFWO\DQGVHFXUHO\ &XWRIIYDOYHVRIWKHFRQQHFWLRQSLSHVVKRXOGEHRSHQHG $OOWKHLPSXULWLHVVXFKDVVFUDSVDQGWKUXPVPXVWEHFOHDUHGIURPWKHXQLW 2SHUDWLRQ7HVW0HWKRG 6ZLWFKRQSRZHUDQGSUHVV212))EXWWRQRQWKHUHPRWHFRQWUROOHUWRVWDUWRSHUDWLRQ 3UHVV 02'( EXWWRQ WR VHOHFW WKH &22/ +($7 1RW DYDLODEOH IRU FRROLQJ RQO\ XQLW )$1 WR FKHFN ZKHWKHU WKH RSHUDWLRQLVQRUPDORUQRW ,QVWDOODWLRQDQG0DLQWHQDQFHRI+HDOWK\)LOWHU ,QVWDOODWLRQRI+HDOWK\)LOWHU /LIWXSWKHIURQWSDQHOIURPLWVWZRHQGVDVVKRZQE\WKHDUURZGLUHFWLRQDQG WKHQUHPRYHWKHDLU¿OWHUDVVKRZQLQ)LJD $WWDFKWKHKHDOWK\¿OWHURQWRWKHDLU¿OWHUDVVKRZQLQ)LJE ,QVWDOOWKHDLU¿OWHUSURSHUO\DORQJWKHDUURZGLUHFWLRQLQ)LJFDQGWKHQFORVH WKHSDQHO Fig. a Fig. b Air filter Healthy filter &OHDQLQJDQG0DLQWHQDQFH Fig. c 5HPRYHWKHKHDOWK\¿OWHUDQGUHLQVWDOOLWDIWHUFOHDQLQJDFFRUGLQJWRWKHLQVWDOODWLRQLQVWUXFWLRQ'RQRWXVHEUXVKRUKDUG REMHFWVWRFOHDQWKH¿OWHU$IWHUFOHDQLQJEHVXUHWRGU\LWLQWKHVKDGH 6HUYLFH/LIH 7KHJHQHUDOVHUYLFHOLIHIRUWKHKHDOWK\¿OWHULVDERXWRQH\HDUXQGHUQRUPDOFRQGLWLRQ$VIRUVLOYHULRQ¿OWHULWLV LQHIIHFWLYHZKHQLWVVXUIDFHEHFRPHVEODFNJUHHQ 7KLVVXSSOHPHQWDU\LQVWUXFWLRQLVSURYLGHGIRUUHIHUHQFHWRWKHXQLWZLWKKHDOWK\¿OWHU,IWKHJUDSKLFVSURYLGHGKHUHLQ DUHGLIIHUHQWIURPWKHDFWXDOSURGXFWSOHDVHUHIHUWRWKHDFWXDOSURGXFW7KHTXDQWLW\RIKHDOWK\¿OWHUVLVEDVHGRQWKH DFWXDOGHOLYHU\ ([SORGHG9LHZVDQG3DUWV/LVW ([SORGHG9LHZVDQG3DUWV/LVW ,QGRRU8QLW *:+5$.'1$$,*:+5$.'1$%, *:+5%.'1$%,*:+5%.'1$%, 14 35 37 36 13 39 38 15 12 11 10 9 16 8 17 7 18 6 5 19 4 20 3 2 21 1 22 23 24 25 27 28 26 34 29 30 33 31 32 ([SORGHG9LHZVDQG3DUWV/LVW 12 'HVFULSWLRQ 3URGXFWFRGH )URQW3DQHO$VV\ )LOWHU6XE$VV\ 6FUHZ&RYHU )URQW&DVH6XEDVV\ $LU/RXYHU $LU/RXYHU 3DUW&RGH *:+5$.'1$$, *:+5$.'1$%, &%1 &%1 4W\ +HOLFRLG7RQJXH /HIW$[LOH%XVK 5HDU&DVHDVV\ 5XEEHU3OXJ:DWHU7UD\ 5LQJRI%HDULQJ 2*DVNHWVXEDVV\RI%HDULQJ &URVV)ORZ)DQ (YDSRUDWRU6XSSRUW (YDSRUDWRU$VV\ :DOO0RXQWLQJ)UDPH 0RWRU3UHVV3ODWH )DQ0RWRU 3LSH&ODPS 'UDLQDJHKRVH 6WHS0RWRU &UDQN *XLGH/RXYHU $[LOH%XVK (OHFWULF%R[ 7HUPLQDO%RDUG (OHFWULF%R[&RYHU 'LVSOD\%RDUG &DSDFLWRU&%% -XPSHU 0DLQ%RDUG 6KLHOGFRYHURI(OHFWULF%R[VXEDVV\ (OHFWULF%R[&RYHU (OHFWULF%R[$VV\ 3RZHU&RUG &RQQHFWLQJ&DEOH $PELHQW7HPSHUDWXUH6HQVRU 5HPRWH&RQWUROOHU 7XEH6HQVRU 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH ([SORGHG9LHZVDQG3DUWV/LVW 12 'HVFULSWLRQ 3URGXFWFRGH )URQW3DQHO$VV\ )LOWHU6XE$VV\ 6FUHZ&RYHU )URQW&DVH6XEDVV\ $LU/RXYHU $LU/RXYHU *:+5%.'1$%, *:+5%.'1$%, &%1 &%1 4W\ +HOLFRLG7RQJXH /HIW$[LOH%XVK 5HDU&DVHDVV\ 5XEEHU3OXJ:DWHU7UD\ 5LQJRI%HDULQJ 2*DVNHWVXEDVV\RI%HDULQJ &URVV)ORZ)DQ (YDSRUDWRU6XSSRUW (YDSRUDWRU$VV\ :DOO0RXQWLQJ)UDPH 0RWRU3UHVV3ODWH )DQ0RWRU 3LSH&ODPS 'UDLQDJHKRVH 6WHS0RWRU &UDQN *XLGH/RXYHU $[LOH%XVK (OHFWULF%R[ 7HUPLQDO%RDUG (OHFWULF%R[&RYHU 'LVSOD\%RDUG &DSDFLWRU&%% -XPSHU 0DLQ%RDUG 6KLHOGFRYHURI(OHFWULF%R[VXEDVV\ (OHFWULF%R[&RYHU (OHFWULF%R[$VV\ 3RZHU&RUG &RQQHFWLQJ&DEOH $PELHQW7HPSHUDWXUH6HQVRU 5HPRWH&RQWUROOHU 7XEH6HQVRU 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH 3DUW&RGH ([SORGHG9LHZVDQG3DUWV/LVW *:+5$.'1$%,*:+5%.'1$%, 17 16 34 36 35 15 38 37 14 13 12 11 10 18 9 19 8 20 7 6 21 5 22 4 3 1 23 2 24 25 26 27 28 33 29 30 32 31 ([SORGHG9LHZVDQG3DUWV/LVW 12 'HVFULSWLRQ 3URGXFW&RGH *:+5$.'1$%, *:+5%.'1$%, &%1 &%1 4W\ )URQW3DQHO$VV\ 'LVSOD\%RDUG )LOWHU6XE$VV\ 6FUHZ&RYHU )URQW&DVH6XEDVV\ $LU/RXYHU $LU/RXYHU +HOLFRLG7RQJXH /HIW$[LOH%XVK 5HDU&DVHDVV\ 5XEEHU3OXJ:DWHU7UD\ 5LQJRI%HDULQJ 2*DVNHWRI&URVV)DQ%HDULQJ 2*DVNHWVXEDVV\RI%HDULQJ &URVV)ORZ)DQ (YDSRUDWRU6XSSRUW (YDSRUDWRU$VV\ :DOO0RXQWLQJ)UDPH 0RWRU3UHVV3ODWH )DQ0RWRU 3LSH&ODPS 'UDLQDJH+RVH 6WHS0RWRU &UDQN *XLGH/RXYHU $[LOH%XVK (OHFWULF%R[ 7HUPLQDO%RDUG (OHFWULF%R[&RYHU 0DLQ%RDUG 6KLHOG&RYHURI(OHFWULF%R[6XEDVV\ (OHFWULF%R[&RYHU (OHFWULF%R[$VV\ 3RZHU&RUG &RQQHFWLQJ&DEOH $PELHQW7HPSHUDWXUH6HQVRU 5HPRWH&RQWUROOHU 7HPSHUDWXUH6HQVRU 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH 3DUW&RGH ([SORGHG9LHZVDQG3DUWV/LVW 2XWGRRU8QLW 18 1 2 3 4 5 17 6 7 8 16 15 14 13 12 19 11 20 21 22 10 9 23 24 30 29 28 27 26 25 31 34 33 32 ([SORGHG9LHZVDQG3DUWV/LVW 12 'HVFULSWLRQ 3DUW&RGH *:+5$.'1$$2 *:+0$.'1$%2 &%: &%: 3URGXFW&RGH (OHFWULF%R[$VV\ (OHFWULF%R[6XE$VV\ 0DLQ%RDUG 5HDFWRU 0DJQHWLF5LQJ 7HPSHUDWXUH6HQVRU 7HUPLQDO%RDUG :LUH&ODPS )URQW*ULOO )URQW3DQHO 3 3 $[LDO)ORZ)DQ &KDVVLV6XEDVV\ 3 3 %UXVKOHVV'&0RWRU 6PDOO+DQGOH 7RS&RYHU6XE$VV\ 0RWRU6XSSRUW &RQGHQVHU$VV\ 5HDU*ULOO &DSLOODU\6XEDVV\ 7HPS6HQVRU6OHHYLQJ 9DOYH6XSSRUWVKHOYHV &XWRII9DOYH %LJ+DQGOH &XWRII9DOYH$VV\ 9DOYH6XSSRUW 3 3 5LJKW6LGH3ODWH6XE$VV\ :D\9DOYH$VV\ &ODSERDUG6XE$VV\ 0DJQHW&RLO 0DJQHWLF5LQJ (OHFWULF+HDWHU&RPSUHVVRU &RPSUHVVRUDQG)LWWLQJV * * 'UDLQDJH&RQQHFWHU (OHFWULFDO+HDWHU&KDVVLV 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH 4W\ ([SORGHG9LHZVDQG3DUWV/LVW 12 'HVFULSWLRQ 3URGXFW&RGH 3DUW&RGH *:+0%.'1$%2 4W\ &%: (OHFWULF%R[$VV\ (OHFWULF%R[6XE$VV\ 0DLQ%RDUG 5HDFWRU 0DJQHWLF5LQJ 7HPSHUDWXUH6HQVRU 7HUPLQDO%RDUG :LUH&ODPS )URQW*ULOO )URQW3DQHO 3 $[LDO)ORZ)DQ &KDVVLV6XEDVV\ 3 %UXVKOHVV'&0RWRU 6PDOO+DQGOH 7RS&RYHU6XE$VV\ 0RWRU6XSSRUW &RQGHQVHU$VV\ 5HDU*ULOO &DSLOODU\6XEDVV\ 7HPS6HQVRU6OHHYLQJ 9DOYH6XSSRUWVKHOYHV &XWRII9DOYH %LJ+DQGOH &XWRII9DOYH$VV\ 9DOYH6XSSRUW 3 5LJKW6LGH3ODWH6XE$VV\ :D\9DOYH$VV\ &ODSERDUG6XE$VV\ 0DJQHW&RLO 0DJQHWLF5LQJ (OHFWULF+HDWHU&RPSUHVVRU &RPSUHVVRUDQG)LWWLQJV * 'UDLQDJH&RQQHFWHU (OHFWULFDO+HDWHU&KDVVLV 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH ([SORGHG9LHZVDQG3DUWV/LVW 12 'HVFULSWLRQ 3DUW&RGH *:+0$.'1$%2 *:+0%.'1$%2 &%: &%: 3URGXFW&RGH (OHFWULF%R[$VV\ (OHFWULF%R[6XE$VV\ 0DLQ%RDUG 5HDFWRU 0DJQHWLF5LQJ 7HPSHUDWXUH6HQVRU 7HUPLQDO%RDUG :LUH&ODPS )URQW*ULOO )URQW3DQHO 3 3 $[LDO)ORZ)DQ &KDVVLV6XEDVV\ %UXVKOHVV'&0RWRU 3 3 6PDOO+DQGOH 7RS&RYHU6XE$VV\ 0RWRU6XSSRUW &RQGHQVHU$VV\ 5HDU*ULOO &DSLOODU\6XEDVV\ 7HPS6HQVRU6OHHYLQJ 9DOYH6XSSRUWVKHOYHV 3 3 &XWRII9DOYH %LJ+DQGOH &XWRII9DOYH$VV\ 9DOYH6XSSRUW 3 3 5LJKW6LGH3ODWH6XE$VV\ :D\9DOYH$VV\ &ODSERDUG6XE$VV\ 0DJQHW&RLO 0DJQHWLF5LQJ (OHFWULF+HDWHU&RPSUHVVRU &RPSUHVVRUDQG)LWWLQJV 'UDLQDJH&RQQHFWHU (OHFWULFDO+HDWHU&KDVVLV 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH 4W\ * * 7URXEOHVKRRWLQJ 7URXEOHVKRRWLQJ 0DOIXQFWLRQ$QDO\VLV Note:When replacing the controller, make sure insert the wire jumper into the new controller, otherwire the unit will display C5. The breaker trips at once when it is set to “ON”. Air conditioner can not start up Trip of breaker or blow of fuse The air conditioner does not react after it is powered ( after the plug is inserted, the buzzer does not sound and the remote startup has no response) to ground to see if there is any leakage. The breaker trips in few minutes when it is set to “ON”. The circuit or the part of the air conditioner has malfunction. They heat and break the insulation and lead to short circuit or creepage. Measure the insulation resistance or eliminate the malfunction one by one. If the breaker itself has malfunction, then replace the breaker. No power Check power supply circuit. Power plug is not well plugged in and poor connection. Check if the plug is properly plugged in and make the loose contact firm. Fuse of controller burnt out Change controller fuse The transformer connection is loose or has bad contact or the transformer has malfunction. Fasten the wiring; measure the output voltage of the transformer , if it is incorrect, change the transformer. Controller is broken Check remote controller Remote controller is short of power The remote controller does not receive signals (after it is powered, the buzzer will sound, unless it has malfunction) Measure insulation resistance Remote controller malfunction Receiver loose or poor connection Receiver is broken Power voltage is too low Change batteries First, press the manual switch button AUTO,if there is no response,check based on the above methods. If it runs normally after pressing the button, check again whether the installation position and the connection wire of the reception head is correct. If it is correct,then replace the receiver or the remote controller. Check the voltage. If it is lower than 10% of the rated voltage, check the cause, improve the power supply condition and add the stabilized voltage power supply. 7URXEOHVKRRWLQJ Improper set of temperature Adjust set temperature If cooling (heating) load is proper Check the forecasted load of cooling (heating) The refrigerant has leakage or is insufficient heck and fill the leakage, then vacuumize it and supplement the refrigerant as required Leakage between the high presMalfunction of refrigerant flow sure and the low pressure inside the compressor Malfunction of four-way valve Poor COOL(HEAT) operation Local block of capillary Blockage of cooling system Replace the compressor Replace the four-way valve Replace the capillary Judge whether the system is blocked by observing the condensation of evaporator and the pressure value of the high pressure manometer and take measures to deal with the system. Heat insulation for the connection pipes of the indoor unit and the outdoor unit is bad. Make sure that heat insulation for the thick and thin pipes is good. Heat insulation must also be provided for the joint andthe exposed part of the copper pipe . Block of outdoor heat exchanger Clean the dust accumulated on the surface of the heat exchanger. Air filter were blocked Clean the filter Fan speed was set too slow Air circulation is insufficient Fan rotation speed becomes low The installation position of the outdoor unit is not appropriate. The outdoor temperature is too high. To set the fan speed to high or middle speed Capacitor damage Replace the capacitor Motor damage Replace the motor Good ventilation must be provided for the installation position of the outdoor unit. Properly install the rainproof plate or the sunproof plate. If the maximum cool air still can not meet the requirement, it is suggested to replace the air conditioner. The air tightness is not enough. People come in and out too frequently. There are heating devices indoors. Keep certain air tightness indoors, try not to use electricalappliance with large quantity of heat 7URXEOHVKRRWLQJ The indoor fan motor is burned or breaks or has the heat protector malfunction. Replace the fan motor or the defective part. The fan does not The built-in heat protector of the motor breaks frequently because the Replace the fan motor run when it is set to supply air. motor is abnormal. Wrong connection The fan capacitor has open circuit or is damaged. Make the correction connection based on the circuit drawing. Replace the fan capacitor of the same type and same specification. In the cooling and The outdoor fan motor is damaged. Replace the fan motor heating mode, the compressor Wrong connection Make the correct connection based on the circuit drawing The outdoor fan capacitor is damaged. Replace the fan capacitor runs, but the outdoor fan does not run. Malfunction of compressor Replace the compressor Breakage of running capacitor of In the cooling and heating mode, the outdoor fan runs, but the compressor does not run. compressor The voltage is too low or too high. Wrong wire connection The protector itself has malfunction. The refrigerant is not enough or is too much. The compressor is too hot and leads to the action of the protector. Replace the capacitor Manostat is recommended. Connect the circuit diagram correctly Use the multimeter to check whether the contact of the compressor is on when it is not overheated. If it is not on, then replace the protector Adjust the volume of the refrigerant The capillary is blocked and the temperature rises. Replace the capillary The compressor does not run Replace the compressor smoothly or is stuck. The air discharge valve is damaged The protector itself has malfunction. Replace the protector 7URXEOHVKRRWLQJ The torque of the swing motor is not enough The swing fan does not run. Wrong connection First, check whether the connection is wrong. If no, replace the parts The controller is damaged(IC2003 is damaged, the swing relay can not close, etc) Controller malfunction (IC2003 broken, creepage of parallel capaci- Change controller In cool, heat mode, the tor of relay loop, relay is broken etc.) outdoor unit and compres- Wire loose or wrong connection Correctly wire according to the drawing Improper setting of temperature Adjust setting temp. Drainage pipe blocked or broken Change drainage pipe Wrap of refrigerant pipe joint is not Re-wrap and make it tight. sor will not run. Water leakage close enough. Fan of indoor unit contacts other parts Foreign object in indoor unit Adjust fan location Take out the foreign object Adjust support washer of compressor, and tighten loosen screws Abnormal sound and shake Touch of pipeline of outdoor unit Separate the touching pipeline. Touch of inner plates 1. Tighten connect screw. 2. Stick absorbing clay between plates. Louver of outdoor unit touched outer case. Adjust location of louver. Abnormal sound inside compressor Change compressor 7URXEOHVKRRWLQJ 0DOIXQFWLRQ&RGH )ODVKLQJ/('RI,QGRRU2XWGRRU8QLWDQG3ULPDU\-XGJHPHQW 1 2 3 Name of Operation Status Yellow LED Compressure operates Defrosting Freeze prevention protection Blink once Blink twice Blink for 3 times Red LED Green LED Display on IDU H1 E2 4 IPM protection Blink for 4 times H5(displayed after it occurs for successively 6 times) 5 6 7 8 9 Blink for 5 times Blink for 6 times Blink for 7 times Blink for 8 times Blink for 9 times E5 H4 E4 H3 L9 23 24 Overcurrent protection Overload protection Discharge protection Overload protection Capacity power protection Read-write malfunction of EEPROM Low-voltage protection High-voltage protection PFC overcurrent protection Models of IDU and ODU don't not match Limit frequency(current) Limit frequency(discharge) Limit frequency(overload) Limit frequency(freeze prevention) Malfunction of outdoor ambient temp sensor Malfunction of outdoor pipe temp sensor Malfunction of outdoor discharge temp sensor Temperature for operation of the unit is reached. Limit frequency(power) Protection of fan 25 Normal communication Continuously blink 26 Malfunction of communication Off 10 11 12 13 14 15 16 17 18 19 20 21 22 27 28 Malfunction of indoor ambient temp sensor Malfunction of indoor pipe temp sensor Blink for 11 times Blink for 12 times Blink for 13 times Blink for 14 times PL PH HC Blink for 16 times LP Blink once Blink twice Blink for 3 times Blink for 4 times Blink for 6 times F3 Blink for 5 times F4 Blink for 7 times F5 Blink for 8 times Blink for 13 times Blink for 14 times E6 F1 F2 7URXEOHVKRRWLQJ 7URXEOHVKRRWLQJ 7URXEOHVKRRWLQJ +RZWR&KHFN6LPSO\WKH0DLQ3DUW (1) Capacitor charge fault (Fault with outdoor unit) (AP1 below refers to the outdoor control panel) Main Check Pionts: Use AC voltmeter to check if the voltage between terminal L and N on the wiring board id within 210VAC~240VAC. If the reactor (L) is correctly connected? If the connection is loose or fallen? If the reactor (L) is damaged? Fault diagnosis process: Turn on the unit and wait 1 minute Use DC voltmeter to measure the voltage on the two ends of electrolytic capacitor Voltage higher than 200V? Y Fault with the voltage testing circuit on control panel AP1 Replace the control panel AP1 Shut down the power and repair the power supply to restore the range 210VAC~250VAC power on and restart the unit N Measure the AC voltage between terminalL and N on wiring board XT(power supply) Voltage within 210VAC~250VAC? N If the fault is eliminated? Y Y Shut down the power and wait 20 minutes; or use DC voltmeter to measure the voltage on the two ends of capacitor, until the voltage is lower than 20V N Check the connection of reactor (L in the Electrical Wiring Diagram) If the wiring of reactor Lis normal? N Connect the reactor L according to Electrical Wiring Diagram correctly Re-energize and turn on the unit Y Replace the control panel AP1 End N If the fault is eliminated? Y 7URXEOHVKRRWLQJ ,303URWHFWLRQ2XWRIVWHS)DXOW&RPSUHVVRU3KDVH2YHUFXUUHQW$3EHORZUHIHUVWRWKHRXWGRRUFRQWUROSDQHO 0DLQO\GHWHFW ƽ ,IWKHFRQQHFWLRQEHWZHHQFRQWUROSDQHO$3DQGFRPSUHVVRU&203LVVHFXUH",IORRVH",IWKHFRQQHFWLRQLVLQFRUUHFWRUGHU" ƽ ,IWKHYROWDJHLQSXWRIWKHPDFKLQHLVZLWKLQQRUPDOUDQJH"8VH$&YROWPHWHUWRPHDVXUHWKHYROWDJHEHWZHHQWHUPLQDO/DQG1RQ WKHZLULQJERDUG;7 ƽ ,IWKHFRPSUHVVRUFRLOUHVLVWDQFHLVPRUPDO",IWKHLQVXODWLRQRIFRPSUHVVRUFRLODJDLQVWWKHFRSSHUWXEHLVLQJRRGFRQGLWLRQ" ƽ ,IWKHZRUNLQJORDGVRIWKHPDFKLQHDUHWRRKLJK",IWKHUDGLDWLRQLVJRRG" ƽ ,IWKHFKDUJHYROXPHRIUHIULJHUDQWLVFRUUHFW" )DXOWGLDJQRVLVSURFHVV Energize and switch on IPM protection occurs after the machine has run for a period of time? Y Use AC voltmeter to measure the voltage between terminal L and N on the wiring board XT) If the voltage between terminal L and N on wiring board XT is within 210VAC~250VAC? N Check the supply voltage and restore it to 210VAC~250VAC Y Start and run the unit. Before protection occurs, use DC voltmeter to measure the voltage between the two ends of electrolytic capacitor on control panel AP1 Voltage between the two ends of electrolytic capacitor is higher than 250V Y Please confirm: 1. If the indoor and outdoor heat exchangers are dirty? If they are obstructed by other objects which affect the heat exchange of indoor and outdoor unit. 2. If the indoor and outdoor fans are working normally? 3. If the environment temperature is too high, resulting in that the system pressure is too high and exceeds the permissible range? 4. If the charge volume of refrigerant is too much, resulting in that the system pressure is too high? 5. Other conditions resulting in that the system pressure becomes too high. The connection of capacitor C2 is loose. Y Reconnect the capacitor C2 according to Electrical Wiring Diagram. Then, energize and start the unit. Y N Remove the wires on the two ends of capacitor C2. Then, use capacitance meter to measure the capacitor C2. Verify as per the Parameters Sheet. Stop the unit and disconnect the power supply. Wait 20 minutes, or use DC voltmeter to measure the voltage between the two ends of capacitor C2, until the voltage is lower than 20V If capacito r C2 is failed? Replace the capacitor C2. Then, energize and start the unit. Y Replace the control panel AP1 N If there is any abnormality described above? Y Y Take corrective actions according to Technical Service Manual, and then energize and start the unit. Connect the control panel AP1 and compressor COMP correctly according to the Electrical Wiring Diagram. Then, energize and start the unit. If the resistance is normal? N N If the unit can work normally? If the unit can work normally? Y Y N Replace the control panel AP1 N Use ohmmeter to measure the resistance between the three terminals on compressor COMP, and compare the measurements with the compressor resistance on Service Manual. If the unit can work normally? N Stop the unit and disconnect the power supply. Then, check the connection of capacitor C2 according to Electrical Wiring Diagram. Refer to the Electrical Wiring Diagram and check if the connection between AP1 and COMP is loose and if the connection order is correct. If the connection between AP1 and COMP is unsecure or the connection order is wrong? N If the unit can work normally? If the unit can work normally? Y N Y Replace the compressor COMP N Use ohmmeter to measure the resistance between the two terminals of compressor COMP and copper tube. Resistance higher than 500M ? Y Replace the control panel AP1 END 7URXEOHVKRRWLQJ (3) High temperature and overload protection diagnosis (AP1 here in after refers to the control board of the outdoor unit) Mainly detect: Is outdoor ambienttemperature in normal range? After the outdoor and indoor fans operating normally? Is the heat dissipation environment inside and outside the unit is good? Overheat and high temperature protection Y Is outdoor ambient temperature higher than 53? Normal protection, please operate it after the outdoor ambient temperature is normalized. N 20 minutes after the complete unit is powered off. Is heat dissipation of the indoor unit and outdoor unit abnormal? Y Improve the heat dissipation environment of the unit N Does the outdoor fan work normally? N 1. Check if the fan terminal OFAN is connected correctly 2. Resistance between any two terminals is measure by an ohm gauge and should be less than 1K Ohm. Y Replace the fan capacitor C1 Replace the control panel AP1 Replace the outdoor fan End 7URXEOHVKRRWLQJ (4) Start-up failure(following AP1 for outdoor unit control board) Mainly detect: Whether the compressor wiring is connected correct? Is time for compressor stopping enough? Is compressor broken? Power on the unit Is stop time of the compressor longer than 3 minutes? N Restart it up after 3 minutes Y Does startup fail? Y Are the wires for the compressor connected correctly? Is connection sequence right? N Connect the wires as per the connection diagram Y Replace the control panel AP1 N If the fault is eliminated? N Replace the compressor Y End 7URXEOHVKRRWLQJ (5) Out of step diagnosis for the compressor (AP1 hereunafter refers ti the control board of the outdoor unit) Main detect: Whether the system pressure is too high? Whether the input voltage is too low? Out of step occurs once the unit is powered on. Out of step occurs in operation Is stop time of the compressor longer than 3 minutes? Is the outdoor fan working normally? Is the outdoor unit blocked by foreign objects? Are the wires for the compressor connected correctly? Is connection sequence right? Is the connection made in clockwise direction? Replace the control panel AP1 Connect the wires correctly Replace the control panel AP1 If the fault is eliminated? If the fault is eliminated? Replace the compressor Replace the compressor End End Check if the fan terminal OFAN is connected correctly Replace the fan capacitor C1 Replace the outdoor fan Remove foreign objects 7URXEOHVKRRWLQJ (6) Overload and air exhaust malfuntion diagnosis (following AP1 for outdoor unit unit control board) Mainly detect: Wether the PMV is connected well or not? Is PMV damaged? Is refrigerant leaked? 20 minutes after the complete unit is powered o ff Is the terminal FA for the PMV connected correctly? Connect the wires correctly Resistances between the first four pins close to the terminal hole and the fifth pin are almost the same, less than 100 ohm. Replace the PMV If the fault is eliminated? Replace the control panel AP1 If the fault is eliminated? Coolant leakage, refilling the coolant End 7URXEOHVKRRWLQJ (7) Power factor correct or (PFC) fault (a fault of outdoor unit)(AP1 here in after refers to the control board of the outdoor unit) Start Checkwiring of the reactor (L) of the outdoorunit andthe PFC capacitor Whether there is any damage or short-circuit? Y Replace it as per the wiring diagram and reconnect the wires If the fault is eliminated? N Remove the PFC capacitor and measure resistance between the two terminals. Is the resistance around zero? N Y The capacitor is short circuited and the capacitor should be replaced Restart the unit If the fault is eliminated? Y N Disconnect the terminals for the reactor and measure the resistance between the two terminals of the reactor by an ohmmeter Whether there is any damage or short-circuit? N Y Replace the reactor Restart the unit If the fault is eliminated? Y N Replace the control panel AP1 N Y End 7URXEOHVKRRWLQJ (8) Communication malfunction:(following AP1 for outdoor unit control board) Mainly detect: Detect the indoor and outdoor units connection wire and indoor and outdoor units inside wiring is connect well or not, If is there any damage? Is there any damage for the indoor unit mainboard communication circuit? Is communication circuit damaged? The flow chart fir malfunction detect: Start Y Did the equipment operate normally before the failure occurs? N Check the wiring of the indoor and outdoor units with reference to the wiring diagram Check wiring inside of the indoor and outdoor units Y Is the connection right? N N The AP1 voltage detection circuit is at fault Y Correctly connect the corresponding wires for the indoor and outdoor units with reference to the wiring diagram Are wires broken? N If the fault is eliminated? N Check the communication circuit of the outdoor unit If the fault is eliminated? The communication circuit is abnormal Y Replace the main board AP1 of the outdoor unit N If the fault is eliminated? N Replace the main board of the indoor unit Y Y End Y 7URXEOHVKRRWLQJ $SSHQGL[5HVLVWDQFH7DEOHIRU,QGRRUDQG2XWGRRU$PELHQW7HPSHUDWXUH6HQVRUV. 7HPSć 5HVLVWDQFHNȍ 7HPSć 5HVLVWDQFHNȍ 7HPSć 5HVLVWDQFHNȍ 7HPSć 5HVLVWDQFHNȍ 7URXEOHVKRRWLQJ $SSHQGL[5HVLVWDQFH7DEOHIRU,QGRRUDQG2XWGRRU7XEH7HPSHUDWXUH6HQVRU. 7HPSć 5HVLVWDQFHNȍ 7HPSć 5HVLVWDQFHNȍ 7HPSć 5HVLVWDQFHNȍ 7HPSć 5HVLVWDQFHNȍ 1RWH7KHLQIRUPDWLRQDERYHLVIRUUHIHUHQFHRQO\ 5HPRYDO3URFHGXUH 5HPRYDO3URFHGXUH 5HPRYDO3URFHGXUHRI,QGRRU8QLW Warning Be sure to wait for a minimum of 10 minutes after turning off all power supplies before disassembly. 1. Before disassembly of the unit 2. Remove filter and horizontal louver 1 2 Open the panel. Loosen clasps on filter and then remove the filter. filter 3 Remove axial bush on horizontal louver, and bend the horizontal louver slightly to remove it. horizontal louver 5HPRYDO3URFHGXUH 3. Remove display and panel 1 display Remove screws on display and then remove the display. screw rotation shaft 2 front panel assy Quit the rotation shaft of panel from groove, and then remove the panel. 4. Remove electric box cover 2 screw Remove screws connecting electric box cover 2 and front case, and then remove the electric box cover 2. electric box cover 2 5HPRYDO3URFHGXUH 5. Remove front case 1 Remove screws connecting front case and bottom case. screw clasp 2 Open screw cover by hand, remove other 3 screws, loosen clasps connecting front case and bottom case and then remove the front case. 6. Remove swing blade 1 Remove 10 clasps connecting swing blade and bottom case. swing blade 2 Remove swing blade. clasp 5HPRYDO3URFHGXUH 7. Remove electric box 1 indoor temperature sensor Pull out the indoor temperature sensor. electric box cover 2 Remove screws connecting electric box and bottom case, loosen clasps, remove screws connecting earthing wire and evaporator, and then remove the electric box. electric box 8. Remove evaporator pipe clamp auxiliary piping 1 Turn over bottom case, remove screws connecting pipe clamp and bottom case, loosen clasps between connecting pipe clamp and bottom case, and then remove the connecting pipe clamp. 2 Remove screws connecting evaporator and motor press plate and bottom case, loosen clasps fixing evaporator and bottom case, adjust the pipeline and then remove the evaporator. evaporator 5HPRYDO3URFHGXUH 9. Remove cross flow blade and motor 1 Remove screws on stepping motor, and then remove the stepping motor. stepping motor 2 Remove 4 screws connecting motor press plate and bottom case, and then remove motor press plate. motor press plate 3 Remove cross flow blade and motor. O-Gasket sub-assy of Bearing 4 Remove shaft rubber cushion block. ring of bearing 5 Remove screws connecting cross flow blade and motor shaft, and then remove motor. cross flow blade fan mtor 5HPRYDO3URFHGXUH 5HPRYDO3URFHGXUHRI2XWGRRU8QLW Warning Be sure to wait for a minimum of 10 minutes after turning off all power supplies before disassembly. 1. Remove big handle 1 2 Before disassembly Remove 1 connection screw fixing big handleand then removethe big handle. Handle 2. Remove top cover plate Top panel Remove 3 connection screws among top cover plate, front panel and right sideplate. Then remove top cover plate. 5HPRYDO3URFHGXUH 3. Remove front grill and front panel 1 Remove 2 connection screws between front grill and front panel. Then remove front panel. 2 Remove 5 connection screws among front panel, chassis and motor support. Then remove front panel. front grill front panel 4. Remove axial flow fan blade axial flow fan blade Remove nut of fan blade, and then remove axial flow fan blade. 5. Remove right side plate right side plate Remove 7 connection screws among right side plate, chassis, valve support and electric box. 5HPRYDO3URFHGXUH 6. Remove electric box assy Electric box assy Remove the 2 screws fixing the cover of electric box. Lift to remove the cover. Loosen the wire and disconnect the terminal. Lift to remove the electric box assy. 7. Disassemble 4-way Valve Assy Unscrew the fastening nut of the 4-way Valve Assy coil and remove the coil. Wrap the 4- 4-way Valve Assy way Valve Assy with wet cotton and unsolder the 4 weld spots connecting the 4-way Valve Assy to take it out.(Note: Refrigerant should be discharged firstly.) Welding process should be as quickly as possible and keep wrapping cotton wet all the time. Be sure not to burn out the lead-out wire of compressor. 8. Disassemble Capillary Sub-assy Unsolder weld point of capillary Sub-assy, Capillary Sub-assy valve and outlet pipe of condensator. Then remove the capillary Sub-assy. Do not block the capillary when unsoldering it. (Note: before unsoldering,discharge refrigerants completely) 5HPRYDO3URFHGXUH 9. Disassemble motor and motor support Motor support Remove the 4 tapping screws fixing the motor. Pull out the lead-out wire and remove the motor. Remove the 2 tapping screws fixing Motor the motor support. Lift motor support to remove it. 10. Disassemble Clapboard Sub-Assy Clapboard Sub-Assy Loosen the screws of the Clapboard Sub-Assy . The Clapboard Sub-Assy has a hook on the lower side. Lift and pull the Clapboard Sub-Assy to remove. 5HPRYDO3URFHGXUH 11. Disassemble Compressor 1 Remove the 2 screws fixing the gas valve. Unsolder the welding spot connecting gas valve and air return pipe and remove the gas valve. (Note: it is necessary to warp the gas valve when unsoldering the welding spot.) Remove the 2 screws fixing liquid valve. Unsolder the weld- Liquid valve ing spot connecting liquid valve and remove the liquid valve. Gas valve 2 Remove the 3 footing screws of the compressor and remove the compressor. Compressor -) GREE ELECTRIC APPLIANCES, INC. OF ZHUHAI Add: West Jinji Rd, Qianshan, Zhuhai, Guangdong, China, 519070 Tel: (+86-756) 8522218 Fax: (+86-756) 8669426 E-mail: [email protected] www.gree.com For continuous improvement in the products, Gree reserves the right to modidy the product specification and appearance in this manual without notice and without incurring any obligations.