Download SERVICE MANUAL - Amp Air
Transcript
Manual No. '10 • PAC - SM - 137 SERVICE MANUAL HYPER INVERTER PACKAGED AIR-CONDITIONERS (Split system, Air to air heat pump type) CEILING CASSETTE- 4 WAY COMPACT TYPE Triple type Twin type FDTC140VNXTVD FDTC71VNXPVD 140VSXTVD 100VNXPVD 100VSXPVD 125VNXPVD 125VSXPVD DUCT CONNECTED-LOW / MIDDLE STATIC PRESSURE TYPE Triple type Twin type Single type FDUM140VNXTVD FDUM100VNXPVD FDUM71VNXVD 140VSXTVD 100VSXPVD 100VNXVD 125VNXPVD 100VSXVD 125VSXPVD 125VNXVD 140VNXPVD 125VSXVD 140VSXPVD 140VNXVD 140VSXVD CEILING CASSETTE- 4 WAY TYPE Single type Twin type FDT71VNXVD FDT71VNXPVD 100VNXVD 100VNXPVD 100VSXVD 100VSXPVD 125VNXVD 125VNXPVD 125VSXVD 125VSXPVD 140VNXVD 140VNXPVD 140VSXVD 140VSXPVD DUCT CONNECTED-HIGH STATIC PRESSURE TYPE Single type FDU71VNXVD 100VNXVD 100VSXVD 125VNXVD 125VSXVD 140VNXVD 140VSXVD CEILING SUSPENDED TYPE Twin type Single type FDEN71VNXPVD FDEN71VNXVD 100VNXPVD 100VNXVD 100VSXPVD 100VSXVD 125VNXPVD 125VNXVD 125VSXPVD 125VSXVD 140VNXPVD 140VNXVD 140VSXPVD 140VSXVD Triple type FDT140VNXTVD 140VSXTVD Triple type FDEN140VNXTVD 140VSXTVD WALL MOUNTED TYPE Triple type Twin type SRK140VNXTZIX SRK100VNXPZIX 140VSXTZIX 100VSXPZIX 125VNXPZIX 125VSXPZIX '10 • PAC-SM-137 CONTENTS 1. OUTLINE OF OPERATION CONTROL BY MICROCOMPUTER ................. 3 1.1 Remote controller ................................................................................... 3 1.2 Operation control function by the wired remote controller ................ 5 1.3 Operation control function by the indoor controller ........................... 6 (1) FDTC,FDT,FDEN,FDUM and FDU series ............................................. 6 (2) SRK seies ............................................................................................. 16 1.4 Operation control function by the outdoor controller ........................ 20 2. MAINTENANCE DATA .................................................................................. 2.1 Diagnosing of microcomputer circuit ..................................................... (1) Selfdiagnosis function ............................................................................. (2) Troubleshooting procedure .................................................................... (3) Troubleshooting at the indoor unit ........................................................ (4) Troubleshooting at the outdoor unit ...................................................... (5) Check of anomalous operation data with the remote controller ............. 31 31 31 34 34 40 47 (6) Inspection display of wireless specification model (FDEN,FDT) ............. 48 (7) Power transistor module (including the driver PCB) inspection procedure ......... 49 (8) Inverter checker for diagnosis of inverter output ..................................... 50 (9) Outdoor unit controller failure diagnosis circuit diagram .................................. 51 2.2 Troubleshooting flow ............................................................................... 54 3. ELECTRICAL WIRING ...................................................................................101 (1) Indoor units ............................................................................................101 (2) Outdoor units .........................................................................................110 4. PIPING SYSTEM ............................................................................................113 5. APPLICATION DATA .....................................................................................116 5.1 Installation of indoor unit .......................................................................116 (1) Ceiling cassette-4way compact type (FDTC) ........................................116 (2) Ceiling cassette-4way type (FDT) .........................................................122 (3) Ceiling suspended type (FDEN) ............................................................128 (4) Duct connected-Low / Middle static pressure type (FDUM) ...................132 (5) Duct connected-High static pressure type (FDU) ..................................136 (6) Wall mounted type (SRK) .....................................................................140 - 1- '10 • PAC-SM-137 5.2 Instullation for wired remote controller ................................................144 5.3 Instullation of outdoor unit ...................................................................150 (1) Model FDC71VNX .................................................................................150 (2) Models FDC100㨪140VNX, 100㨪140VSX ...........................................158 5.4 Electric wiring work installation ...........................................................166 How to read the model name Example: FDT 125 VNX P V Series code (blank) : Single type P : Twin type T : Triple type Applicable power source...See the specification Product capacity Model name FDTC FDT FDEN FDUM FDU FDC Example: SRK 125 VNX : Ceiling cassette-4 way compact type : Ceiling cassette-4 way type : Ceiling suspended type : Duct connected-Low / Middle static pressure type : Duct connected-High static pressuret type : Outdoor unit P ZIX Series code P : Twin type T : Triple type Applicable power source...See the specification Product capacity Model name ާ Wall mounted type ި - 2- '10 • PAC-SM-137 1. OUTLINE OF OPERATION CONTROL BY MICROCOMPUTER 1.1 Remote controller (1) Wired remote controller The figure below shows the remote controller with the cover opened. Note that all the items that may be displayed in the liquid crystal display area are shown in the figure for the sake of explanation Characters displayed with dots in the liquid crystal display area are abbreviated. The figure below shows the remote control with the cover opened. Ventilaion display Displayed during ventilation operation Weekly timer display Displays the settings of the weekly timer. Centeal control display Displayed when the air conditioning system is controlled by centralized remote control. Operation setting display area Displays setting temperature, airflow volume, operation mode and oparation message. Timer operation display Displays the timer operation setting. Operation/check indicator light During oparation: Lit in green In case of error: Flashing in red Temperature setting buttons These buttons are used to set the temperature of the room. Operation/stop button This button is used to operate and stop the air conditioning system. Press the button once to operate the system and press it once again to stop the system. Timer button This button is used to set the timer mode. MODE button This button is used to change the operation mode. Timer setting buttons These buttons are used to set the timer mode and the time. FAN SPEED button This button is used to set the airflow volume. VENT button This button is used to operate external ventilator. GRILL button This button has no function. When this button is pressed, (Invalid Operation) is displayed, but it does not mean a failure. LOUVER button This button is used to operate/stop the swing louver. Cover AIR CON No. button Display the indoor unit number connected to this remote controller. SET button ٨ ٨ This button is used to fix the setting. This button is used to set the silent mode. CHECK button This button is used at servicing. RESET button Press this button while making settings to go back to the previous operation. This button is also used to reset the "FILTER CLEANING" display. (Press it after cleaning the air filter) ٨ TEST button This button is used during test operation. ٨ 䋪㩷All displays are described in the liguid crystal display for explanation. - 3- '10 • PAC-SM-137 (2) Wireless remote controller FDEN series only Indication section Indicates set temperature. Indicates the status of swing louver. Indicates selected operation with . Indicates the selected airflow volume Indicates for two seconds when FILTER button is pressed. Indicates when ON-TIMER is set. Indicates when OFF-TIMER is set. Indicates the ON-TIMER setting time. Nothing displayed when ON-TIMER is not set. Indicates OFF-TIMER setting time. Indicates the current time when the OFF-TIMER is not set. Operation section Sends signal to the air conditioner. When this is pressed once, the unit starts to operate and when this is pressed once again, it stops operating. Every time this button is pressed, the mode is switched as below. Used to swing the louver. Used to reset (turn off) the filter sign. Press the button only after completing the filter cleaning. Every time this button is pressed, as below. displays switch Sets ON TIMER operation. Sets room temperature by pressing Sets time when setting the time. Sets OFF TIMER operation. Used to cancel the TIMER SETTINGS. Sets current time. Used to reset the microcomputer. * All displays are described in the liquid crystal display for explanation - 4- or button. '10 • PAC-SM-137 1.2 Operation control function by the wired remote controller (1) Switching sequence of the operation mode switches of remote controller $29 #//, &!. (%!4 !54/ (2) [CPU reset] (3) This functions when “CHECK” and “GRILL” buttons on the remote controller are pressed simultaneously. Operation is same as that of the power supply reset. [Power failure compensation function]...Electric power supply failure • This becomes effective if “Power failure compensation effective” is selected with the setting of remote controller function. • Since it memorizes always the condition of remote controller, it starts operation according to the contents of memory no sooner than normal state is recovered after the power failure. Although the auto swing stop position and the timer mode are cancelled, the weekly timer setting is restored with the holiday setting for all weekdays. After recovering from the power failure, it readjusts the clock and resets the holiday setting for each weekday so that the setting of weekly timer becomes effective. • Content memorized with the power failure compensation are as follows. Note (1) Items, and are memorized regardless whether the power failure compensation is effective or not while the setting of silent mode is cancelled regardless whether the power failure compensation is effective or not. At power failure – Operating/stopped If it had been operating under the off timer mode, sleep timer mode, the state of stop is memorized. (Although the timer mode is cancelled at the recovery from power failure, the setting of weekly timer is changed to the holiday setting for all weekdays.) Operation mode $LUÀRZYROXPHPRGH Room temperature setting Louver auto swing/stop However, the stop position (4-position) is cancelled so that it returns to Position (1). “Remote controller function items” which have been set with the remote controller function setting (“Indoor function items” are saved in the memory of indoor unit.) Upper limit value and lower limit value which have been set with the temperature setting control Sleep timer and weekly timer settings (Other timer settings are not memorized.) [Parts layout on remote controller PCB] Master/ slave setting when more than one remote controllers are used A maximum of two remote controllers can be connected to one indoor unit (or one group of indoor units.) Switch Indoor units SW2 SW1 Setting Contents M Master remote controller S Slave remote controller Remote controller cord (no polarity) SW2 A Upper Master B Remote controller SW1 "Master" 親 M SW1 Remote controller SW1 "Slave" Slave Board Lower S SW1子 Set SW1 to "Slave" for the slave remote controller. It was factory set to "Master" for shipment. X Y Note: The setting "Remote controller thermistor enabled" is only selectable with the master remote controller in the position where you want to check room temperature. The air conditioner operation follows the last operation of the remote controller regardless of the master/ slave setting of it. Caution When using multiple remote controllers, the following dispiays or settings cannot be done with the slave remote controller. It is available only with the master remote controller. ޓLouver position setting (set upper or lower limit of swinging range) ޓSetting indoor unit functions ޓSetting temperature range ޓOperation data display ޓError data display ޓSilent mode setting ޓTest operation of drain pump ޓRemote controller sensor setting - 5- '10 • PAC-SM-137 1.3 Operation control function by the indoor controller (1) (a) FDTC, FDT, FDEN, FDUM and FDU series Auto operation If “Auto” mode is selected by the remote controller, the heating and the cooling are automatically switched according to the difference between outdoor air temperature and setting temperature and the difference between setting temperature and return air temperature. (When the switching of cooling mode ¢ heating mode takes place within 3 minutes, the compressor does not operate for 3 minutes by the control of 3-minute timer.) This will facilitate the cooling/heating switching operation in intermediate seasons and the adaptation to unmanned operation at stores, etc (ATM corner of bank). Cooling operation Heating operation -3 +3 Room temperature setting temperature Room temperature (detected with ThI-A) [deg] Note (1) Room temperature control during auto cooling/auto heating is performed according to the room temperature setting temperature. (DIFF: ±1 deg) (2) If the indoor heat exchanger temperature rises to 59°C or higher during Heating operation stopped (cooling) heating operation, it is switched automatically to cooling operation. In addition, for 1 hour after this switching, the heating operation is not Heating OK performed, regardless of the temperature shown at right. 56 59 Indoor heat exchanger temperature (°C) (b) Operations of functional items during cooling/heating Cooling Operation Functional item Heating Thermostat Thermostat ON OFF Fan Thermostat Thermostat ON OFF Hot start (Defrost) Dehumidify / Compressor 4-way valve () Outdoor unit fan () / Indoor unit fan / / / / Louver motor / / /× / / Drain pump (3) (2) / (2) (2) Thermostat ON: Thermostat OFF: (2) /: Turned ON/OFF by the control other than the room temperature control. Note (1) : Operation : Stop (2) ON during the drain motor delay control. (3) Drain pump ON setting may be selected with the indoor unit function setting of the wired remote controller. (c) Dehumidifying operation Return air temperature thermistor [ThI-A (by the remote controller when the remote controller thermistor is enabled)] controls the indoor temperature environment simultaneously. 1) Operation is started in the cooling mode. When the difference between the return air temperature and the setting temperature is 2°C or less, the indoor unit fan tap is brought down by one tap. That tap is retained for 3 minutes after changing the indoor unit fan tap. 2) If the return air temperature exceeds the setting temperature by 3°C during defrosting operation, the indoor unit fan tap is raised. That tap is retained for 3 minutes after changing the indoor unit fan tap. 3) If the thermostat OFF is established during the above control, the indoor unit fan tap at the thermostat ON is retained so far as the thermostat is turned OFF. 4) After stopping the cooling operation, the indoor unit continues to run at Lo for 15 seconds. - 6- '10 • PAC-SM-137 (d) Timer operation 1) Sleep timer Set the duration of time from the present to the time to turn off the air-conditioner. It can be selected from 10 steps in the range from “OFF 1 hour later” to “OFF 10 hours later”. After the sleep timer setting, the remaining time is displayed with progress of time in the unit of hour. 2) OFF timer Time to turn OFF the air-conditioner can be set in the unit of 10 minutes. 3) ON timer Time to turn ON the air-conditioner can be set. Indoor temperature can be set simultaneously. 4) Weekly timer Timer operation (ON timer, OFF timer) can be set up to 4 times a day for each weekday. 5) Timer operations which can be set in combination Item Item Sleep timer OFF timer ON timer Weekly timer Sleep timer OFF timer ON timer Weekly timer Note (1) : Allowed : Not (e) Remote controller display during the operation stop 1) (f) “Centralized control ON” is displayed always on the LCD under the “Center/Remote” and “Center” modes during the operation stop (Power ON). This is not displayed under the “Remote” mode. 2) If this display is not shown under the “Center/Remote” mode, check if the indoor unit power switch is turned on or not. Hot start (Cold draft prevention at heating) At the startup of heating operation, at resetting of the thermostat, during defrost operation and at returning to heating, the indoor fan is controlled by the indoor heat exchanger temperature (detected with ThI-R) for preventing the cold draft. Judgment by heating start thermostat Thermostat OFF Thermostat ON Set airflow volume Lo Fan Lo Set airflow volume Fan OFF 35 25 Indoor heat exchanger temperature (˚C) 35 Indoor heat exchanger temperature (˚C) Heat exchanger temp. 35˚C or higher, or after 7 minutes Heat exchanger temp. 35˚C or higher, or after 7 minutes Normal condition/Set airflow volume Compressor ON Compressor OFF Defrosting start End of defrosting Set airflow volume Lo Set airflow volume Fan OFF (1) Fan Lo 35 45 25 Indoor heat exchanger temperature (˚C) 35 45 Indoor heat exchanger temperature (˚C) 1RWH +HDWLQJSUHSDUDWLRQLVGLVSOD\HGGXULQJWKHKRWVWDUWZKHQWKHFRPSUHVVRULVRSHUDWLQJDQGWKHLQGRRUIDQGRHVQRWSURYLGHWKHVHWDLUÀRZYROXPH - 7- '10 • PAC-SM-137 (g) Hot keep Hot keep control is performed at the start of the defrost control. 1) Control a) (h) When the indoor heat exchanger temperature (detected with ThI-R1 or R2) drops to 35°C or lower, the speed of indoor fan is changed to the lower tap at each setting. b) During the hot keep, the louver horizontal control signal is transmitted. 2) Ending condition :KHQWKHLQGRRUIDQLVDWWKHORZHUWDSDWHDFKVHWWLQJLWUHWXUQVWRWKHVHWDLUÀRZYROXPHDVWKHLQGRRUKHDWH[FKDQJHU temperature rises to 45°C or higher. Fan control during the heating thermostat OFF When the heating thermostat is turned OFF, the setting of the fan control is selectable using the indoor function of wired remote controller [ 1) 2) 3) 4) (i) FAN CONTROL]. Low fan speed (Factory default) If the indoor heat exchanger temperature drops below 35°C with the heating thermostat OFF, the indoor fan operate at the lower speed tap at each setting. Set fan speed Even if the indoor heat exchanger temperature drops below 35°C with the heating thermostat OFF, the indoor fan FRQWLQXHVWRUXQDWWKHVHWDLUÀRZYROXPH Intermittence If the indoor heat exchanger temperature drops below 35°C with the heating thermostat OFF, the indoor fan operates at the lower speed tap at each setting and, when the indoor heater exchanger temperature drops below 25°C, the indoor fan stops for 5 minutes. Then the fan runs at the low speed tap for 2 minutes, and the judgment is made by the thermostat. Fan OFF If the indoor heat exchanger temperature drops below 35°C with the heating thermostat OFF, the indoor fan is turned OFF. The same applies also when the remote controller sensor is effective. Filter sign As the operation time (Total ON time of ON/OFF switch) accumulates to 180 hours (1), “FILTER CLEANING” is displayed on the remote controller. (This is displayed when the unit is in trouble and under the centralized control, regardless of ON/OFF) 1RWH7LPHVHWWLQJIRUWKH¿OWHUVLJQFDQEHPDGHDVVKRZQEHORZXVLQJWKHLQGRRUIXQFWLRQRIZLUHGUHPRWHFRQWUROOHU³),/7(56,*16(7´,WLVVHWDWDWWKH shipping from factory.) Filter sign setting Function TYPE 1 Setting time: 180 hrs (Factory default) TYPE 2 Setting time: 600 hrs TYPE 3 Setting time: 1,000 hrs TYPE 4 Setting time: 1,000 hrs (Unit stop) (2) (2) After the setting time has elapsed, the “FILTER CLEANING” is displayed and, after operating for 24 hours further (counted also during the stop), the unit stops. (j) Auto swing control [Applicable model: FDTC, FDT and FDEN] 1) Louver control a) Press the “LOUVER” button to operate the swing louver when the air conditioner is operating. “SWING E ” is displayed for 3 seconds and then the swing louver moves up and down continuously. 7R¿[WKHVZLQJORXYHUDWDSRVLWLRQSUHVVRQHWLPHWKH³/289(5´EXWWRQZKLOHWKHVZLQJORXYHULVPRYLQJVRWKDW four stop positions are displayed one after another per second. When a desired stop position is displayed, press the “LOUVER” button again. The display stops, changes to show the “STOP 1 c) ” for 5 seconds and then the swing louver stops. Louver operation at the power on with a unit having the louver 4-position control function The louver swings one time automatically (without operating the remote controller) at the power on. This allows inputting the louver motor (LM) position, which is necessary for the microcomputer to recognize the louver position. Note (1) If you press the “LOUVER” button, the swing motion is displayed on the louver position LCD for 10 second. The display changes to the ” display 3 seconds later. “SWING - 8- '10 • PAC-SM-137 2) Automatic louver level setting during heating 3) At the hot start with the heating thermostat OFF, regardless whether the auto swing switch is operated or not (auto swing or louver stop), the louver takes the level position (In order to prevent the cold start). The louver position display LCD continues to show the display which has been shown before entering this control. Louver-free stop control When the louver-free stop has been selected with the indoor function of wired remote controller “ POSITION”, the louver motor stops when it receives the stop signal from the remote controller. If the auto swing signal is received from the remote controller, the auto swing will start from the position where it was before the stop. Note (1) When the indoor function of wired remote controller “ POSITION” has been switched, switch also the remote control function “ POSITION” in the same way. (k) Compressor inching prevention control 1) 3-minute timer When the compressor has been stopped by the thermostat, remote controller operation switch or anomalous condition, 2) its restart will be inhibited for 3 minutes. However, the 3-minute timer is invalidated at the power on the electric power source for the unit. 3-minute forced operation timer • Compressor will not stop for 3 minutes after the compressor ON. However, it stops immediately when the unit is stopped by means of the ON/OFF switch or by when the thermister turned OFF the change of operation mode. • If the thermostat is turned OFF during the forced operation control of heating compressor, the louver position (with the auto swing) is returned to the level position. Note (1) The compressor stops when it has entered the protective control. (l) Drain motor (DM) control [Applicable model: FDTC, FDT and FDUM] 1) Drain motor (DM) is operated during the cooling or dehumidifying mode operations and simultaneously with the compressor ON. The DM continues to operate for 5 minutes after the operation stop, anomalous stop, thermostat stop or when it was switched from the cooling and dehumidifying operations to the fan or heating operation. Indoor unit operation mode Stop (1) Cooling Dehumidifying Compressor ON Compressor OFF a) Fan (2) Control A Heating Note (1) Including the stop from the cooling, dehumidifying, fan and heating, and the anomalous stop (2) Including the “Fan” operation according to the mismatch of operation modes Control B Control A L b) ,IWKHÀRDWVZLWFKGHWHFWVDQ\DQRPDORXVGUDLQLQJFRQGLWLRQWKHXQLWVWRSVZLWKWKHDQRPDORXVVWRSGLVSOD\V E9) and the drain pump starts. After detecting the anomalous condition, the drain motor continues to be ON. LL ,WNHHSVRSHUDWLQJZKLOHWKHÀRDWVZLWFKLVGHWHFWLQJWKHDQRPDORXVFRQGLWLRQ Control B ,I WKH ÀRDW VZLWFK GHWHFWV DQ\ DQRPDORXV GUDLQ FRQGLWLRQ WKH GUDLQ PRWRU LV WXUQHG 21 IRU PLQXWHV DQG DW VHFRQGVDIWHUWKHGUDLQPRWRU2))LWFKHFNVWKHÀRDWVZLWFK,ILWLVQRUPDOWKHXQLWLVVWRSSHGXQGHUWKHQRUPDO mode or, if there is any anomalous condition, E9 is displayed and the drain motor is turned ON. (The ON condition is maintained during the drain detection.) 2) Drain motor (DM) interlock control a) Start conditions Depending on the function setting by the remote controller, the drain motor is turned ON under either one of the following conditions. i) During heating mode operation (Both the thermostat ON/OFF) ii) During heating mode operation (Both the thermostat ON/OFF) + Fan operation iii) Fan operation b) End conditions The drain motor is turned OFF 5 minutes after the stop of operations i) to iii) above. (m) Operation check/drain pump test run operation mode 1) 2) If the power is turned on by the dip switch (SW7-1) on the indoor PCB when electric power source is supplied, it enters the mode of operation check/drain pump test run. It is ineffective (prohibited) to change the switch after turning power on. When the communication with the remote controller has been established within 60 seconds after turning power on by the dip switch (SW7-1) ON, it enters the operation check mode. Unless the remote controller communication is established, it enters the drain pump test run mode. Note (1) To select the drain pump test run mode, disconnect the remote controller connector (CNB) on the indoor PCB to shut down the remote controller communication. - 9- '10 • PAC-SM-137 3) (n) Operation check mode There is no communication with the outdoor unit but it allows performing operation in respective modes by operating the remote controller. 4) Drain pump test run mode As the drain pump test run is established, the drain pump only operates and during the operation protective functions by the microcomputer of indoor unit become ineffective. Cooling, dehumidifying frost protection 1) To prevent frosting during cooling mode or dehumidifying mode operation, the of compressor speed is reduced if the indoor heat exchanger temperature (detected with ThI-R) drops to 1.0 °C or lower at 4 minutes after the start of compressor operation. If the indoor unit heat exchanger temperature is 1.0 °C or lower after 1 minutes, the compressor speed is reduced further. If it becomes 2.5 °C or higher, the control terminates. When the indoor heat exchanger temperature has become as show below after reducing the compressor speed, it is switched to the fan operation. For the selection of indoor fan speed, refer to item 2). Cooling operation Fan operation 1.0 10 Indoor heat exchanger temperature (°C) 2) Selection of indoor fan speed If it enters the frost prevention control during cooling operation (excluding dehumidifying), the indoor unit fan speed is switched. (a) In cases of FDUM, FDU and FDEN i) When the indoor unit return air temperature (detected with ThI-A) is 23°C or lower, this control is invalidated and, as 2 hours elapse after starting the frost prevention control, it is terminated. ii) If it is detected again within 15 minutes from the start of frost prevention control, the indoor fan speed is raised by 1 tap to increase the indoor unit fan speed. If it is detected within further 15 minutes, the indoor unit fan speed is raised by 1 tap more. Note (1) Indoor unit fan speed can be increased by up to 2 taps. b) iii) “ FAN SPEED SW VALID/INVALID” of this control is selectable with the function setting of remote controller. In the case of FDT and FDTC i) When the indoor return air detection temperature (detected with ThI-A) is 23°C or higher and the indoor heat exchanger temperature (detected with ThI-R) detects the compressor frequency drop start temperature A°C+1°C, of indoor unit fan speed is increased by 20rpm. ii) If the phenomenon of i) above is detected again after the acceleration of indoor unit fan, indoor unit fan speed is increased further by 20rpm. Note (1) Indoor unit fan speed can be increased by up to 2 taps. • Compressor frequency drop start temperature Symbol Item Temperature - Low (Factory default) Temperature - High A 1.0 2.5 Note (1) Frost prevention temperature setting can be selected with the indoor unit function setting of the wired remote controller. (o) Heating overload protection 1) If the indoor heat exchanger temperature (detected with ThI-R) at 63°C or higher is detected for 2 seconds continuously, the compressor stops. When the compressor is restarted after a 3-minute delay, if a temperature at 63°C or higher is detected for 2 seconds continuously within 60 minutes after initial detection and if this is detected 5 times consecutively, the compressor stops with the anomalous stop (E8). Anomalous stop occurs also when the indoor heat exchanger temperature at 63°C or higher is detected for 6 minutes continuously. Compressor OFF Compressor ON 56 63 Indoor heat exchanger temperature (°C) 2) Indoor unit fan speed selection If, after second detection of heating overload protection up to fourth, the indoor fan is set at Me and Lo taps when the compressor is turned ON, the indoor fan speed is increased by 1 tap. - 10 - '10 • PAC-SM-137 (p) Anomalous fan motor [In case of FDT, FDTC only] (q) After starting the fan motor, if the fan motor speed is 200rpm or less is detected for 30 seconds continuously and 4 times within 60 minutes, then fan motor stops with the anomalous stop (E16). Plural unit control – Control of 16 units group by one remote controller 1) Function One remote controller switch can control a group of multiple number of unit (Max. 16 indoor units). “Operation mode” which is set by the remote controller switch can operate or stop all units in the group one after another in the order of unit No.(1). Thermostat and protective function of each unit function independently. Note (1) Unit No. is set by SW2 on the indoor unit control PCB. Unit No. setting by SW2 is necessary for the indoor unit only. In cases of the twin, triple and double-twin specification, it is necessary set for the master and the slave units. This can be selected by SW5. (All are set for the master unit at the shipping from factory.) SW2: For setting of 0 – 9, A – F SW5: For setting of master and slave units (See table shown at right.) SW5 setting Switch SW5-1 SW5-2 Master unit OFF OFF Slave unit a OFF ON Slave unit b ON OFF Slave unit c ON ON Unit Outdoor unit Signal wiring between outdoor unit and indoor units Refrigerant piping 0 1 2 4 3 (Master unit) 4 (Slave unit a) 4 (Slave unit b) 4 (Slave unit c) F Indoor unit R Remote controller wiring Remote controller (2) Unit No. may be set at random unless duplicated, it should be better to set orderly like 0, 1, 2…, F to avoid mistake. 2) (r) Display to the remote controller a) Center or each remote controller basis, heating preparation: the youngest unit No. among the operating units in the remote mode (or the center mode unless the remote mode is available) is displayed. b) Inspection display, filter sign: Any of unit that starts initially is displayed. c) Confirmation of connected units Pressing “AIR CON No.” button on the remote controller displays the indoor unit address. If “S” “T” button is pressed at the next, it is displayed orderly starting from the unit of youngest No. d) In case of anomaly i) If any anomaly occurs on a unit in a group (a protective function operates), that unit stops with the anomalous stop but any other normal units continue to run as they are. ii) Signal wiring procedure Signal wiring between indoor and outdoor units should be made on each unit same as the normal wiring. For the group control, lay connect with sires wiring between rooms using terminal blocks (X, Y) of remote controller. Connect the remote controller communication wire separately from the power supply wire or wires of other electric devices (AC220V or higher). High ceiling control In the case of indoor unit installed in a higher ceiling room, the airflow volume mode control can be changed with the wired remote controller indoor unit function “FAN SPEED SET”. Indoor unit airflow setting UH - Hi - Me - Lo Hi - Me - Lo Hi - Lo Hi - Me STANDARD FAN SPEED SET HIGH SPEED1, 2 UH - UH - Hi - Me UH - Hi - Me UH - Me UH - Hi Fan tap Note (1) Factory default is Standard. (2) At the hot-start and heating thermostat OFF, or other, the indoor unit fan is operated at the low speed tap of each setting. - 11 - '10 • PAC-SM-137 (s) Abnormal temperature thermistor (return air/indoor heat exchanger) wire/short-circuit detection 1) Broken wire detection When the return air temperature thermistor detects -50°C or lower or the heat exchanger temperature thermistor detect -50°C or lower for 5 seconds continuously, the compressor stops. After a 3-minute delay, the compressor restarts but, if it is detected again within 60 minutes after the initial detection for 6 minutes continuously, stops again (the return air temperature thermistor: E7, the heat exchanger temperature thermistor: E6). 2) Short-circuit detection If the heat exchanger temperature thermistor detects 70°C or higher for 5 seconds continuously at 2 minutes and 20 seconds after the compressor ON during cooling operation, the compressor stops (E6). (t) Operation permission/prohibition (In case of adopting card key switches or commercially available timers) When the indoor function setting of wired remote controller for “Operation permission/prohibition” is changed from “Invalid (Factory default)” to “ Valid”, following control becomes effective. 1 2 CnT Blue 12V Optional XR1 3 4 5 XR2 XR3 Card key switch XR5 XR4 6 XR5 Normal operation (Factory default) CnT-6 *1 Operation permission/prohibition mode “Valid” (Local setting) ON OFF ON OFF Operation Stop Operation permission*1 Operation prohibition (Unit stops) Only the “LEVEL INPUT” is acceptable for external input, however when the indoor function setting of “Level input (Factory default)” or “Pulse input” is selected by the function for “External input” of the wired remote controller, operation status will be changed as follows. *(1) *(2) (3) In case of “Level input” setting In case of “Pulse input” setting Unit operation from the wired remote controller becomes available*(1) Unit starts operation *(2) In case that “Operation permission/prohibition mode” setting is “Valid” and “External input” setting is “Level input (Factory default)”; ① When card key switch is ON (CnT-6 ON: Operation permission), start/stop operation of the unit from the wired remote controller becomes available. ② When card key switch is OFF (CnT-6 OFF: Operation prohibition), the unit stops operation in conjunction with OFF signal, and start/stop operation of the unit from the wired remote controller becomes not available. In case that “Operation permission/prohibition mode” setting is “Valid” and “External input” setting is “Pulse input (Local setting)”; ① When card key switch is ON (Operation permission), the unit starts operation in conjunction with ON signal. and also start/stop operation of the unit from the wired remote controller becomes available. ② When card key switch is OFF (Operation prohibition), the unit stops operation in conjunction with OFF signal, and start/stop operation of the unit from the wired remote controller becomes not available. This function is invalid only at “Center mode” setting done by central controller. - 12 - '10 • PAC-SM-137 (u) External input/output control (CnT) Be sure to connect the wired remote controller to the indoor unit. Without wired remote controller remote operation by CnT is not possible to perform. 1 2 CnT Blue 12V Optional ①Operation output XR1 ②Heating output (CnT-3: XR2) ③Thermostat ON output (CnT-4: XR3) ④Error output (CnT-5: XR4) ⑤Remote operation input (CnT-6: No-voltage contactor) 3 4 5 XR2 XR3 XR4 6 (CnT-2: XR1) XR5 1) 2) Output for external control (remote display) Following output connectors (CnT) are provided on the indoor control PCB for monitoring operation status. ① Operation output: Outputs DC12V signal for driving relay during operation ② Heating output: Outputs DC12V signal for driving relay during heating operation ③ Thermostat ON output: Outputs DC12V signal for driving relay when compressor is operating. ④ Error output: Outputs DC12V signal for driving relay when anomalous condition occurs. Remote operation input Remote operation input connector (CnT-6) is provided on the indoor control PCB. However remote operation by CnT-6 is not effective, when “Center mode” is selected by center controller. In case of plural unit (twin, triple, double twin), remote operation input to CnT-6 on the slave indoor unit is invalid. Only the “LEVEL INPUT” is acceptable for external input, however when the indoor function setting of “Level input (Factory default)” or “Pulse input” is selected by the function for “External input” of the wired remote controller, operation status will be changed as follows. a) In case of “Level input” setting (Factory default) ,QSXWVLJQDOWR&Q7LV2))ĺ21««XQLW21 ,QSXWVLJQDOWR&Q7LV21ĺ2))««XQLW2)) Operation is not inverted. ON CnT-6 input ON OFF OFF OFF ON Unit A ON OFF OFF OFF ON ON Unit B OFF OFF Note: The latest operation has priority b) It is available to operate/stop by remote controller or center controller In case of “Pulse input” setting (Local setting) ,WLVHIIHFWLYHRQO\ZKHQWKHLQSXWVLJQDOWR&Q7LVFKDQJHG2))ĺ21DQGDWWKDWWLPHXQLWRSHUDWLRQ>212))@LV inverted. ON ON CnT-6 input OFF OFF OFF ON Unit A OFF OFF ON ON Unit B OFF - 13 - '10 • PAC-SM-137 3) Remote operation a) In case of multiple units (Max. 16 indoor units group) are connected to one wired remote controller When the indoor function setting of wired remote controller for “External control set” is changed from “Individual (Factory default)” to “ For all units”, all units connected in one wired remote controller system can be controlled by external operation input. Outdoor unit Outdoor unit Outdoor unit Outdoor unit ① ② ③ ④ 123 123 Signal & Power 123 123 123 123 Outdoor unit Ⓝ Refrigerant piping 123 123 XY Indoor unit ① XY Cn External input 123 XY XY Indoor unit ② Indoor unit ③ Wired remote controller 123 XY XY Indoor unit Indoor unit ④䇭(master) ④䇭(slave) CnT-6 Only the unit directly connected to the remote controller can be operated. Unit ① only 123 123 XY XY XY Indoor unit ④䇭(slave) Indoor unit ④䇭(slave) Indoor unit Ⓝ Ex. Indoor units = ①+②+③+④x4+……Ⓝ ≦16 units Individual operation (Factory default) ON 123 All units operation (Local setting) OFF Only the unit directly connected to the remote controller can be stopped opeartion. Unit ① only ON All units in one remote controller system can be operated. Units ①−Ⓝ OFF All units in one remote controller system can be stopped operation. Units ①−Ⓝ When more than one indoor unit (Max. 16 indoor units) are connected in one wired remote controller system: (1) With the factory default, external input to CnT-6 is effective for only the unit ①. (2) When setting “For all unit” (Local setting), all units in one remote controller system can be controlled by external input to CnT-6 on the indoor unit ①. (3) (v) External input to CnT-6 on the other indoor unit than the unit ① is not effective. Fan control at heating startup (Applicable model: FDTC and FDT) 1) 2) 3) Start conditions At the start of heating operation, if the difference of setting temperature and return air temperature is 5°C or higher after the end of hot start control, this control is performed. Contents of control a) Sampling is made at each minute and, when the indoor unit heat exchanger temperature (detected with ThI-R) is 37°C or higher, present number of revolutions of indoor unit fan speed is increased by 10min-1. b) If the indoor unit heat exchanger temperature drops below 37°C at next sampling, present number of revolutions of indoor unit fan speed is reduced by 10min-1. End conditions ,QGRRUIDQVSHHGLVUHGXFHGWRWKHVHWWLQJDLUÀRZYROXPHZKHQWKHFRPSUHVVRU2))LVHVWDEOLVKHGDQGDWPLQXWHVDIWHU the start of heating operation. - 14 - '10 • PAC-SM-137 (w) Room temperature detection temperature compensation during heating :LWKWKHVWDQGDUGVSHFL¿FDWLRQWKHFRPSUHVVRULVWXUQHG212))ZLWKWKHWKHUPRVWDWVHWWLQJWHPSHUDWXUH:KHQWKHWKHUPRVWDW is likely to turn OFF earlier because the unit is installed at the ceiling where warm air tends to accumulate, the setting can be changed with the wired remote controller indoor unit function “ ”. The compressor and the heater are turned ON/OFF at one of the setting temperature +3, +2 or +1°C in order to improve the feeling of heating. The setting temperature, however, has the upper limit of 30°C. Standard Operation Compressor When it is set at +3°C Compressor Operation Stop -1 Stop +1 +2 Setting temperature Room temperature (deg) (x) +4 Setting temperature Room temperature (deg) Return air temperature compensation This is the function to compensate the deviation between the detection temperature by the return air temperature thermistor and the measured temperature after installing the unit. 1) It is adjustable in the unit of 0.5°C with the wired remote controller indoor unit function “RETURN AIR TEMP”. • +1.0°C, +1.5°C, +2.0°C 2) • -1.0°C, -1.5°C, -2.0°C Compensated temperature is transmitted to the remote controller and the compressor to control them. Note (1) The detection temperature compensation is effective on the indoor unit thermistor only. - 15 - '10 • PAC-SM-137 (2) SRK series (a) Unit ON/OFF button If the remote control is malfunctioning, this button may be used to turn the unit on and off. 1) Operation Push the button once to place the unit in the automatic mode. Push it once more to turn the unit off. 2) Details of operation The unit will go into the automatic mode in which it automatically determines, from room temperature (as detected by sensor), whether to go into the cooling, thermal dry or heating modes. Function Roon temperature Fan speed Swing contral Timer switch setting Operation mode Cooling About 24ºC Thermal dry About 25ºC Heating About 26ºC Auto Auto Continuous Unit ON/OFF button (b) Auto restart function 1) Auto restart function records the operational status of the air-conditioner immediately prior to be switched off by a power cut, and then automatically resumes operations after the power has been restored. 2) The following settings will be cancelled: Jumper wire (J170) • Timer settings Notes (1) Auto restart function is set at on when the air-conditioner is shipped from the factory. Consult with your dealer if this function needs to be switched off. (2) When power failure occurs, the timer setting is cancelled. Once power is resumed, reset the timer. (3) If the jumper wire (J170) “AUTO RESTART” is cut, auto restart is disabled. (See the diagram at right) (c) Auto swing control 1) Louver control a) Press the “LOUVER” button to operate the swing louver when the air conditioner is operating. “AUTO E ” is displayed for 3 seconds and then the swing louver moves up and down continuously. 7R¿[WKHVZLQJORXYHUDWDSRVLWLRQSUHVVRQHWLPHWKH³/289(5´EXWWRQZKLOHWKHVZLQJORXYHULVPRYLQJVRWKDW four stop positions are displayed one after another per second. When a desired stop position is displayed, press the “LOUVER” button again. The display stops, changes to show the “STOP 1 2) ” for 5 seconds and then the swing louver stops. Automatic louver level setting during heating At the hot start with the heating thermostat OFF, regardless whether the auto swing switch is operated or not (auto swing or louver stop), the louver takes the level position (In order to prevent the cold start). The louver position display LCD continues to show the display which has been shown before entering this control. 3) Louver-free stop control When the louver-free stop has been selected with the indoor function of wired remote controller “ POSITION”, the louver motor stops when it receives the stop signal from the remote controller. If the auto swing signal is received from the remote controller, the auto swing will start from the position where it was before the stop. Note (1) When the indoor function of wired remote controller “Louver control setting” has been switched, switch also the remote control function “ POSITION” in the same way. - 16 - '10 • PAC-SM-137 (d) Timer operation 1) Timer Set the duration of time from the present to the time to turn off the air-conditioner. It can be selected from 10 steps in the range from “OFF 1 hour later” to “OFF 10 hours later”. After the clock timer setting, the remaining time is displayed with progress of time in the unit of hour. 2) OFF timer Time to turn OFF the air-conditioner can be set in the unit of 10 minutes. 3) ON timer Time to turn ON the air-conditioner can be set. Indoor temperature can be set simultaneously. 4) Weekly timer Timer operation (ON timer, OFF timer) can be set up to 4 times a day for each weekday. 5) Timer operations which can be set in combination Item Item Timer OFF timer ON timer Weekly timer Timer OFF timer ON timer Weekly timer Note (1) : Allowed : Not (e) Remote controller display during the operation stop 1) “Centralized control ON” is displayed always on the LCD under the “Center/Remote” and “Center” modes during the operation stop (Power ON). This is not displayed under the “Remote” mode. 2) If this display is not shown under the “Center/Remote” mode, check if the indoor unit power switch is turned on or not. (f) Outline of heating or cooling operation 1) Operation of major functional components in heating mode Heating 2) Thermostat ON Thermostat OFF Failure Compressor ON OFF OFF Indoor fan motor ON Outdoor fan motor ON OFF OFF 4-way valve ON ON OFF (3 minutes ON) ON(HOT KEEP) OFF Operation of major functional components in Cooling mode Cooling (g) Thermostat ON Thermostat OFF Failure Compressor ON OFF OFF Indoor fan motor ON ON OFF Outdoor fan motor ON OFF OFF (few minutes ON) 4-way valve OFF OFF OFF Frost prevention control 1) Operating conditions a) Indoor heat exchanger temperature (Th2) is lower than 5ºC. b) 5 minutes after reaching the compressor command speed except 0 rps. 2) Detail of anti-frost operation Indoor heat exchanger temperature Item Lower limit speed 5°C or lower 2.5°C or lower 25 rps 0rps Protects the fan tap just before Indoor fan Depends on operation mode Outdoor fan 4-way valve Depends on operation mode OFF frost prevention control Depends on stop mode Compressor command speed Lower limit speed 0 rps 2.5 Notes (1) When the indoor heat exchanger temperature is in the range of 2.5~5 ºC, the speed is reduced by 4 rps at each 20 seconds. (2) When the temperature is lower than 2.5 ºC, the compressor is stopped. (3) When the indoor heat exchanger temperature is in the range of 5~8 ºC, the compressor command speed is been maintained. - 17 - 5 8 Indoor heat exchanger temperature (C) '10 • PAC-SM-137 5HVHWFRQGLWLRQV:KHQHLWKHURIWKHIROORZLQJFRQGLWLRQLVVDWLV¿HG a) The indoor heat exchanger temperature (Th2) is 8ºC or higher. b) The compressor command speed is 0 rps. (h) Indoor fan motor protection When the air conditioner is operating and the indoor fan motor is turned ON, if the indoor fan motor has operated at 300 rpm or XQGHUIRUPRUHWKDQVHFRQGVWKHXQLWHQWHUV¿UVWLQWKHVWRSPRGHDQGWKHQVWRSVWKHHQWLUHV\VWHP (i) Serial signal transmission error protection (a) Purpose: Prevents malfunction resulting from error on the indoor l outdoor signals. (b) Detail of operation: If the compressor is operating and a serial signal cannot be received from the indoor control with outdoor control having serial signals continues for 7 minute and 35 seconds, the compressor is stopped. After the compressor has been stopped, it will be restarted after the compressor start delay if a serial signal can be received again from the indoor control. (j) Plural unit control – Control of 16 units group by one remote controller 1) Function One remote controller switch can control a group of multiple number of unit (Max. 16 indoor units). “Operation mode” which is set by the remote controller switch can operate or stop all units in the group one after another in the order of unit No.(1). Thermostat and protective function of each unit function independently. Note (1) Unit No. is set by SW1 on the interface PCB. Unit No. setting by SW1 is necessary for the interface only. In cases of the twin and triple VSHFL¿FDWLRQLWLVQHFHVVDU\VHWIRUWKHPDVWHUDQGWKHVODYHXQLWV7KLVFDQEHVHOHFWHGE\6:$OODUHVHWIRUWKHPDVWHUXQLWDWWKHVKLSSLQJ from factory.) SW1: For setting of 0 – 9, A – F SW3: For setting of master and slave units (See table shown at right.) SW3 setting (For interface PCB) Switch SW3-1 SW3-2 Master OFF OFF Stave1 OFF ON Stave2 ON OFF Unit Outdoor unit Signal wiring between outdoor unit and indoor units Refrigerant piping (Master unit) Indoor unit Connection cable Interfase kit 0 R 1 2 3 (Slave unit 1) (Slave unit 2) 4 5 6 (Master) (Slave 1) (Slave 2) F Remote controller wiring Remote controller 8QLW1RPD\EHVHWDWUDQGRPXQOHVVGXSOLFDWHGLWVKRXOGEHEHWWHUWRVHWRUGHUO\OLNH«)WRDYRLGPLVWDNH 2) Display to the remote controller a) Center or each remote controller basis, heating preparation: the youngest unit No. among the operating units in the remote mode (or the center mode unless the remote mode is available) is displayed. b) Inspection display: Any of unit that starts initially is displayed. F &RQ¿UPDWLRQRIFRQQHFWHGXQLWV Pressing “AIR CON No.” button on the remote controller displays the indoor unit address. If “S” “T” button is pressed at the next, it is displayed orderly starting from the unit of youngest No. - 18 - '10 • PAC-SM-137 d) (k) In case of anomaly i) If any anomaly occurs on a unit in a group (a protective function operates), that unit stops with the anomalous stop but any other normal units continue to run as they are. ii) Signal wiring procedure Signal wiring between indoor and outdoor units should be made on each unit same as the normal wiring. For the group control, lay connect with sires wiring between rooms using terminal blocks (X, Y) of interface kit. Connect the remote controller communication wire separately from the power supply wire or wires of other electric devices (AC220V or higher). Filter sign As the operation time (Total ON time of ON/OFF switch) accumulates to 180 hours (1), “Filter cleaning” is displayed on the remote controller. (This is displayed when the unit is in trouble and under the centralized control, regardless of ON/OFF) 1RWH7LPHVHWWLQJIRUWKH¿OWHUVLJQFDQEHPDGHDVVKRZQEHORZXVLQJWKHLQGRRUIXQFWLRQRIZLUHGUHPRWHFRQWUROOHU³),/7(56,*16(7´,WLVVHWDWDWWKH shipping from factory.) Filter sign setting Function Setting 1 Setting time: 180 hrs (Factory default) Setting 2 Setting time: 600 hrs Setting 3 Setting time: 1,000 hrs Setting 4 Setting time: 1,000 hrs (Unit stop) (2) (2) After the setting time has elapsed, the “FILTER CLEANING” is displayed and, after operating for 24 hours further (counted also during the stop), the unit stops. - 19 - '10 • PAC-SM-137 1.4 Operation control function by the outdoor controller (1) Determination of compressor speed (frequency) Required frequency (a) Cooling/dehumidifying operation Unit: rps Model Max. required frequency 71 100 125 140 Indoor unit air flow “P-Hi”, “Hi” 88 75 95 95 Indoor unit air flow “Me”, “Lo” 80 60 60 70 20 20 20 20 71 100 125 140 Indoor unit air flow “P-Hi”, “Hi” 112 120 120 120 Indoor unit air flow “Me”, “Lo” 90 60 70 70 20 20 20 20 Min. required frequency (b) Heating operation Unit: rps Model Max. required frequency Min. required frequency (c) (d) If “Silent mode start” signal is received from the remote controller, the maximum required frequency becomes same as when the indoor air flow is set at “Lo”. Max. required frequency under high outdoor air temperature in cooling mode Maximum required frequency is selected according to the outdoor air temperature (Tho-A). Unit: rps Model Outdoor air temperature is 40°C or higher Outdoor air temperature is 46°C or higher Max. required frequency (e) 71 100 125 140 76 75 75 75 62 75 70 70 Max. required frequency under outdoor air temperature in heating mode Maximum required frequency is selected according to the outdoor air temperature (Tho-A). Unit: rps Model Outdoor air temperature is 18°C or higher Max. required frequency (f) (h) (2) 100 125 140 76 60 80 85 Selection of max. required frequency by heat exchanger temperature 1) Maximum required frequency is selected according to the outdoor unit heat exchanger temperature (Tho-R) during cooling/dehumidifying or according to the indoor unit heat exchanger temperature (ThI-R) during heating mode. 2) When there are 3 indoor unit heat exchanger temperatures (ThI-R), whichever the highest applies, Unit: rps Max. required frequency (g) 71 Model Cooling/ dehumidifying Heating Outdoor unit heat exchanger temperature is 56°C or higher Indoor unit heat exchanger temperature is 56°C or higher 71 100 125 140 – – – – – 100 100 100 When any of the controls from (a) to (f) above may duplicate, whichever the smallest value among duplicated controls is taken as the maximum required frequency. During heating, it is operated with the maximum required frequency until the indoor unit heat exchanger temperature becomes 40°C or higher. Compressor start control (a) (b) Compressor starts upon receipt of the thermostat ON signal from the indoor unit. However, at initial start after turning the power supply breaker, it may enter the standby state for maximum 30 minutes (“ PREPARATION” is displayed on the remote controller) in order to prevent the oil loss in the compressor. If the cooling/dehumidifying/heating operation is selected from the remote controller when the outdoor unit is in the standby state, “ PREPARATION” is displayed for 3 seconds on the remote controller. - 20 - '10 • PAC-SM-137 (3) Compressor soft start control (a) Compressor protection start I [Control condition] Normally, the compressor operation frequency is raised in this start pattern. [Control contents] 1) Starts with the compressor’s target frequency at A rps. However, when the ambient air temperature (Tho-A) is 35°C or higher during cooling/ dehumidifying or the indoor return air temperature (ThI-A) is 25°C or higher during heating, it starts at C rps. 2) At 30 seconds after the start of compressor, its target frequency changes to B rps and the compressor is operated for 2 - 4 minutes with its operation frequency fixed at B rps. Model 71 100 125, 140 Operation mode Cooling/Dehumidifying Heating Cooling/Dehumidifying Heating Cooling/Dehumidifying Heating A rps 42 62 55 55 45 45 B rps 42 62 55 55 45 45 C rps 40 40 30 30 25 25 (b) Compressor protection start III [Control condition] Number of compressor starts is only 1 counted after the power supply breaker ON. [Control contents] Operates by selecting one of following start patterns according to the operation mode and the outdoor air temperature (Tho-A). 1) Low frequency operation control during cooling/dehumidifying [Control condition] Upon establishing the conditions of compressor protection start III, the low frequency operation control is performed during cooling/dehumidifying. [Control contents] a) Starts with the compressor’s target frequency at A rps. When the outdoor air temperature (Tho-A) is 35°C or higher, it starts at C rps. b) At 30 seconds after the compressor start, the compressor’s target frequency is changed to B rps and the compressor’s operation frequency is fixed for 10 minutes. Model 71 100 125, 140 2) Operation mode Cooling/Dehumidifying Cooling/Dehumidifying Cooling/Dehumidifying A rps B rps C rps 42 55 45 42 55 45 40 30 25 Low frequency operation control during heating [Control condition] When the conditions of compressor protection start III are established and one of following conditions a) and b) is satisfied, the low number of revolutions operation control is performed during heating. a) At 30 minutes or more after turning the power supply breaker on b) Compressor underneath temperature (Tho-H) is 4°C or higher and the difference from the outdoor air temperature (Tho-A) becomes 4°C or higher. [model 200, 250 only] [Control contents] a) Starts the compressor with its target frequency at A rps. However, when the indoor unit return air temperature (ThI-A) is 25°C or higher, it start at C rps. b) At 30 seconds after the start of compressor, the compressor’s target frequency is changed to B rps and the compressor’s operation frequency is fixed for 10 minutes. Model 71 100 125, 140 Operation mode Heating Heating Heating - 21 - A rps 42 55 45 B rps 42 55 45 C rps 40 30 25 '10 • PAC-SM-137 (4) Outdoor unit fan control (a) Outdoor unit fan tap and fan motor speed Model Mode 71 Cooling/Dehumidifying Heating 100 Cooling/Dehumidifying Heating 125, 140 Cooling/Dehumidifying Heating Unit: min-1 Fan motor tap speed speed speed speed speed speed speed 200 400 600 710 810 850 950 200 400 600 710 810 850 950 speed speed speed speed speed speed speed 200 350 600 740 820 870 950 200 350 600 740 820 870 950 speed speed speed speed speed speed speed 200 370 560 640 745 870 910 200 370 560 640 800 870 910 (b) Fan tap control during cooling/heating operation Fan taps are selected depending on the outdoor unit heat exchanger temperature (Tho-R1, R2) and the outdoor air temperature (Tho-A). Note (1) It is detected by Tho-R1 or R2, whichever the higher. zone Tap 5(6) Tap 5(6) Tap 4 Tap 3 zone zone zone zone zone Tap 5(6) Tap 5(6) Tap 4 Tap 3 zone Tap 5(6) Tap 4(6) Tap 3 Tap 2 zone Tap 4 Tap 3 Tap 2 Tap 1 Note (1) Value in ( ) are for the model 71. zone zone zone zone 30 zone 15 zone 46 48 43 zone 37 33 zone 18 20 Outdoor air temp. (˚C) 53 40 30 Outdoor unit heat exchanger temp. (˚C) (c) Fan tap control during heating operation Fan taps are selected depending on the outdoor unit heat exchanger temperature (Tho-R1, R2) and the outdoor air temperature (Tho-A). Note (1) It is detected by Tho-R1 or R2, whichever the lower. zone Tap 3 Tap 3 Tap 4 zone zone zone Note (1) Value in ( zone Tap 3 Tap 4(5) Tap 5 zone Tap 4 Tap 5 Tap 6 ) are for the model 71. zone zone zone zone 12 zone 3 15 1 zone 9 -2 Outdoor air temp. (˚C) 3 0 Outdoor unit heat exchanger temp. (˚C) (d) Outdoor unit fan control at cooling low outdoor air 1) When all the following conditions are established after the start of compressor, the following control is implemented. If the outdoor air temperature (Tho-A) is in the zone in the cooling/dehumidifying mode, it has elapsed 20 seconds from the start of outdoor unit fan and the outdoor unit fan is at the tap 1 speed, the outdoor unit fan speed is controlled according to the outdoor unit heat exchanger temperature (Tho-R1, R2). Note (1) It is detected with Tho-R1 or R2, whichever the higher. Outdoor unit fan speed +10min-1 Retained zone Outdoor unit fan speed -10min-1 zone 5 10 20 Outdoor air temp. (˚C) 30 Outdoor unit heat exchanger temp. (˚C) - 22 - '10 • PAC-SM-137 2) The outdoor unit heat exchanger temperature is detected always and, when the number of revolutions of the outdoor fan speed has been increased or decreased, there is no change of fan speed for 20 seconds. 3) Rage of the outdoor unit fan speed under this control is as follows. a) Lower limit: 130rpm b) Upper limit: 500rpm 4) As any of the following conditions is established, this control terminates. a) When the outdoor air temperature is in the zone and the outdoor unit heat exchanger temperature at 30°C or higher is established for 40 seconds or more continuously. b) When the outdoor fan speed is 500rpm and the outdoor unit heat exchanger temperature at 30°C or higher is established for 40 seconds or more continuously. c) When the outdoor unit heat changer temperature at 45°C or higher is established for 40 seconds or more. (e) Outdoor unit fan control by the power transistor radiator fin temperature When all the following conditions are established later than 3 minutes after the start of compressor, the following control is implemented. 1) Cooling/dehumidifying a) Outdoor air temperature Tho-A 33°C b) Compressor’s actual frequency A rps c) Power transistor radiator fin temperature C °C 2) Heating a) Outdoor air temperature Tho-A 16°C b) Compressor’s actual frequency B rps c) Power transistor radiator fin temperature C °C 3) Control contents a) Raises the outdoor unit fan tap by 1 tap. b) When the sampling is for 60 minutes and the value of power transistor radiator fin temperature (Tho-P) is as follows. When the power transistor radiator fin temperature (Tho-P) C °C, the outdoor unit fan tap is raised by 1 speed further. When C °C > power transistor radiator fin temperature (Tho-P) D °C, present outdoor unit fan tap is maintained. When the power transistor radiator fin temperature (Tho-P) D °C, the outdoor unit fan tap is dropped by 1 speed. 4) Ending conditions When the operation under the condition of item b), above and with the outdoor unit fan tap, which is determined by the item (b) is detected 2 times consecutively. • Compressor’s frequency and power transistor radiator fin temperature Item Model 71 100 125, 140 (f) A B C D 60 85 65 70 85 65 80 72 72 75 68 68 Caution at the outdoor unit fan start control When the outdoor unit fan is running at 400min-1 before operating the compressor, it may operate with the compressor only, without starting up the outdoor fan This is normal. (g) Snow protection fan control If the dip switch (SW3-2) on the outdoor unit control PCB is turned ON, the outdoor unit fan is operated for 30 seconds at 4 tap speed once in every 10 minutes depending on the outdoor air temperature (detected with Tho-A) in the stop mode or anomalous stop mode. Snow protection fan control OFF Snow protection fan control ON 3 5 Outdoor air temp. (°C) - 23 - '10 • PAC-SM-137 Defrosting Model 71 ~ 140 -2 Outdoor unit heat exchanger temp.(͠)㨇Tho-R㨉 (a) Defrosting start conditions LPT invalid -35 -25 ion 4 e st o tur era to s fro Defrost operation start temperature zone p tem t tar s ion ) rd da an t (S ) rat pe De -20 -18 -15 -10 -5 0 56 10 Outdoor air temp. (͠)㨇Tho-A㨉 ) ON 3-1 st o fro De star (SW e mp t te n atio re ratu ) rd per da tan S e( ur rat pe t tar tem Defrost operation start temperature zone ns tio era st op fro De -20 -18 -15 -10 -5 0 56 10 Model 100 ~ 140 Outdoor air temp. (°C) -8 Note (1) Figures in [ ] are for model 71. Defrosting conditions B b) c) sta fro De ON 3-1 (SW Outdoor air temp. (͠)㨇Tho-A㨉 2 a) per at per LPT detection 2) re atu em rt t Suction saturation temp.(͠)㨇SST㨉 If all of the following defrosting conditions A or conditions -5 -6 B are met, the defrosting operation starts. 1) Defrosting conditions A -10 a) Cumulative compressor operation time after the end of defrosting has elapsed 37 [45] minutes, -15 and the cumulative compressor operation time after the start of heating operation (remote -20 controller ON) has elapsed 30 minutes. b) After 5 minutes from the compressor ON -25 c) After 5 minutes from the start of outdoor unit fan -27 d) After satisfying all above conditions, if temperatures of the outdoor unit heat exchanger temperature -30 -25 thermistor (Tho-R1, R2) and the outdoor air temperature thermistor (Tho-A) become lower than the defrosting start temperature as shown Model 71 -8 by the right figure for 15 seconds continuously, or the suction gas saturation temperature (SST) -10 and the outdoor air temperature (Tho-A), which -15 are obtained from the value detected by the low pressure sensor (LPT) stay for 3 minutes -20 within the range below the defrosting operation start temperature as shown by the right figure. -24 -25 However, it excludes for 10 minutes after the start of compressor and the outdoor air temperature is -30 as shown by the lower figure. -31 When previous defrosting end condition is the time out of defrosting operation and it is in the heating operation after the cumulative compressor operation time after the end of defrosting has become 30 minutes. After 5 minutes from the start of compressor After 5 minutes from the start of outdoor unit fan (b) Defrosting end conditions Suction saturation temp.(͠)㨇SST㨉 (5) -10 -15 ta ns tio era -20 -24 -25 -28.6 -30 -25 em rt t rd) da tan S e( ur rat pe ns tio era p to os fr De re atu ) ON m t te tar p st o fro De per 3-1 (SW Defrost operation start temperature zone -20 -18 -15 -10 -5 0 56 10 When any of the following conditions is satisfied, the Outdoor air temp. (͠)㨇Tho-A㨉 defrosting end operation starts. 1) When it has elapsed 8 minutes and 20 seconds after the start of defrosting. (After 10 minutes and 20 seconds for model 71) 2) When the outdoor unit heat exchanger temperatures (Tho-R1, R2), whichever the lower, becomes 12°C or higher for 10 seconds continuously. - 24 - '10 • PAC-SM-137 (c) Switching of defrosting control with SW3-1 1) 2) If SW3-1 on the outdoor unit control PCB is turned to ON, it becomes easier to enter the defrosting operation. Use this when installing a unit at snowing regions. Control contents a) It allows entering the defrosting operation under the defrosting condition A when the cumulative heating operation time becomes 30 minutes. It is 37 [45] minutes at SW3-1 OFF (Factory default). b) It allows entering the defrosting operation under the defrosting condition B when the cumulative heating operation time becomes 25 minutes. It is 30 minutes at SW3-1 OFF (Factory default). c) It allows the defrosting operation with the outdoor unit heat exchanger temperature (Tho-R) and suction pressure saturation temperature (SST) being higher than normal. Note (1) Figures in [ ] are for model 71. (6) Protective control/anomalous stop control by compressor’s number of revolutions (a) Compressor discharge pipe temperature protection 1) Protective control As the discharge pipe temperature (detected with Tho-D) exceeds the setting value, the compressor speed (frequency) is controlled to suppress the rise of discharge pipe temperature. Reduces compressor speed at each minute. Retention Release 105 110 Discharge pipe temperature (°C) 2) Anomalous stop control a) b) If the discharge pipe temperature (detected with Tho-D) exceeds the setting value, the compressor stops. When it is detected 2 times within 60 minutes or after continuous 60 minutes, including the stop of compressor, E36 is displayed on the remote controller and it enters the anomalous stop mode. Compressor stop Compressor operation 85 115 Discharge pipe temperature (°C) 3) Reset of anomalous stop mode As it drops to the reset value of 85°C or lower for 45 minutes continuously, it becomes possible to restart from the remote controller. (b) Cooling high pressure protection 1) Protective control a) When the outdoor air temperature (Tho-A) is 40°C or higher and the outdoor unit heat exchanger temperature (Tho-R) exceeds the setting value, the compressor speed (frequency) is controlled to suppress the rise of high pressure. b) Control value A is updated to an optimum value automatically according to the operating conditions. Reduces compressor speed at each minute. Control value A Reset A Outdoor unit heat exchanger temp. (°C) 2) 54~60°C Anomalous stop control a) As the outdoor unit heat exchanger temperature (Tho-R) exceeds the setting value, the compressor stops. b) If it is detected 5 times within 60 minutes or 65°C or higher continues for 60 minutes, including the stop of compressor, E35 is displayed on the remote controller and it enters the anomalous stop mode. Compressor stop Compressor operation 1 5 65 Outdoor unit heat exchanger temp. (°C) 3) Reset of anomalous stop mode As it reaches the reset value of 51°C or lower, it becomes possible to restart from the remote controller. - 25 - '10 • PAC-SM-137 (c) Heating high pressure protection 1) Protective control a) As the indoor unit heat exchanger temperature (Th I-R) exceeds the setting value, the compressor speed (frequency) is controlled to suppress the rise of high pressure. b) Control value A is updated to an optimum value automatically according to the operating conditions. Reduces compressor frequency at every 30 seconds. Model Reset 71 100~140 A Indoor unit heat exchanger temp. (°C) 2) 3) Existing piping adaptation switch: SW5-1 (SW8-1: model 80) OFF (Shipping) ON Control value A (°C) 52~58 48~54 46~52 Note (1) Adaptation to existing piping is at ON. Anomalous stop control Operation control function by the indoor unit controller - See the heating overload protection, page 10. Adaptation to existing piping, stop control If the existing piping adaptation switch, SW5-1 (SW8-1: 71 type), is turned ON, the compressor stops to protect existing piping when the indoor unit heat exchanger temperature (ThI-R) exceeds the setting value. Compressor stop Reset 7 4 8 5 Indoor unit heat exchanger temp. (°C) (d) Anomaly detection control by the high pressure switch (63H1) If the pressure rises and operates the high pressure switch (opens at 4.15MPa/closes at 3.15MPa), the compressor stops. Under any of the following conditions, E40 is displayed and it enters the anomalous stop mode. a) When it occurs 5 times within 60 minutes that pressure rises and the compressor is stopped by 63H1. b) When 63H1 has been in the open state for 60 minutes continuously, including the stop of compressor. (e) Low pressure control 1) Protective control If the value detected by the low pressure sensor (LPT) exceeds the setting value, the compressor speed (frequency) is controlled to restrain the drop of pressure. 1) 2) Reduces compressor frequency at every 30 seconds. Retention Reset 0.150 0.189 Low pressure (MPa) 2) Reduces compressor frequency at each minute. Indoor unit heat exchanger temp. (°C) (f) Anomalous stop control a) When a value detected by the low pressure sensor (LPT) satisfies any of the following conditions, the compressor stops to run for its protection. When the low pressure drops to 0.079MPa or under for 15 seconds continuously. At 10 minutes after the start of compressor, the suction overheat becomes 30°C and the low pressure becomes 0.15MPa or under for 60 seconds continuously. b) E49 is displayed under any of the following conditions and it enters the anomalous stop mode. When the low pressure drops 3 times within 60 minutes and the compressor stops under any of the above conditions. When a value detected with the low pressure sensor becomes 0.079MPa or under for 5 minutes, including the stop of compressor. c) However, when the control condition a). is established during the compressor protection start III, E49 is displayed at initial stop and it enters the anomalous stop mode. Compressor pressure ratio protection control 1) During heating operation, if the indoor unit heat exchanger temperature (ThI-R) and the outdoor unit heat exchanger temperature (Tho-R) exceed the setting values at 10 minutes after the start of compressor, the compressor speed (frequency) is controlled to protect the compressor. 2) This control is not performed during the outdoor fan ON and for 10 minutes from the start of outdoor unit fan. 3) This control is not performed during defrosting operation and at 10 minutes after the reset of defrosting operation. 4) When there are 3 indoor unit heat exchanger temperatures (ThI-R), the highest temperature is detected. 65°C Resert 33°C 0.150 0.425 Low pressure (MPa) - 26 - '10 • PAC-SM-137 (g) Over-current protection current safe controls I, II Detecting the outdoor unit inverter input (primary) current and the output (secondary) current, if the current values exceed setting values, the compressor speed (frequency) is controlled to protect the inverter. Reduces frequency at each minute. Model Retention Reset B 71 100 125, 11.0 (23.0) 10.0 (22.0) 11.0 (25.0) 10.0 (24.0) 140 71 13.0 12.0 13.0 12.0 Secandary 100 11.5 (Fig.C) 10.5 (Fig.C) 11.5 (Fig.C) 10.5 (Fig.C) current side 125, 11.5 (Fig.C) 10.5 (Fig.C) 11.5 (Fig.C) 10.5 (Fig.C) 140 Primary current side A Current (A) T he controlv alue “ A”and the reset v alue v ary depending on the compressor speed. Controlor reset v alv e (A) (F ig . C) 4 2 2 Cooling Heating Control Reset Control Reset value A value B value A value B 15.0 14.0 16.0 15.0 13.5 (23.0) 12.5 (22.0) 13.5 (23.0) 12.5 (22.0) Control av lv e A Note (1) Value in ( ) are for the single phase models. 0 2 8 1 6 1 Reset valv e B 4 1 2 1 0 4 0 5 60 70 80 09 0 1 0 1 01 2 130 Compressor speed (frequenc y) (rps) (h) Power transistor temperature protection 1) Protective control If the power transistor temperature (detected with TIP) exceeds the setting value, the compressor speed (frequency) is controlled to suppress the rise of power transistor temperature. Reduces compressor frequency at each minute. Retention Reset 81 85 Power transistor temp. (°C) (i) Anomalous power transistor current Prevents over-current on the inverter. If the current value in the power transistor exceeds the setting value, the compressor stops. 2) If the current value in the power transistor exceeds the specified value and the compressor stops 4 times within 30 minutes, E42 is displayed on the remote controller and it enters the anomalous stop mode. (j) Anomalous inverter PCB If the power transistor detects any anomaly for 15 minutes, including the stop of compressor, E51 is displayed on the remote controller and it enters the anomalous stop mode. (k) Anti-frost control by the compressor frequency control 1) If the indoor unit heat exchanger temperature (detected with ThI-R) exceeds the setting value at 4 minutes after the start of compressor, the compressor speed (frequency) is controlled to initiate the anti-frost control of indoor unit heat exchanger. 2) When there are 3 indoor unit heat exchanger temperatures (ThI-R), the lowest temperature is detected. 1) Reset Reduces compressor frequency at each minute. Retention 1.5 3.5 Indoor unit heat exchanger temp. (°C) 3) Regarding the anti-frost control by the operation stop, refer to the operation control function by the indoor unit controller and the cooling, dehumidifying frost prevention of page 10. - 27 - '10 • PAC-SM-137 (l) Dewing prevention control [Control condition] During cooling and dehumidifying operation, if all the following conditions are established, the compressor speed (frequency) is reduced to prevent dewing and water splash. Cooling electronic expansion valve aperture (EEVC) is 500 pulses. Suction overheat is 10°C or higher. zCompressor speed (frequency) is A rps or higher. [Control contents] When the suction overheat is 10°C or higher, the compressor speed (frequency) is reduced at each 1 minute. Compressor speed (frequency) does not rise till the cooling Model A rps expansion valve becomes 460 pulses. 71 42 z This control takes A rps as its lower limit so that compressor speed is not controlled when it is less than A rps. 100~140 60 (m) Refrigerant quantity shortage protection Under the compressor protection start III control during cooling and dehumidifying operations, the following control is performed by detecting the indoor unit heat exchanger temperature (ThI-R) and the indoor unit return air temperature (ThI-A). [Control condition] When the state that the indoor unit heat exchanger temperature (ThI-R) does not become lower than the indoor unit return air temperature (ThI-A) by 4°C or more continues for 1 minute. [Control contents] It judges that the flowing of refrigerant in to the indoor unit is insufficient so that the compressor is stopped and E57 is displayed on the remote controller. (n) Broken wire detection on temperature thermistor and low pressure sensor 1) Outdoor unit heat exchanger thermistor, outdoor air thermistor and low pressure sensor If the following is detected for 5 second continuously within 2 minutes to 2 minutes and 20 seconds after the compressor ON, the compressor stops. After a delay of 3 minutes, it restarts but, if the same is detected repeatedly 3 times within 40 minutes, the compressor stops with the anomalous stop. Note (1) During defrosting and for 3 minutes after the end of defrosting, it is not detected. 2) • Outdoor unit heat exchanger thermistor: -50°C or lower • Outdoor air temperature thermistor: -45 or lower • Low pressure sensor: 0V or under or 4.0V or over Discharge pipe temperature thermistor, suction pipe temperature thermistor If the following is detected for 5 second continuously within 10 minutes to 10 minutes and 20 seconds after the compressor ON, the compressor stops. After a delay of 3 minutes, it restarts but, if the same is detected repeatedly 3 times within 40 minutes, the compressor stops with the anomalous stop. Note (1) During defrosting and for 3 minutes after the end of defrosting, it is not detected. • Discharge pipe temperature thermistor: -10°C or lower • Suction pipe temperature thermistor: -50 or lower (o) Open phase protection (3-phase models only) When 0V is detected on any of L1, L2 or L3 phase for 5 seconds continuously after the power ON, it judges the state of open phase on the power supply and activates the anomalous stop (E34) 1 second later. (p) Fan motor error 1) If the fan speed of 100rpm or under is detected for 30 second continuously under the outdoor unit fan control (with the operation command of fan tap at speed or higher), the compressor stops. 2) When the fan motor speed drops to 100rpm or under 5 times within 60 minutes and the compressor stops, it enters the anomalous stop mode with E48 displayed on the remote controller. (q) Anomalous stop by the compressor start stop 1) 2) When it fails to shift to the compressor DC motor’s rotor position defection operation at 5 seconds after establishing the compressor start condition, the compressor stops temporarily and restarts 3 minutes later. If it fails to shift to the position detection operation again at second time, it judges the anomalous compressor start and stops the compressor by the anomalous stop (E59). - 28 - '10 • PAC-SM-137 (7) Silent mode (a) (b) (8) As “Silent mode start” signal is received from the remote controller, it operates by dropping the outdoor unit fan tap and the compressor speed (frequency). For details, refer to items (1) and (4) above. Test run (a) It is possible to operate from the outdoor unit using the dip switch on the outdoor unit control PCB. OFF Cooling test run SW3-4 ON SW3-3 (SW5-4) ON Heating test run (SW5-3) OFF Normal and end of test run Make sure to turn SW3-3 (SW5-3) to OFF after the end of operation. Note (1) Value in ( ) are for the model 71. (b) Test run control 1) 2) 3) Operation is performed at the maximum compressor speed (frequency), which is determined for each model. Each protective control and error detection control are effective. If SW3-4 (SW5-4) is switched during test run, the compressor is stoped for once by the stop control and the cooling/ heating operation is switched. Note (1) Value in ( ) are for the model 71. 4) Setting and display of remote controller during test run Item Contents of remote controller setting/display Mode Cooling test run Setting temperature of cooling is 5°C. Heating test run Setting temperature of heating (preparation) is 30°C. (9) Pump-down control Turning ON the pump-down switch SW1 (SW9) for 2 seconds during the operation stop or anomalous stop (excluding the thermostat OFF), the pump-down operation is performed. (This is invalid when the indoor unit is operating. This is effective even when the indoor unit is stopped by the anomalous stop or the power supply is turned OFF.) Note (1) Value in ( ) are for the model 71. (a) Control contents 1) 2) 3) 4) Close the operation valve at the liquid side. (It is left open at the gas side.) Compressor is started with the target speed (frequency) at 71:62, 100:55, 125・140:45 rps in the cooling mode. Red and green lamps (LED) flash continuously on the outdoor unit control PCB. Each of protection and error detection controls, excluding the low pressure control, anti-frost control and dewing prevention control, is effective. 5) Outdoor unit fan is controlled as usual. 6) Electronic expansion valve is fully opened. (b) Control ending conditions Stop control is initiated depending on any of the following conditions. 1) Low pressure of 0.087MPa or lower is detected for 5 seconds continuously. a) Red LED: Light, Green LED: Flashing, Remote controller: Displays stop. b) It is possible to restart when the low pressure is 0.087MPa or higher. c) Electronic expansion valve (cooling/heating) is kept fully open. 2) Stop by the error detection control a) Red LED: Flashing, Green LED: Flashing b) Restart is prohibited. To return to normal operation, reset the power supply. c) Electronic expansion valve (cooling/heating) is left fully open. 3) When the cumulative operation time of compressor under the pump-down control becomes 5 minutes. a) Red LED: OFF, Green LED: Flashing, Remote controller: Stop b) It is possible to pump-down again. c) Electronic expansion valve (cooling/heating) is left fully open. Note (1) After the stop of compressor, close the operation valve at the gas side. Caution: Since pressing the pump-down switch cancels communications with the indoor unit, the indoor unit and the remote controller display “Transmission error – E5”. This is normal. - 29 - '10 • PAC-SM-137 (j) Drain pan ON/OFF output control (optional) (Models 100 ∼ 140 only) 1) Drain pan heater ON conditions When all of following conditions are met, the drain pan heater is turned ON. ・Outdoor air temperature (detected with Tho-A) is 3ºC or lower. ・In the heating mode ・When the compressor is turned ON 2) Drain pan heater OFF conditions When either one of following conditions is met, the drain pan heater is turned OFF. ・Outdoor air temperature (detected with Tho-A) is 5ºC or higher. ・When the compressor stop has been detected for 30 minutes continuously ・In the cooling or dehumidifying mode Drain pan heater OFF Drain pan heater ON 3 5 Outdoor air temperature (ºC) [Tho-A] - 30 - '10 • PAC-SM-137 2. MAINTENANCE DATA 2.1 Diagnosing of microcomputer circuit (1) Selfdiagnosis function (a) Check Indicator Table (i) Whether a failure exists or not on the indoor unit and outdoor unit can be know by the contents of remote controller error code, indoor/outdoor unit green LED (power pilot lamp and microcomputer normality pilot lamp) or red LED (check pilot lamp). Indoor unit Remote controller Error code Red LED Indoor control PCB Green LED (1) Red LED Stays OFF Keeps flashing No-indication Stays OFF Stays OFF Stays OFF or INSPECT I/U WAIT Outdoor control PCB Green LED (1) Red LED Stays OFF Keeps flashing 2 times flash Stays OFF Keeps flashing * 3 times flash Keeps flashing Stays OFF Stays OFF Keeps flashing 2 times flash Keeps flashing Location of trouble — Description of trouble • Normal operation Indoor unit power • Power OFF, broken wire/blown fuse, broken transformer wire supply Remote controller • Poor connection, breakage of remote controller wire * For wire breaking at power ON, the wires LED is OFF. Reference page — — Repair 62 Repair Replacement of remote controller Remote controller • Defective remote controller PCB Indoor-outdoor units connection wire Repair method • Poor connection, breakage of indoor-outdoor units connection wire Repair 63 64 ∼ 68 Remote controller • Improper setting of master and slave by remote controller Stays OFF * Keeps flashing Stays OFF Keeps flashing 2 times flash Keeps flashing 2 times flash Keeps flashing 2 times flash Keeps flashing Stays OFF Keeps flashing Remote controller wires (Noise) • Poor connection of remote controller signal wire (White) * For wire breaking at power ON, the LED is OFF • Intrusion of noise in remote controller wire Remote controller indoor control PCB *• Defective remote controller or indoor control PCB (defective communication circuit)? Indoor-outdoor units connection wire (Noise) Outdoor control PCB Outdoor control PCB • Poor connection of wire between indoor-outdoor units during operation (disconnection, loose connection) • Anomalous communication between indoor-outdoor units by noise, etc. • CPU-runaway on outdoor control PCB *• Occurrence of defective outdoor control PCB on the way of power supply (defective communication circuit)? • Defective outdoor control PCB on the way of power supply Repair Replacement of remote controller or PCB 70 Repair Power reset or Repair Replacement of PCB 71 2 times flash Keeps flashing 1 time flash Keeps flashing Stays OFF Keeps flashing 1 time flash Keeps flashing Stays OFF Keeps flashing 1 time flash Keeps flashing Stays OFF Keeps flashing 1 time flash Keeps flashing Stays OFF Keeps flashing Stays OFF Keeps flashing Stays OFF Keeps flashing 3 times flash Keeps flashing Stays OFF Keeps flashing Stays OFF Keeps flashing Stays OFF Keeps flashing 1 time flash Keeps flashing Stays OFF Keeps flashing Indoor control PCB • Improper operation mode setting Repair 79 Keeps flashing Remote controller temperature therm- • Broken wire of remote controller temperature thermistor istor Repair 80 Stays OFF Stays OFF Fuse Keeps flashing Indoor heat • Defective indoor heat exchanger temperature thermistor (defective element, broexchanger tempera- ken wire, short-circuit) ture thermistor • Poor contact of temperature thermistor connector Replacement, repair of temperature thermistor Replacement of Indoor control PCB *• Defective indoor control PCB (Defective temperature thermistor input PCB circuit)? Indoor return air • Defective indoor return air temperature thermistor (defective element, broken wire, Replacement, repair temperature therm- short-circuit) of temperature istor • Poor contact of temperature thermistor connector thermistor Replacement of Indoor control PCB *• Defective indoor control PCB (Defective temperature thermistor input PCB circuit)? Installation or oper• Heating over-load (Anomalously high indoor heat exchanger temperature) Repair ating condition Indoor heat Replacement of exchanger tempera- • Defective indoor heat exchanger temperature thermistor (short-circuit) temperature thermture thermistor istor Replacement of Indoor control PCB *• Defective indoor control PCB (Defective temperature thermistor input circuit)? PCB Replacement, repair Drain trouble • Defective drain pump (DM), broken drain pump wire, disconnected connector of DM Float switch Indoor control PCB Option Stays OFF Keeps flashing Stays OFF Replacement • Blown fuse • Anomalous float switch operation (malfunction) 72 73 74 Repair *• Defective indoor control PCB (Defective float switch input circuit) *• Defective indoor control PCB (Defective DM drive output circuit)? • Defective optional parts (At optional anomalous input setting) Number of con- • When multi-unit control by remote controller is performed, the number of nected indoor units units is over Indoor unit No. set•No master is assigned to slaves. ting Replacement of PCB 75 Repair Repair 76 Repair 77 Rcmote controller wires •Anomalous remote controller wire connection, broken wire between master and slave units Fan motor • Defective fan motor Indoor control PCB • Defective indoor control PCB Replacement, repair (In case of FDTC, FDT, SRK) Replacement 78 Note (1) Normal indicator lamp (Indoor, outdoor units: Green) extinguishes (or lights continuously) only when CPU is anomalous. It keeps flashing in any trouble other than anomalous CPU. PDUNLQWKH'HVFULSWLRQRIWURXEOHPHDQVWKDWLQRUGLQDU\GLDJQRVLVLWFDQQRWLGHQWLI\WKHFDXVHGH¿QLWHO\DQGLIWKHWURXEOHLVUHSDLUHGE\UHSODFLQJ the part, it is judged consequently that the replaced part was defective. - 31 - '10 • PAC-SM-137 (ii) Outdoor unit Remote controller Indoor control PCB Outdoor control PCB Outdoor inventer PCB Error code Red LED Red LED Green LED (1) Red LED Green LED (1) Stays OFF Keeps flashing 1 time flash Keeps flashing Yellow LED Location of trouble Power supply wires Outdoor control PCB Description of trouble • Outdoor unit power supply L3-phase interruption, defective noise filter (3-phase model only) *• Defective outdoor control PCB (Defective power supply input circuit)? (3-phase model only) Installation or operating • Higher outdoor heat exchanger temperature condition Stays OFF Stays OFF Keeps flashing Keeps flashing 1 time flash 1 time flash Keeps flashing Keeps flashing Keeps flashing Keeps flashing Outdoor heat exchanger • Defective outdoor heat exchanger temperature thermistor temperature thermistor *• Defective outdoor control PCB (Defective temperature thermistor input Outdoor control PCB circuit)? Installation or operating • Higher discharge temperature condition Discharge pipe • Defective discharge pipe temperature thermistor temperature thermistor *• Defective outdoor control PCB (Defective temperature thermistor input Outdoor control PCB circuit)? Outdoor heat exchanger • Defective outdoor heat exchanger temperature thermistor, broken wire or poor temperature thermistor connector connection *• Defective outdoor control PCB (Defective temperature thermistor input Outdoor control PCB circuit)? Outdoor air temperature • Defective Outdoor air temperature thermistor, broken wire or poor connector thermistor connection *• Defective outdoor control PCB (Defective temperature thermistor input Outdoor control PCB circuit)? Discharge pipe • Defective discharge pipe temperature thermistor, broken wire or poor temperature thermistor connector connection *• Defective outdoor control PCB (Defective temperature thermistor input Outdoor control PCB circuit)? Installation or operating • Rising high pressure (Operation of 63H1) • Service valve closing operation condition Keeps flashing 1 time flash Keeps flashing 1 time flash Keeps flashing 1 time flash Keeps flashing 1 time flash Stays OFF Keeps flashing 1 time flash Keeps flashing 2 times flash or 6 times flash Inverter PCB or radiator • Power transistor overheat (Single phase modelonly) fin Stays OFF Keeps flashing 1 time flash Keeps flashing 1 time flash or 5 times flash Outdoor control PCB • Current cut (Anomalous compressor over-current) compressor Installation or operating • Service valve closing operation condition Keeps flashing 1 time flash Keeps flashing Keeps flashing Stays OFF Keeps flashing 1 time flash Keeps flashing 7 times flash Stays OFF Keeps flashing 1 time flash Keeps flashing Stays OFF Stays OFF Stays OFF Stays OFF Keeps flashing Stays OFF Stays OFF Keeps flashing 1 time flash Keeps flashing Keeps flashing Keeps flashing Keeps flashing Outdoor control PCB Keeps flashing 1 time flash Keeps flashing Stays OFF Keeps flashing 1 time flash Keeps flashing Stays OFF Keeps flashing 1 time flash Keeps flashing Keeps flashing 1 time flash Keeps flashing 5 times flash Stays OFF Stays OFF Repair Replacement of temperature thermistor 82 Replacement of PCB Repair Replacement, repair of temperature thermistor 83 Replacement of PCB Replacement, repair of temperature thermistor 84 Replacement of PCB Replacement, repair of temperature thermistor 85 Replacement of PCB Replacement, repair of temperature thermistor 86 Replacement of PCB Repair 87 Replacement of PCB Replacement of PCB or Repair 88 Replacement of PCB 89 •90 Repair Inverter PCB • Anomalous inverter PCB communication Replacement of PCB Inverter PCB activefilter • Defective outdoor inverter PCB (Model FDC 71) Defective active filter of control. Replacement • Anomalous outdoor fan motor Replacement, repair *• Defective outdoor control PCB (Defective motor input circuit)? Replacement of PCB 91 92 93 Outdoor control PCB Keeps flashing 2 times flash or 6 times flash Installation or operating • Low pressure error • Service valve closing operation condition • Anomalous low pressure, broken wire of low pressure sensor or poor Low pressure sensor connector connection Inverter PCB *• Defective outdoor control PCB (Defective sensor input circuit)? • Anomalous inverter PCB Repair Replacement, repair of sensor Replacement of control PCB Replacement of PCB Suction pipe • Defective suction pipe temperature thermistor, broken wire or poor connector Replacement, repair of temperature thermistor connection temperature thermistor Replacement of control Outdoor control PCB *• Defective outdoor PCB (Defective thermistor input circuit)? PCB Keeps flashing Keeps flashing Keeps flashing 81 Replacement of PCB Service valve opening check Outdoor fan motor Reference page Repair • Anomalous outdoor control PCB communication Outdoor control PCB Outdoor control PCB Stays OFF *• Defective outdoor control PCB (Defective 63H input circuit)? Repair method Stays OFF or 4 times flash Low pressure sensor • Defective low pressure sensor Replacement of sensor Outdoor control PCB • Defective outdoor control PCB (Defective sensor input circuit)? Replacement of control PCB 94,95 96 97 98 Operation status • Shortage in refrigerant quantity Repair • Service valve closing operation Service valve opening check 99 Installation status Compressor inverter PCB • Anomalous compressor startup Replacement 100 Note (1) * mark in the Description of trouble means that, in ordinary diagnosis, it cannot identify the cause definitely, and, if the trouble is repaired by replacing the part, it is judged consequently that the replaced part was defective. (iii) Optional controller in-use Indoor unit control PCB Outdoor unit control PCB Red LED Red LED Green LED Red LED Keeps flashing Stays OFF Keeps flashing Stays OFF Description of trouble Error code Repair method Green LED Keeps flashing • Communication error (Defective communication circuit on the main unit of SC-SL2N-E or SC-SL3N-E) ete. - 32 - Replacement '10 • PAC-SM-137 (iv) Display sequence of error codes or inspection indicator lamps N Occurrence of one kind of error Displays are shown respectively according to errors. N Occurrence of plural kinds of error Section Error code on remote controller Red LED on indoor control PCB Red LED on outdoor control PCB Category of display • Displays the error of higher priority (When plural errors are persisting) • Displays the present errors. (When a new error has occurred after the former error was reset.) N Error detecting timing Section Error description Drain trouble (Float switch activated) Communication error at initial operation Error code “ WAIT Remote controller communication circuit error Communication error during operation Indoor Excessive number of connected indoor units by controlling with one remote controller Error detecting timing Whenever float switch is activated after 30 second had past since power ON. No communication between indoor and outdoor units is ” established at initial operation. Communication between indoor unit and remote controller is interrupted for mote than 2 minutes continuously after initial communication was established. Communication between indoor and outdoor units is interrupted for mote than 2 minutes continuously after initial communication was established. Whenever excessively connected indoor units is detected after power ON. -50 (-45)°C or lower is detected for 5 (15) seconds continuously within 60 minutes after initial detection of this anomalous temperature. -50 (-28)°C or lower is detected for 5 (15) seconds continuously within 60 minutes after initial detection of this anomalous temperature. Or 70°C or higher is detected for 5 seconds continuously. -45°C or lower is detected for 5 seconds continuously 3 times within 40 minutes after initial detection of this anomalous temperature. Or -45°C or higher is detected for 5 seconds continuously within 20 seconds after compressor ON. -50°C or lower is detected for 5 seconds continuously 3 times within 40 minutes after initial detection of this anomalous temperature. Or -50°C or lower is detected for 5 seconds continuously within 20 seconds after compressor ON. -10°C or lower is detected for 5 seconds continuously 3 times within 40 minutes after initial detection of this anomalous temperature. -50°C or lower is detected for 5 seconds continuously 3 times within 40 minutes after initial detection of this anomalous temperature. 0V or lower or 3.49V or higher is detected for 5 seconds continuously 3 times within 40 minutes after initial detection of this anomalous pressure. -50°C or lower is detected for 5 seconds continuously 3 times within 40 minutes after initial detection of this anomalous temperature. Return air temperature thermistor anomaly Indoor heat exchanger temperature thermistor anomaly Outdoor air temperature thermistor anomaly Outdoor heat exchanger temperature thermistor anomaly Outdoor Discharge pipe temperature thermistor anomaly Suction pipe temperature thermistor anomaly Low pressure sensor anomaly Underneath temperature thermistor anomaly Note (1) Value in ( ) are for the models SRK50, 60. - 33 - '10 • PAC-SM-137 N Error log and reset Error indicator Memorized error log Remote controller display • Higher priority error is memorized. Red LED on indoor control PCB • Not memorized. Red LED on outdoor control PCB • Memorizes a mode of higher priority. Reset • Stop the unit by pressing the ON/OFF switch of remote controller. • If the unit has recovered from anomaly, it can be operated. N Resetting the error log • Resetting the memorized error log in the remote controller Holding down “CHECK” button, press “TIMER” button to reset the error log memorized in the remote controller. • Resetting the memorized error log The remote controller transmits error log erase command to the indoor unit when “VENTI” button is pressed while holding down “CHECK” button. Receiving the command, the indoor unit erase the log and answer the status of no error. (2) Troubleshooting procedure When any trouble has occurred, inspect as follows. Details of respective inspection method will be described on later pages. Trouble (3) Confirmation of power supply (Indoor/ outdoor unit) Confirmation of remote controller and LEDs on the PCB of indoor unit and outdoor unit (Indoor/ outdoor unit, remote controller) Check of the anomalous operation data on the remote controller Inspection of the unit/ controller Replacement/ repair of faulty part, test run, adjustment Troubleshooting at the indoor unit :LWKWKHWURXEOHVKRRWLQJ¿QGRXWDQ\GHIHFWLYHSDUWE\FKHFNLQJWKHYROWDJH$&'&UHVLVWDQFHHWFDWUHVSHFWLYHFRQQHFWRUV at around the indoor PCB, according to the inspection display or operation status of unit (the compressor does not run, fan does not run, the 4-way valve does not switch, etc.), and replace or repair in the unit of following part. (a) Replacement part related to indoor PCB’s Control PCB, power supply PCB, temperature thermistor (return air, indoor heat exchanger), remote controller switch, limit switch, transformer and fuse Note (1) With regard to parts of high voltage circuits and refrigeration cycle, judge it according to ordinary inspection methods. (b) Instruction of how to replace indoor control PCB SAFETY PRECAUTIONS ٨ ٨ ٨ Read the "SAFETY PRECAUTIONS" carefully first of all and then strictly follow it during the replacement in order to protect yourself. The precautionary items mentioned below are distinguished into two levels, WARNING and CAUTION. Both mentions the important items to protect your health and safety so strictly follow them by any means. WARNING Wrong installation would cause serious consequences such as injuries or death. CAUTION Wrong installation might cause serious consequences depending on circumstances. After completing the replacement, do commissioning to confirm there are no anomaly. ޓޓޓޓޓޓޓޓޓޓWARNING ٨ ٨ ٨ ٨ ٨ Replacement should be performed by the specialist. If you replace the PCB by yourself, it may lead to serious trouble such as electric shock or fire. Replace the PCB correctly according to these instructions. Improper replacement may cause electric shock or fire. Shut off the power before electrical wiring work. Replacement during the applying the current would cause the electric shock, unit failure or improper running. It would cause the damage of connected equipment such as fan motor,etc. Fasten the wiring to the terminal securely, and hold the cable securely so as not to apply unexpected stress on the terminal. Loose connections or hold could result in abnormal heat generation or fire. Check the connection of wiring to PCB correctly before turning on the power, after replacement. Defectiveness of replacement may cause electric shock or fire. ޓޓޓޓޓޓޓޓޓCAUTION ٨ ٨ ٨ In connecting connector onto the PCB, connect not to deform the PCB. It may cause breakage or malfunction. Insert connecter securely, and hook stopper. It may cause fire or improper running. Bundle the cables together so as not to be pinched or be tensioned. It may cause malfunction or electric shock for disconnection or deformation. - 34 - '10 • PAC-SM-137 UModel: FDT, FDTC series PSB012D931F C • Control PCB Replace and set up the PCB according to this instruction. ԘSet to an appropriate address and function using switch on PCB. ޓSelect the same setting with the removed PCB. item switch Content of control Address SW2 Plural indoor units control by 1 remote controller Master /Slave setting Test run SW5-1 SW5-2 SW7-1 Master Slave1 Slave2 Slave3 䋭 䋭 䋭 䇳 䇳 䋭 䇳 䇳 Normal Operation check/drain motor test run 䋭 䇳 䇳㪑㪦㪥䇭䋭㪑㪦㪝㪝 ԙSet to an appropriate capacity using the model selector switch(SW6). Select the same capacity with the PCB removed from the unit. ޓ SW6 -1 -2 -3 -4 SW6 -1 -2 -3 ޚ ޚ 㧙 㧙 100V ޚ ޚ㧙 40V ޚ ޚ 㧙 㧙 50V 125V 㧙 㧙 ޚ ޚ ޚ ޚ 㧙 60V 140V ޚ㧙 ޚ ޚ ޚ 㧙 㧙 71V -4 SW6 ON ޚ ޚ ޚ 1 2 3 4 Example setting fro 50V ԚReplace the PCB 1. Fix the PCB so as not to pitch the cords. 2. Connect connectors to the PCB. Connect a cable connector with the PCB connector of the same color. 3.Do not pass CPU surrounding about wirings. ԛControl PCB Parts mounting are different by the kind of PCB. 㪚㪥㪡㩿㪮㪿㫀㫋㪼䋩 㪣㫆㫌㫍㪼㫉㩷㫄㫆㫋㫆㫉 㪚㪥㪱㩿㪮㪿㫀㫋㪼䋩 㪟㪘 㪚㪥㪫䋨㪙㫃㫌㪼䋩 㪜㫏㫋㪼㫉㫅㪸㫃㩷㫊㫎㫀㫋㪺㪿 㪚㪥㪭䋨㪩㪼㪻䋩 㪘㫌㫋㫆㩷㫃㫀㪽㫋 㪪㪮㪉㩷㩿㪙㫃㫌㪼㪀 㪘㪻㪻㫉㪼㫊㫊㩷㫊㪼㫋㫋㫀㫅㪾 㪚㪥㪮㪋㩿㪙㫃㫌㪼䋩 㪧㫆㫎㪼㫉㩷㪧㪚㪙 㪪㪮㪌 㪤㪸㫊㫋㪼㫉㪆㪪㫃㪸㫍㪼 㫊㪼㫋㫋㫀㫅㪾 㪚㪥㪮㪊㩿㪩㪼㪻䋩 㪧㫆㫎㪼㫉㩷㪧㪚㪙 㪚㪥㪜㩿㪮㪿㫀㫋㪼䋩 㪩㪘㪤㩷㪺㪿㪼㪺㫂㪼㫉 㪚㪥㪞䋨㪙㫃㫌㪼䋩 㪪㪮㪍 㪚㪸㫇㪸㪺㫀㫋㫐㩷㫊㪼㫋㫋㫀㫅㪾 㪧㪸㫉㫋㩷㫅㫌㫄㪹㪼㫉 - 35 - 㪚㪥㪙㩿㪮㪿㫀㫋㪼䋩 㪩㪼㫄㫆㫋㪼 㪺㫆㫅㫋㫉㫆㫃㫃㪼㫉 㪚㪥㪠㩿㪙㫃㫌㪼䋩 㪝㫃㫆㪸㫋㩷㪪㪮 㪚㪥㪚㩿㪩㪼㪻䋩 㪟㫌㫄㫀㪻㫀㫋㫐 㫊㪼㫅㫊㫆㫉 㪚㪥㪟㩿㪙㫃㪸㪺㫂䋩 㪫㪿㪼㫉㫄㫀㫊㫋㫆㫉 㩿㪩㪼㫋㫌㫉㫅㩷㪸㫀㫉㪀 㪚㪥㪭㪉㩿㪙㫃㪸㪺㫂㪀 㪘㫌㫋㫆㩷㫃㫀㪽㫋 㪪㪮㪎 㪝㫌㫅㪺㫋㫀㫆㫅㩷㫊㪼㫋㫋㫀㫅㪾 㪚㪥㪥㩿㪰㪼㫃㫃㫆㫎䋩 㪫㪿㪼㫉㫄㫀㫊㫋㫆㫉 㩿㪟㪼㪸㫋㩷㪼㫏㪺㪿㪸㫅㪾㪼㫉㪀 '10 • PAC-SM-137 • Power PCB PSB012D953A This PCB is a general PCB. Replace the PCB according to this instruction. ԘReplace the PCB (refer to right dwg.) 1. Unscrew terminal of the wiring(yellow/green) soldered to PCB from the box. 2. Cut the band that binds the wiring (red and blue) from connector CNW1 and CNW2, and the wiring (yellow/green) from PCB (T2/T3) . (Note 1) 㵘(However, do not cut the band that binds only the red and blue wirings.) 3. Replace the PCB only after all the wirings connected to the connector are removed. 4. Fix the board such that it will not pinch any of the wires. 5. Reconnect the wirings to the PCB. Wiring connector color should match with the color of connector of the PCB. (Note 2) 6. Let the wiring (red and blue) pass beneath the (yellow/green) wiring and bind together with band. 7. Screw back the terminal of wiring (yellow/green) from PCB(T1䋬T2/T3), that was removed in 1. In that case, do not place the crimping part of the wiring under the PCB. 㵘 1): It might not be applicable on some models. (Note 㵘 2): After replacing PCB, connection between capacitor assy and connector CNP is no longer needed. (Note ԙPower PCB Parts mounting are different by the kind of PCB. 㪚㪥㪤㩿㪮㪿㫀㫋㪼䋩 㪝㪸㫅㩷㫄㫆㫋㫆㫉 㪚㪥㪮㪇䋨㪮㪿㫀㫋㪼䋩 㪫㪼㫉㫄㫀㫅㪸㫃㩷㪹㫃㫆㪺㫂 䌔䋱㩿㪰㪼㫃㫃㫆㫎㪆㪞㫉㪼㪼㫅䋩 㪜㪸㫉㫋㪿 㪚㪥㪮㪈㩿㪙㫃㫌㪼䋩 㪚㫆㫅㫋㫉㫆㫃㩷㪧㪚㪙 㪚㪥㪮㪉㩿㪩㪼㪻䋩 㪚㫆㫅㫋㫉㫆㫃㩷㪧㪚㪙 㪫㪉㩿㪰㪼㫃㫃㫆㫎㪆㪞㫉㪼㪼㫅䋩 㪜㪸㫉㫋㪿 㪫㪊㩿㪰㪼㫃㫃㫆㫎㪆㪞㫉㪼㪼㫅䋩 㪜㪸㫉㫋㪿 㩿㪥㫆㫋㪼㩷㪉㪀㩷㪚㪥㪧㩿㪮㪿㫀㫋㪼㪀 㪚㪸㫇㪸㪺㫀㫋㫆㫉㩷㪸㫊㫊㫐 㪧㪸㫉㫋㩷㫅㫌㫄㪹㪼㫉 - 36 - 㪚㪥㪩䋨㪮㪿㫀㫋㪼䋩 㪛㫉㪸㫀㫅㩷㫄㫆㫋㫆㫉 '10 • PAC-SM-137 - 37 - '10 • PAC-SM-137 UModel: FDUM, FDU, FDEN series PSB012D933D D ԘSet to an appropriate address and function using switch on PCB. There is a unit having plural applicable PCB depending on a model. Set the function setting corresponding the spare PCB and the applicable model. item switch Content of control Address SW2 Plural indoor units control by 1 remote controller Master /Slave setting Master Slave1 Slave2 Slave3 䋭 䋭 䋭 䇳 䇳 䋭 䇳 䇳 SW5-1 SW5-2 Test run 䋭 SW7-1 䇳 Normal Operation check/drain motor test run ޚ10ޓ㧙1(( ԙSet to an appropriate capacity using the model selector switch(SW6). Select the same capacity with the PCB removed from the unit. ޓ SW6 40V 50V 60V 71V -1 -2 -3 -4 ޚ ޚ 㧙 㧙 ޚ 㧙 ޚ 㧙 ޚ ޚ ޚ 㧙 ޚ 㧙 㧙 ޚ SW6 100V 125V 140V -1 -2 -3 -4 ޚ ޚ 㧙 ޚ 㧙 㧙 ޚ ޚ ޚ 㧙 ޚ ޚ SW6 ON 1 2 3 4 Example setting for 50V ԚReplace the PCB 1. Fix the PCB so as not to pitch the cords. 2. Connect connectors to the PCB. Connect a cable connector with the PCB connector of the same color. 3.Do not pass CPU surrounding about wirings. ԛControl PCB Parts mounting are different by the kind of PCB. 㪚㪥㪮㪇㩿㪩㪼㪻䋩 㪧㫆㫎㪼㫉㩷㫊㫆㫌㫉㪺㪼 㪧㪸㫉㫋㩷㫅㫌㫄㪹㪼㫉 㪪㪮㪉㩷㩿㪙㫃㫌㪼㪀 㪘㪻㪻㫉㪼㫊㫊㩷㫊㪼㫋㫋㫀㫅㪾 㪚㪥㪮㪉㩿㪙㫃㪸㪺㫂䋩 㪪㪼㪺㫆㫅㪻㪸㫉㫐 㫋㫉㪸㫅㫊㪽㫆㫉㫄㪼㫉 㪚㪥㪮㪈䋨㪮㪿㫀㫋㪼䋩 㪧㫉㫀㫄㪸㫉㫐㩷㫋㫉㪸㫅㫊㪽㫆㫉㫄㪼㫉 㪪㪮㪌㩷㪤㪸㫊㫋㪼㫉㪆㪪㫃㪸㫍㪼 㫊㪼㫋㫋㫀㫅㪾 㪚㪥㪙㩿㪮㪿㫀㫋㪼䋩 㪩㪼㫄㫆㫋㪼 㪺㫆㫅㫋㫉㫆㫃㫃㪼㫉 㪚㪥㪤㪊䋨㪮㪿㫀㫋㪼䋩 㪝㪸㫅㩷㫄㫆㫋㫆㫉 㪚㪥㪞䋨㪙㫃㫌㪼䋩 㪚㪥㪡㪉㩿㪙㫃㫌㪼䋩 㪣㫆㫌㫍㪼㫉㩷㫄㫆㫋㫆㫉 㪪㪮㪎 㪚㪥㪩㩿㪮㪿㫀㫋㪼䋩 㪛㫉㪸㫀㫅㩷㫇㫌㫄㫇 - 38 - 㪚㪥㪱㩿㪮㪿㫀㫋㪼㪀 㪟㪘 㪚㪥㪟㩿㪙㫃㪸㪺㫂䋩 㪫㪿㪼㫉㫄㫀㫊㫋㫆㫉 㩿㪩㪼㫋㫌㫉㫅㩷㪸㫀㫉㪀 㪚㪥㪥㩿㪰㪼㫃㫃㫆㫎䋩 㪫㪿㪼㫉㫄㫀㫊㫋㫆㫉 㩿㪟㪼㪸㫋 㪼㫏㪺㪿㪸㫅㪾㪼㫉㪀 㪚㪥㪭㩿㪙㫃㪸㪺㫂䋩 㪘㫌㫋㫆㩷㫃㫀㪽㫋 㪚㪥㪪㩿㪙㫃㫌㪼䋩 㪣㫆㫌㫍㪼㫉㩷㪪㪮 㪚㪥㪠㩿㪙㫃㫌㪼䋩 㪝㫃㫆㪸㫋㩷㪪㪮 㪚㪥㪫㩿㪙㫃㫌㪼䋩 㪦㫇㫋㫀㫆㫅 㪚㪥㪨㩿㪮㪿㫀㫋㪼㪀 㪚㪥㪡㩿㪮㪿㫀㫋㪼㪀 㪣㫆㫍㪼㫉㩷㫄㫆㫋㫆㫉 㪧㫌㫃㫊㪼 㪚㪥㪦㩿㪩㪼㪻䋩 㪟㪼㪸㫋㪼㫉 㪚㪥㪜䋨㪮㪿㫀㫋㪼䋩 㪩㪘㪤㩷㪺㪿㪼㪺㫂㪼㫉 '10 • PAC-SM-137 ٨DIP switch setting list Switches SW2 SW5-1 SW5-2 SW6-1 SW6-2 SW6-3 SW6-4 SW7-1 SW7-2 SW7-3 SW7-4 JSL1 Description Default setting Address No. setting at plural indoor units control by 1 R/C Master/Slave setting 0-F 0 OFF OFF Master*/Slave Model selection See table 2 As per model Normal*/Test run Test run, Drain motor Reserved Powerful mode Reserved Superlink terminal spare OFF OFF ON OFF With Valid*/Invalid(FDU only) Normal*/switch to spare keep OFF Valid Table 1: Indoor unit model selection with SW6-1-SW6-4 SW6-1 SW6-2 SW6-3 SW6-4 50V 1 0 1 0 60V 1 1 1 0 71V 1 0 0 1 100V 1 1 0 1 0: OFF 1:ON 125V 140V 0 1 0 0 1 1 1 1 Table 2: Indoor unit Master/Slave setting with SW5-1,SW5-2 Master Slave1 Slave2 Slave3 0: OFF 1:ON SW5-1 SW5-2 0 0 0 1 1 0 1 1 - 39 - See table 1 Normal * Default setting 40V 1 1 0 0 Remarks keep OFF '10 • PAC-SM-137 (4) Troubleshooting at the outdoor unit :KHQWURXEOHVKRRWLQJWKHRXWGRRUXQLW¿UVWO\DVVHVVWKHRYHUYLHZRIPDOIXQFWLRQDQGWU\WRSUHVXPHWKHFDXVHDQGWKHIDXOW\ SDUWE\FKHFNLQJWKHHUURUFRUGGLVSDO\HGRQWKHUHPRWHFRQWUROOHUDQGÀDVKLQJSDWWHUQRILQGLFDWRUODPSV5HG/('DQG*UHHQ LED), and then proceed further inspection and remedy it. 6HOIGLDJQRVLVV\VWHPE\PLFURFRPSXWRURQLQGRRUDQGRXWGRRU3&%FDQDVVLVWWR¿QGWKHFDXVHRIPDOIXQFWLRQVPRRWKO\E\ making a diagnosis of not only the anomaly of microcomutor, but also the anomaly in power supply system, installation space, overload resulting from improper charging amount of refrigerant and etc. 8QOHVVWKHSRZHULVUHVHWWKHHUURUORJLVVDYHGLQPHPRU\DQGWKHLQVSHFWLRQLQGLFDWRUODPSVRQRXWGRRU3&%NHHSÀDVKLQJ after automatical recovering from malfunction. After automatical recovering from malfunction, if any another error mode which has a higher priority than the previous error saved in memory occurs, it is overwritten in memory and is displayed. [Reset of power supply] Be sure to avoid electrical shock, when replacing or checking the outdoor control PCB, because some voltage is still retained in the electrolytic capacitor on the PCB even after shutting down tne power supply to the outdoor unit. Be sure to start repairing work, after confirming that the Green LED on the PCB has been extiguished for more than 10 VHFRQGVDIWHUPRUHWKDQPLQXWHVKDGEHHQSDVVHGVLQFHSRZHUVKXWGRZQDQGUHFRQ¿UPLQJWKDWYROWDJHKDVEHHQGLVFKDUJHG VXI¿FLHQWO\ E\ PHDVXULQJ WKH YROWDJH '& EHWZHHQ ERWK WHUPLQDOV RI HOHFWURO\WLF FDSDFLWRU & (Measurment of voltage may be disturbed by the moisture-proof coating. In such case, remove the coating and measure it by taking care of avoiding electrical shock) (a) Module of part to be replaced for outdoor unit controller Outdoor control PCB, Inverter PCB, Temperature thermistor (of outdoor heat exchanger, discharge pipe, outdoor air, ,30DQGVXFWLRQSLSH)XVHVIRUSRZHUVXSSO\DQGFRQWURO3&%1RLVH¿OWHU&DSDFLWRU5HDFWRUDQG7UDQVIRUPHU (b) Replacement procedure of outdoor control PCB Precautions for Safety Since the following precaution is the important contents for safety, be sure to observe them. WARNING and CAUTION are described as follows: Indicates an imminently hazardous situation which will result in death or serious injury if proper safety procedures and instructions are not adhered to. 㧍 CAUTION Indicates a potentially hazardous situation which may result in minor or moderate injury if proper safety procedures and instructions are not adhered to. 㧍 WARNING 㧍 WARNING Securely replace the PCB according to this procedure. If the PCB is incorrectly replaced, it will cause an electric shock or fire. Be sure to check that the power source for the outdoor unit is turned OFF before replacing the PCB. The PCB replacement under current-carrying will cause an electric shock or fire. After finishing the PCB replacement, check that wiring is correctly connected with the PCB before power distribution. If the PCB is incorrectly replaced, it will cause an electric shock or fire. 㧍 CAUTION Band the wiring so as not to tense because it will cause an electric shock. - 40 - '10 • PAC-SM-137 1) Model FDC71VNX PCA012D021C F a) Replace the PCB after elapsing 3 minutes from power OFF. (Be sure to measure voltage (DC) between T26 and T27 on inverter PCB, and check that the voltage is discharged sufficiently(10V or less).(Refer to Fig.1)) b) Disconnect the connectors from the control PCB. c) Match the switches setting (SW4) with the former PCB. d) Connect the connectors to the control PCB.(Confirm the connectors are not half inserted.) CNTH Parts No. after elapsing 3 minutes from power OFF CNI1 CNW2 CNIP CNB CNG1 CNI3 Voltage measurement point (T26(red)ޔT27(blue)) CNQ1 CNQ2 CNA1 SW4 CNW CNPS CNEEV1 CNFAN CNS CNH CNA2 CNEEV2 CNN CNR Fig.1 Position of terminal Parts Arrangement View connectors are not half inserted - 41 - '10 • PAC-SM-137 2) 2) Model FDC100VNX, 125VNX, 140VNX Model FDC100VSX, 125VSX, 140VSX PCA012D024F H a) Replace the PCB after elapsing 3 minutes from power OFF. b) Measurement was done on both ends of connector(CNA1) during measurement, the voltage(DC) might charged the electrolytic capacitor, be sure that the voltage is discharged sufficiently. (Refer to Fig.1) c) Disconnect the connectors from the control PCB. d) Disconnect the white or blue wiring passing through CT1 on the PCB before replacing the PCB. e) Match the setting switches (SW3-5, JSW, SW(J5-7)) with the former PCB. f) Tighten up a screw after passing white or blue wiring through CT1 of the changed. g) Please connect the connectors with the same place. (Confirm the connectors are not half inserted.) CNH CNW CNM CNA2 CNS after elapsing 3 minutes from power OFF 㩷 CNF CNN1 CNN2 CT1 (㧙) CNR CNW2 CNA1 CNFAN1 JSW CNFAN2 SW5 㧼㧯㧭㧡㧜㧡㧭㧝㧤㧣 CNI3 CNI1 SW4 SW3 CNEEV2 (㧗) Voltage measurement parts (Pin terminals1-2 of CNA1) SW䋨J5-7䋩 CNPS CNEEV1 CNB CNTH CNIP Parts Arrangement View connectors are not half inserted - 42 - Fig.1 Enlarged figure of parts location '10 • PAC-SM-137 (c) Outdoor inverter PCB replacement procedure Precautions for Safety • Since the following precaution is the important contents for safety, be sure to observe them. WARNING and CAUTION are described as follows: 㧍 WARNING Indicates an imminently hazardous situation which will result in death or serious injury if proper safety procedures and instructions are not adhered to. 㧍 CAUTION Indicates a potentially hazardous situation which may result in minor or moderate injury if proper safety procedures and instructions are not adhered to. 㧍 WARNING • Securely replace the PCB according to this procedure. If the PCB is incorrectly replaced, it will cause an electric shock or fire. • Be sure to check that the power source for the outdoor unit is turned OFF before replacing the PCB. The PCB replacement under current-carrying will cause an electric shock or fire. • After finishing the PCB replacement, check that wiring is correctly connected with the PCB before power distribution. If the PCB is incorrectly replaced, it will cause an electric shock or fire. 㧍 CAUTION • Band the wiring so as not to tense because it will cause an electric shock. Replace the inverter PCB according to the following procedure. 1) Model FDC71VNX PCA012D022G B Replace the PCB after elapsing 3 minutes from power OFF. (Be sure to measure voltage (DC) between T26 and T27 on inverter PCB, and check that the voltage is discharged sufficiently (10V or less). (Refer to Fig.1)) Take off the connection of inverter PCB terminal and connector, and remove the screw of power transistor (IC10), active filter (IC2), and diode stack (DS1) then remove the PCB. Wipe off the silicon grease neatly on the controller’s radiation heat fins. (Refer to Fig.1 and Parts arrangement view) Refer to table1 for the setting of switch (JSW10, 11) of new PCB. Before installing the power transistor (IC10), active filter (IC2), and diode stack (DS1) on the new PCB, apply silicon grease equally to the their surface. (Make full use of the silicon grease.) They may be damaged unless they apply it. Tighten the screw of power transistor (IC10), active filter (IC2), and diode stack (DS1) on inverter PCB and connect terminal and connector. Confirm the connection and there is not the half insertion. Tighten properly power transistor, (IC10) active filter (IC2), and diode stack (DS1) with a screw and make sure there is no slack. They can be damage if not properly tighten. (Recommended tightening torque: power transistor (IC10)1.2±0.1 and active filter (IC2)0.98±0.1, diode stack(DS1) 0.5±0.1 Unit N·m a) b) c) d) e) T22 (WHITE) CNG2 T30 (BLUE) T28 (RED) after elapsing 3 minutes from power OFF SCREW OF POWER TRANSISTOR(IC10) T21 (RED) T29(WHITE) Parts No. T24 (YELLOW) JSW11 JSW10 CNI2 SCREW OF DIODE STACK (DS1) CNI4 CNO1 T27 T25 T26 (BLUE) (YELLOW) (RED) Parts arrangement view Connectors are not half inserted JSW10 Voltage measurement point SCREW OF ACTIVE FILTWER (IC2) (T26 (red), T27 (blue)) Fig. 1 Position of fastontab and terminal Table. 1 Switch setting -1 OFF -2 OFF JSW11 -3 OFF -4 OFF - 43 - -1 -2 -3 -4 ON ON O N O N '10 • PAC-SM-137 2) Model FDC100VNX, 125VNX, 140VNX a) b) c) G e) PCA012D025D F Replace the PCB after elapsing 3 minutes from power OFF. (Be sure to measure voltage (DC) on both capacitor terminals located in controller back, and check that the voltage is discharged sufficiently.(Refer to Fig.1)) Take off the connection of inverter PCB terminal block connector and remove the screw of power transistor then UHPRYHWKH3&%:LSHRIIWKHVLOLFRQJUHDVHQHDWO\RQWKHFRQWUROOHU¶VUDGLDWLRQKHDW¿QV Match the setting switches (JSW10,11) of new PCB with the former PCB. %HIRUH LQVWDOOLQJ WKH SRZHU WUDQVLVWRU RQ WKH QHZ 3&%$SSO\ XQLIRUPO\ D EXQGOHG RI VLOLFRQ JUHDVH ¿UVW RQ WKH surface of power transistor.Make sure it is applied to prevent damage on power transistor. Tighten the screw of power transistor on inverter PCB and connect the terminal block.Confirm the connection and don’t use soldering in the connection.Tighten properly the power transistor with a screw and make sure there is no slack.Power transistor can be damage if not properly tighten.(Recommended power transistor tightening torque:0.98~1.47N·m) Terminal block TB1 Parts No. Voltage measurement parts Terminal block TB10 TB11 TB2 Connector CNI2 PCA565A151-1 TB6 TB5 CNI4 TB7 Switch JSW11 JSW10 TB8 TB9 CNACT1 Parts arrangement view JSW10 Fig.1 Position of capacitor Table. 1 Switch setting -1 OFF -2 OFF JSW11 -3 OFF -4 OFF - 44 - -1 -2 -3 -4 OFF OFF ON ON '10 • PAC-SM-137 3) Model FDC100VSX, 125VSX, 140VSX a) b) c) G e) PCA012D025F F Replace the PCB after elapsing 3 minutes from power OFF. (Be sure to measure voltage (DC) on both capacitor terminals located in controller back, and check that the voltage is discharged sufficiently.(Refer to Fig.1)) Take off the connection of inverter PCB terminal block connector and remove the screw of power transistor then UHPRYHWKH3&%:LSHRIIWKHVLOLFRQJUHDVHQHDWO\RQWKHFRQWUROOHU¶VUDGLDWLRQKHDW¿QV Match the setting switches (JSW10,11) of new PCB with the former PCB. %HIRUH LQVWDOOLQJ WKH SRZHU WUDQVLVWRU RQ WKH QHZ 3&%$SSO\ XQLIRUPO\ D EXQGOHG RI VLOLFRQ JUHDVH ¿UVW RQ WKH surface of power transistor.Make sure it is applied to prevent damage on power transistor. Tighten the screw of power transistor on inverter PCB and connect the terminal block.Confirm the connection and don’t use soldering in the connection.Tighten properly the power transistor with a screw and make sure there is no slack.Power transistor can be damage if not properly tighten.(Recommended power transistor tightening torque:0.98~1.47N·m) Voltage measurement parts Parts No. CNW2 CNO1 CNW1 Connector CNR Terminal block TB6 CNI2 Switch TB5 JSW11 TB7 TB8 TB9 JSW10 Parts arrangement view Fig.1 Position of capacitor Table. 1 Switch setting JSW10 -1 OFF -2 OFF -3 OFF -4 OFF JSW11 - 45 - -1 ON -2 OFF -3 ON -4 ON '10 • PAC-SM-137 ٨DIP switch setting list (Outdoor unit) (1) Control PCB Model FDC71VNX Sw itches SW3-1 SW3-2 SW3-3 SW3-4 SW4-1 SW4-2 SW4-3 SW4-4 SW5-1 SW5-2 SW5-3 SW5-4 SW7 -1 SW7 -2 SW7 -3 SW8 -1 SW8 -2 SW8 -3 SW9 Description Defrostcondition Snowprotection oc ntrol Model selection Defrostprohib ition itme Model selection Model selection eserved R Spare Model selection Model selection estrun SW T estrun mode T Spare ntifrostoc ntrol A Spare eserved R Spare Spare ump dow P n operation Defaultsetting Normal* /Cold er gion Normal* /Snowprotection Cooling only eatpump* /H ON:37min* /OFF:45min Domesti/O c vesr eas* 3-phase/Single phase* Capacity Capacity Normal* estrun /T Cooling* eating /H Valid* /Invalid Normal* mp dow u /P n *Defaultsetting OFF OFF OFF ON ON ON OFF OFF OFF OFF OFF OFF OFF OFF OFF OFF OFF OFF OFF Normal Normal eHatpump 37 min. Ov erseas Single phase R emarks eKep OFF eKep ON eKep ON eep OFF K eep OFF K eep OFF K K eep OFF Normal Cooling Valid eKep OFF eep OFF K eep OFF K eep OFF K Normal Models FDC100,125,140VNX,100,125,140VSX Switches SW1 JSW1-1 JSW1-2 JSW1-3 JSW1-4 SW3-1 SW3-2 SW3-3 SW3-4 SW4-1 SW4-2 SW4-3 SW4-4 SW5-1 SW5-2 SW5-3 SW5-4 J5 J7 Default setting Description Pump down operation Normal*/Pump down Model selection Defrost condition Snow protection control Test run SW Test run mode Model selection Model selection Reserved Reserved Reserved Reserved Reserved Reserved Antifrost control Outdoor fan control when ducting OFF Normal As per model Normal*/Cold region Normal*/Snow protection Normal*/Test run Cooling*/Heating Domestic/Overseas* 3-phase/Single phase Valid*/Invalid Normal*/Hi tap * Default setting Table 1: Outdoor unit model selection with JSW1-1-JSW1-4 and SW4-1-SW4-2 0: OFF 1:ON 100VNX 100VSX 125VNX 125VSX 140VNX 140VSX JSW1-1 0 0 1 1 0 0 JSW1-2 0 0 0 0 1 1 JSW1-3 0 0 0 0 0 0 JSW1-4 0 0 0 0 0 0 SW4-1 1 1 1 1 1 1 SW4-2* 1 0 1 0 1 0 * 3-phase: OFF/Single phase: ON (2) Inverter PCB 100, 125, 140VNX 100, 125, 140VSX 71VNX Switches Single phase models Single phase models 3-phase models JSW10-1 OFF OFF OFF JSW10-2 OFF OFF OFF JSW10-3 OFF OFF OFF JSW10-4 OFF OFF OFF JSW11-1 ON OFF ON JSW11-2 ON OFF OFF JSW11-3 ON ON ON JSW11-4 ON ON ON - 46 - Remarks Normal OFF Normal OFF Normal OFF Cooling OFF Overseas ON As per model OFF OFF OFF OFF OFF OFF Valid With Normal With See table 1 See table 1 See table 1 Keep OFF Keep OFF Keep OFF Keep OFF Keep OFF Keep OFF '10 • PAC-SM-137 (5) Check of anomalous operation data with the remote Number 01 Data Item (Operation Mode) 02 (Set Temperature) 03 (Return Air Temperature) 04 (Remote Controller Thermistor Tempeature) 05 (Indoor Heat Exchanger Thermistor / U Bend) 06 (Indoor Heat Exchanger Thermistor /Capillary) 07 (Indoor Heat Exchanger Thermistor /Gas Header) 08 (Indoor Unit Fan Speed) 09 (Frequency Requirements) Next, operation data of the indoor unit will be displayed. Skip to step . 10 (Response Frequency) When plural indoor units is connected, the smallest address number 11 (Pulse of Indoor Unit Expansion Value) controller Operation data can be checked with remote control unit operation. button. Press the The display change “ Press the ” (SET) button while “ ” is displayed. When only one indoor unit is connected to remote controller, “ ” is displayed (blinking indication during data loading). 12 of indoor unit among all connected indoor unit is displayed. (Total Running Hours of The Indoor Unit) 21 (Outdoor Air Temperature) 22 (Outdoor Heat Exchanger Thermistor) 23 24 (Outdoor Heat Exchanger Thermistor) (Compressor Frequency) 25 (High Pressure) 26 27 (Low Pressure) (Discharge Pipe Temperature) 28 (Comp Bottom Temperature) (The indoor unit number changes from blinking indication to 29 (Current) continuous indication) 30 (Target Super Heat) 31 (Super Heat) 32 (Discharge Pipe Super Heat) 33 (Protection State No. of The Compressor) 34 (Outdoor Unit Fan Speed) 35 (63H1 On/Off) 36 (Defrost Control On/Off) [Example]: ” (blinking 1 seconds) © “ “ ” blinking. Select the indoor unit number you would like to have data displayed button. with the Determine the indoor unit number with the (SET) button. ” (The address of selected indoor unit is blinking for 2 “ seconds.) “ ” (A blinking indication appears while data loaded.) Next, the operation data of the indoor unit is indicated. button, the current operation data is Upon operation of the displayed in order from data number 01. 37 (Total Running Hours of The Compressor) 38 (Pulse of The Outdoor Unit Expansion Valve EEVC) (Pulse of The Outdoor Unit Expansion Valve EEVH) 39 The items displayed are in the above table. *Depending on models, the items that do not have corresponding data are not displayed. To display the data of a different indoor unit, press the button, which allows you to go back to the indoor unit selection screen. Pressing the Pressing the button will stop displaying data. (RESET) button during remote control unit operation will undo your last operation and allow you to go back to the previous screen. ~If two (2) remote controllers are connected to one (1) inside unit, only the master controller is available for trial operation and FRQ¿UPDWLRQRIRSHUDWLRQGDWD7KHVODYHUHPRWHFRQWUROOHULVQRWDYDLODEOH ٨Details of Compressor protection status No. 33 No. "0" "1" "2" "3" "4" "5" "6" "7" "8" "9" "10" "11" "12" "13" "14" "15" "16" "17" Contents of display Normal Discharge pipe temperature protection control Discharge pipe temperature anomaly Current safe control of inverter primary current High pressure protection control High pressure anomaly Low pressure protection control Low pressure anomaly Anti-frost prevention control Current cut Power transistor protection control Power transistor anomaly (Overheat) Compression ratio control Spare Dewing prevention control Current safe control of inverter secondary current Stop by compressor rotor lock Stop by compressor startup failure In case of FDC100-140 refer to P.25䋬䋨㪍䋩.(a).1) P.25䋬䋨㪍䋩.(a).2) P.27䋬䋨㪍䋩.(g) P.25䋬䋨㪍䋩.(b).1)䋬P.26䋬䋨㪍䋩.(c).1) P.25䋬䋨㪍䋩.(b).2) P.26䋬䋨㪍䋩.(e).1)䇭 P.26䋬䋨㪍䋩.(e).2) P.27䋬䋨㪍䋩.(k) P.27䋬䋨㪍䋩.(g) P.27䋬䋨㪍䋩.(h) P.27䋬䋨㪍䋩.(i) P.26䋬䋨㪍䋩.(f) P.28䋬䋨㪍䋩.(l) P.27䋬䋨㪍䋩.(g) P.28䋬䋨㪍䋩.(q) - 47 - Note(1) Operation data display on the remote controller. 䊶Data is dispalyed until canceling the protection control. 䊶In case of multiple protections controlled, only the younger No. is displayed. Note(2) Common item. 㽲 In heating mode. During protection control by the command signal for reducing compressor frequency from indoor unit, No. "4" is displayed. 㽳 In cooling and dehumidifying mode. During protection control by the command signal for reducing compressor frequency from indoor unit, No. "8" is displayed. '10 • PAC-SM-137 (6) Inspection display of wireless specification model (FDEN, FDT) (a) Display 1) FDEN Series Romote controller signal receiving part Backup switch TIMER CHECK RUN Operation display light (Green) • Lights continuously: Under air conditioner operation • Keeps flashing: Under heating preparation (At the time of heating operation) • 3 time flash: Under reception of a remote controller signal Timer/Check display light (Yellow) Check monitor (Error code display E1~E60) 2) • Lights continuously: Under timer operation • 0.5 seconds lighting, 0.5 seconds stays OFF : At the time of anomalous • 2 seconds lighting, 1 second stays OFF : Filter sign FDT (Wireless kit) Romote controller signal receiving part Backup switch TIMER CHECK RUN Operation display light (Green) • Lights continuously: Under air conditioner operation • Keeps flashing: Under heating preparation (At the time of heating operation) • 3 time flash: Under reception of a remote controller signal Timer/Check display light (Yellow) • Lights continuously: Under timer operation • 0.5 seconds lighting, 0.5 seconds stays OFF : At the time of anomalous • 2 seconds lighting, 1 second stays OFF : Filter sign Check monitor (Error code display E1~E60) - 48 - '10 • PAC-SM-137 (7) Power transistor module (including the driver PCB) inspection procedure Is the power transistor module cracked or burnt? YES NO Is there a short circuit between the power transistor module terminals? 1 YES NO Compressor operation Is there any difference in the compressor current between phases? YES If there is a 10% or greater difference in the current in different phases. (except during acceleration or deceleration) NO Replace the outdoor unit inverter PCB Normal *1 Power transistor module terminal short circuit check procedure Disconnect the compressor wiring, then conduct a short circuit check. P-U, P-V, P-W N-U, N-V, N-W Check for a power transistor short circuit. • When you do not have a diagnostic checker for judging if the inverter is defective, measure between the terminals of the power transistor parts, judge whether the power transistor is defective or not. • Disconnect the compressor, then measure with the controller incorporated. Check between the P-N terminals. Bring the tester probes in contact with the following places on each te rminal. P: Power transistor P terminal, N: Power transistor N terminal, Tester Terminal Terminal (+) (-) U: End of red harness to compressor V: End of white harness to compressor P W: End of black or blue harness to compressor N N P P P P N N N U V W U V W U V W U V W P P P N N N Normal values (:) Model Model 71 100~140 0~ Approx. 1 M (Numerical Approx. 300~400 value rises.) Several M (Numerical value rises.) 0 Approx. 650 k Approx. 1.2 M Approx. 670 k Approx. 4.4 M Approx. 1.3 M Approx. 4.4 M Approx. 650 k 0 Approx. 4.8 M Approx. 4.9 M If the measured values range from 0 ~ several kW, there is a possibility that the elements are damaged, so replace the power transistor parts. - 49 - '10 • PAC-SM-137 (8) Inverter checker for diagnosis of inverter output 䇭䃂Checking method (a) Setup procedure of checker. 1) Power OFF (Turn off the breaker). 2) Remove the terminal cover of compressor and disconnect the wires (U, V, W) from compressor. 3) Connect the wires U (Red) , V (White) and W (Black) of checker to the terminal of disconnected wires (U, V, W) from compressor respectively. (b) Operation for judgment. 1) Power ON after JSW10-4 on outdoor inverter PCB was turned ON. 2) After 15 seconds since power has turned ON LED start ON/OFF for 5 seconds cyclically and it repeats 10 times. 3) Check ON/OFF status of 6 LED's on the checker. 4) Judge the PCB by ON/OFF status of 6 LED's on the checker. ON/OFF status of LED If all of LED are ON/OFF according to following pattern Inverter PCB If all of LED stay OFF or some of LED are ON/OFF Normal Anomalous Power ON or start check operation 1 2 3 During this period, ON/OFF status of LED is repeated cyclically according to following pattern 10 15 sec. 5sec. 5sec. 5sec. e) Be sure to turn off JSW10-4 on outdoor inverter PCB, after finishing the check operation. ޛInverter Checkerޜ LED LED ON/OFF pattern LED1 LED3 LED5 LED2 LED4 LED6 LED1 LED3 LED5 LED2 LED4 LED6 LED1 LED3 LED5 LED2 LED4 LED6 LED1 LED3 LED5 Cyclically Faston terminal Red White U Black V W Connect to the terminal of the wires which are disconnected from compressor. - 50 - LED2 LED4 LED6 LED1 LED3 LED5 LED2 LED4 LED6 LED1 LED3 LED5 LED2 LED4 LED6 䃂䇭ON 䂾䇭OFF - 51 - Brown Gray Orange White F 250V 20A Red Yellow/Green So2 T9 Ro2 T8 Si T2 Ri T1 G1 T4 F6 NOISE FILER PWB F3 PWB3 Ro3 T10 52X tq NOISE FILER PWB CNJ tq THo-IPM CH CNR LED1 Green 20S CNS CNO T22 T21 CNTH OPTION DH CNN THo-A LED2 Red CNIP CNB tq Must be conductive. When blown, replace with F3 fuse. Replace also fan motor. 63H1 CNA1 CNO2 CNA2 So3 T11 52 X So1 T6 Ro1 T5 tq LED2(Red) check: 1~5 time flash : Refer to page 32 Must be conductive. When fuse is blown, replace it or check wiring. 3 2 1 L N TB1 Measure the power supply at L.N. (It is normal if it is AC 220-240V) CNW * Power supply check: THo-S Noise filter check: There should be continuity. There should be no shorts between phase THo-R2 㨪 㨪 T24 L1 M EEVH CNEEV2 M CNV EEVC CNEEV1 T27 F4 250V 2A F3 250V 2A CNI3 CNI4 Fuse check: There should be continuity. If faulty, replace the control PCB CNE CNG1 CNG2 T26 PWB2 INVERTER PWB A/F MODULE T25 C1 No anomaly like breakage, swell, etc. allowed. CONTROL PWB PWB1 CNPS LPT LED1 Yellow 㧙 㧗 DC Reactor continuity Check: Max 25mǡ THo-D unit check points Check items with the *mark when the power is ON. THo-R1 ٨Outdoor tq CNW2 tq CNH tq T30 T29 T28 SW PWB B PWB4 CM LED1(Yellow) check: 1㨪6 fimes flash (Refer to page 32) Black White Red SW PWB A PWB4 W V U Voltage between terminals When stopped : 280V ~ 373V During operation : 380V ~ 390V When the outdoor unit fan motor is anomalous: (Refer to page 93) FMo M CNFAN CNI1 CNI2 DIP-IPM 20A CNQ1 CNQ2 Model FDC71VNX '10 • PAC-SM-137 (9) Outdoor unit controller failure diagnosis circuit diagram White White Blue Red White F 250V 30A Red Must be conductive. When fuse is blown, replace it or check wiring. 1 2 3 N L1 - L1o 52 - CNH tq CNTH 㧙 DH 20S CH1 F2 (250V, 4A) 㧙 18V 15V CNI3 CNI1 CNFAN2 CNFAN1 M SM2 SM1 CNEEV2 . P L2 C1 When the outdoor unit fan motor is abnormal: (Refer to page 93) M FMO2 M FMO1 N2 A/F MODULE 㧗 L1 DC Reactor continuity Check: Max 25mǡ CNA1 M CNEEV1 TB11 TB10 CNPS CNA2 LPT 52X1 F1 (250V, 2A) TB2 TB1 tq LED2(Red) check: 1~5 time flash : Refer to page 32 OPTION CNF CNS CNR LED2 LED1 (Red) (Green) PWB1 CONTROL PWB tq CNE tq CNIP CNB tq CNW2 CNW 㨪 tq 63H1 F 250V 4A E CT1 㧗 DM 㨪 tq RAM F 250V 8A E1 PWB3 No 2 NOISE FILTER 1 Ni L1i THo-P Yellow/Green THo-R2 TB THo-A Power supply check: Measure the power supply L1,N (It is normal if it is AC220-240V) THo-S * Noise filter check: There should be continuity. There should be no shorts between phases. unit check points Check items with the *mark when the power is ON. THo-D ٨Outdoor THo-R1 Models FDC100,125,140VNX CNACT1 N2 P CNI2 LED1 (Yellow) RAM CNE TB9 TB8 TB7 LED1 (Yellow) Check : 1㨪6 fimes flash (Refer to page 32) CNI4 DIP-IPM PWB2 INVERTER PWB Capacitor check: Check for anomaly in appearance such as damage, swelling, etc. Blue White Red W V U CM Check the power transistor module if there is short, open, or breakdown on the elements '10 • PAC-SM-137 * - 3 2 1 N L3 L2 L1 Black Blue White Red F 250V 8A L1o 63H1 T12 CN1 CN2-1 53 - THo-R2 tq DH 20S CH 4 2 CNM 6 52C R2 CNFAN2 CNFAN1 CNA1 18V 15V CNI3 CNI1 CNA2 㧙6 DM SM2 SM1 U Va FMO2 M FMO1 M R4 R3 L1 DC Reactor contiuity check:55mǡ or less When the outdoor unit fan motor is anomalous: (Refer to page 93) M CNEEV2 CNPS LPT AC3 AC2 AC1 R5 㧗4 M CNEEV1 F2 (250V, 4A) F1 (250V, 2A) LED2(Red) check: 1~5 time flash : Refer to page 32 OPTION CNF CNS CNR LED1 LED2 (Green) (Red) 5 3 1 R1 Resistance check: Resistance is measured (15ǡ) CONTROL PWB tq CNH THo-P tq PWB1 CNTH tq CNE tq CNIP CNB CT1 tq CNW2 No F 250V 4A CNW F1 L3o PWB3 L2o NOISE FILTER PWB RAM Ni L3i L2i L1i THo-A TB Noise filter check: There should be continuity. There should be no shorts between phases. THo-S Power supply check: Measure the power supply L1,L2,L3 (It is normal if it is AC380-415V) unit check points Check items with the *mark when the power is ON. THo-D ٨Outdoor THo-R1 FDC100,125,140VSX CNO1 CNW1 CNI2 CNR CNW2 TB6 TB5 LED1 (Yellow) Check 1㨪6 fimes flash (Refer to page 32) C2 C1 LED1 (Yellow) DIP-IPM INVERTER PWB PWB2 Capacitor check: Check for anomaly in appearance such as damage,swwll,etc. CNE TB9 TB8 TB7 Black White Red W RAM V U CM '10 • PAC-SM-137 '10 • PAC-SM-137 2.2 Troubleshooting flow (1) List of troubles No. Remote controller display Description of trouble Reference page 1 None Operates but does not cool. 55 2 None Operates but does not heat. 56 3 None Earth leakage breaker activated 57 4 None Excessive noise/vibration (1/3) 58 5 None Excessive noise/vibration (2/3) 59 6 None Excessive noise/vibration (3/3) 60 7 None Louver motor failure (FDT, FDTC and FDEN series) 61 8 None Power supply system error (Power supply to indoor control PCB) 62 9 None Power supply system error (Power supply to remote controller) 63 10 INSPECT I/U INSPECT I/U (When 1 or 2 remote controllers are connected) 64 11 INSPECT I/U INSPECT I/U (Connection of 3 units or more remote controllers) 65 WAIT 12 Communication error at initial operation 66~68 13 None No display 14 E1 Remote controller communication circuit error 69 70 15 E5 Communication error during operation 71 16 E6 Indoor heat exchanger temperature thermistor anomaly 72 17 E7 Return air temperature thermistor anomaly 73 18 E8 Heating overload operation 74 19 E9 Drain trouble (FDT, FDTC, FDU and FDUM series) 75 76 20 E10 Excessive number of connected indoor units (more than 17 units) by controlling with one remote controller 21 E14 Communication error between master and slave indoor units 77 22 E16 Indoor fan motor anomaly (In case of FDTC, FDT and SRK series) 78 23 E19 Indoor unit operation check, drain motor check setting error 79 24 E28 Remote controller temperature thermistor anomaly 80 25 E34 Open L3 phase on power supply (3-phase model only) 81 26 E35 Cooling overload operation 82 27 E36 Discharge pipe temperature error 83 28 E37 Outdoor heat exchanger temperature thermistor anomaly 84 29 E38 Outdoor air temperature thermistor anomaly 85 30 E39 Discharge pipe temperature thermistor anomaly 86 31 E40 High pressure error (63H1 activated) 87 32 E41 Power transistor overheat (Single phase model only) 33 E42 Current cut 34 E45 Inverter communication error 35 E47 Inverter PCB A/F module anomaly (Model FDC 71 only) 92 36 E48 Outdoor fan motor anomaly 93 37 E49 Low pressure error or low pressure sensor anomaly 38 E51 Inverter and fan motor anomaly 39 E53 Suction pipe temperature thermistor anomaly 97 40 E54 Low pressure sensor anomaly 98 41 E57 Insufficient refrigerant amount or detection of service valve closure 99 42 E59 Compressor startup failure 100 88 89, 90 91 94, 95 96 - 54 - '10 • PAC-SM-137 (2) Troubleshooting Error code Remote controller: None LED Green Red Content Indoor .HHSVÀDVKLQJ Stays OFF Operates but does not cool Outdoor .HHSVÀDVKLQJ Stays OFF 1. Applicable model 5. Troubleshooting All models Diagnosis Countermeasure Check the indoor unit fan operation. Check the temperature differnce between return and supply air. 2. Error detection method Is the temperature differnce between return and supply air 10-20degC at cooling? YES Does the heat load increase after installtion? NO It is normal. (This unit is designed to start in the soft start mode by detecting the under dome temperature of compressor when it restart after power reset. YES NO It is necessary to replace to higher capacity one or to install additional unit. Mistake in model selection. Calculate heat load once more. Is the compressor operating? NO “ WAIT ” message is displayed (for 3 seconds) when performing cooling, defrosting and heating operations from the remote controller. YES NO 3. Condition of Error displayed Is the compressor rotation speed low? NO YES 4. Presumable cause • Poor compression of compressor • Faulty expansion valve operation YES Check which control “Determination control of conpressor rotation speed” or “Protective control by controlling compressor rotation speed” is appropriate to this phenomenon. (1) Are the temperature conditions of room and outdoor air close YES to the rated conditions? Note (1) Outdoor: 35°C, Indoor: 27°C NO The unit is operating normally but is operating under the contol for protecting compressor or other respective parts. Note: - 55 - Compressor refrigerant oil protection control at starting is activated. For the contents of control, refer to the compressor start control of the microcomputer control functions. Compressor may be stopped by the error detection control. For the contents of control, refer to anomalous stop control by controlling compressor rotation speed of microcomputor control functions. Inspect the followings. • Minor clogging of filter • Minor clogging of heat exchanger • Minor short-circuit • Minor shortage of refrigerant amount • Poor compression of compressor Considering appropriate operation control, check suspicious points. Inspect the followings for reference. • Major clogging of filter • Major clogging of heat exchanger • Major short-circuit • Major shortage of refrigerant amount • Compressor protection ON • Indoor fan tap • Valid setting of silent mode '10 • PAC-SM-137 Error code Remote controller: None LED Green Red Content Indoor .HHSVÀDVKLQJ Stays OFF Operates but does not heat Outdoor .HHSVÀDVKLQJ Stays OFF 1.Applicable model 5. Troubleshooting All models Diagnosis Countermeasure Check the indoor unit fan operation. Check the temperature differnce between return and supply air. 2. Error detection method Is the temperature differnce between return and supply air 10-30degC at heating? YES Does the heat load increase after installtion? NO It is normal. (This unit is designed to start in the soft start mode by detecting the under dome temperature of compressor when it restart after power reset. YES NO It is necessary to replace to higher capacity one or to install additional unit. Mistake in model selection. Calculate heat load once again. Is the compressor operating? NO “ WAIT ” message is displayed (for 3 seconds) when performing cooling, defrosting and heating operations from the remote controller. YES NO 3. Condition of Error displayed Is the compressor rotation speed low? NO YES 4. Presumable cause • Faulty 4-way valve operation • Poor compression of compressor • Faulty expansion valve operation YES Check which control “Determination control of conpressor rotation speed” or “Protective control by controlling compressor rotation speed” is appropriate to this phenomenon. (1) Are the temperature conditions of room and outdoor air close YES to the rated conditions? Note (1) Outdoor: 7°C, Indoor: 20°C NO The unit is operating normally but is operating under the contol for protecting compressor or other respective parts. Note: - 56 - Compressor refrigerant oil protection control at starting is activated. For the contents of control, refer to the compressor start control of the microcomputer control functions. Compressor may be stopped by the error detection control. For the contents of control, refer to anomalous stop control by controlling compressor rotation speed of microcomputor control functions. Inspect the followings. • Minor clogging of filter • Minor clogging of heat exchanger • Minor short-circuit • Minor shortage of refrigerant amount • Poor compression of compressor Considering appropriate operation control, check suspicious points. Inspect the followings for reference. • Major clogging of filter • Major clogging of heat exchanger • Major short-circuit • Major shortage of refrigerant amount • Compressor protection ON • Indoor fan tap • Valid setting of silent mode '10 • PAC-SM-137 Error code Remote controller: None ED L rGeen Red Content Indoor Stays OFF Stays OFF Earth leakage breaker activated Outdoor Stays OFF Stays OFF 1.Applicable model 5. Troubleshooting All models Diagnosis Are OK the insulation resistance and coil resistance of compressor? Countermeasure NO Replace compressor.* NO Secure insulation resistance. YES 2. Error detection method Is insulation of respective harnesses OK? Is any harness bitten between pannel and casing or etc? YES Check the outdoor unit grounding wire/earth leakage breaker. 3. Condition of Error displayed Check of the outdoor unit grounding wire/earth leakage breaker Run an independent grounding wire from the grounding screw of outdoor unit to the grounding terminal on the distribution panel. (Do not connect to another grounding wire.) In order to prevent malfunction of the earth leakage breaker itself, confirm that it is conformed to higher harmonic regulation. * Insulation resistance of compressor 4. Presumable cause • Defective compressor • Noise • Immediately after installation or when the unit has been left for long time without power supply, the insulation resistance may drop to a few M because of refrigerant migrated in the compressor. When the earth breaker is activated at lower insulation resistance, check the following points. 6 hours after power ON, check if the insulation resistance recovers to normal. When power ON, crankcase heater heat up compressor and evaporate the refrigerant migrated in the compressor. Check if the earth leakage breaker is conformed to higher harmonic regulation or not. Since the unit is equipped with inverter, it is necessary to use components conformed to higher harmonic regulation in order to prevent malfunction of earth leakage breaker. Note: - 57 - '10 • PAC-SM-137 Error code Remote controller: None 1.Applicable model LED Green Red Indoor – – Outdoor – – Content Excessive noise/vibration (1/3) 5. Troubleshooting All models Diagnosis Does noise/v ration ib occur duringor soon after stop ingop p eration ofai r-conditioner ? 2. Error detection method If excessive noise/vibration SHUVLVWVZKHQVXI¿FLHQW time has elapsed after stopping the unit, it is considered that the airconditioner is not the source. O N ES Y ES Y I[nstallatoi n w ork] Doesnoise/vibratoi n occur not onlyfrom the air -conditioner ub t also rfom entire ub ilding? Doesth e i stallation of n indoor/outdoor unit loose? ES Y O N re p A ies touchingth ew all,etc? ES Y roduct ] [P Doesnoise/v ration ib occur from operating naf naf( only ) ? ES Y Isth ere afan or louver touchingoth er components? O N O N oT 2 / 3 4. Presumable cause Improper installation work • Improper anti-vibration work at instllation • Insufficient strength of mounting face Defective product • Before/after shipping from factory Improper adjustment during commissioning • Excess/shortage of refrigerant, etc. Note: - 58 - Check the installed condition carefully, and correct the position or insert rubber cushions or others into the gap, if necessary. Prevent the vibration from transmitting to wall and etc E\¿[LQJSLSHVRQWKHZDOO or wrapping rubber cushion around the pipe which goes through the hole in the wall or applying other appropriate means. Strength of ceiling ZDOOÀRRUHWFPD\EH LQVXI¿FLHQW5HYLHZWKH installing position or reinforce it. O N O N 3. Condition of Error displayed Countermeasure ES Y Check for leaning of installed unit or anomalous mounting of fan, louver or motor and specify the contacting point and correct it. When the heat exchanger RU¿OWHULVFORJJHGFOHDQ them. In case that the unit is installed at the site where background noise is very low, small noise from indoor unit can be heard, but it is normal. Before installation, check for background noise. If backgound nois is very low, convince client prior to installation. '10 • PAC-SM-137 Error code Remote controller: None 1.Applicable model LED Green Red Indoor – – Outdoor – – Content Excessive noise/vibration (2/3) 5. Troubleshooting All models Diagnosis Countermeasure rom 1/ 3 F re th A ep ies contactingth e casing ? 2. Error detection method nit ids e] [U Doesnoise/v ration ib occur w en the cooling h / eatingop h eratoi n is erformed p normally ? ES Y Rearrange the piping to avoid contact with the casing. ES Y It is noise/vibration that is generated when the refrigerant gas or liquid ÀRZWKURXJKLQVLGHRI piping of air-conditioner. It is likely to occur particularly during cooling or defrosting in the heating mode. It is normal. ES Y O N Isit h eard continuoush isngor roaringsound? O N O N oT 3 / 3 re h A isngsounds eard ta th h e startupor stop ing p ? ES Y O N Isbl owingso und he ard at the start/stop ofdefr ostin gdurin g he atin g? 3. Condition of Error displayed ES Y O N Iscrack ingnoise eard duringh h eating op eration? ES Y O N 4. Presumable cause isngnoise is H eard duringcooling h op eratoi n or after stop ing p . O N Note: - 59 - ES Y The noise/vibration occurs when the refrigerant starts RUVWRSVÀRZLQJ,WLV normal. When the defrosting starts or stops during heating, WKHUHIULJHUDQWÀRZLV reversed due to switching 4-way valve. This causes a large change in pressure which produces a blowing sound. It may accompany also the hissing sounds as mentioned above. They are normal. After the start or stop of heating operation or during defrosting, abrupt changes in temperature cause resin parts to shrink or expand. This is normal. It is the sound produced by the drain pump that discharges drain from the indoor unit. The pump continues to run for 5 minutes after stopping the cooling operation. This is normal. Apply the damper sealant at places considered to be the sources such as the pressure reducing mechanism (expansion valve), capillary, etc. '10 • PAC-SM-137 Error code Remote controller: None 1.Applicable model LED Green Red Indoor – – Outdoor – – Content Excessive noise/vibration (3/3) 5. Troubleshooting All models Diagnosis Countermeasure rom 2/ 3 F 2. Error detection method Ajustment d duringcommisioning Doesnoise/v ration occur w ib en th h e coolin/h egatni gop eration isin anomalousconditoi n? ,ILQVXI¿FLHQWFRROLQJ heating problem happens due to anomalous operating conditions at cooling/ heating, followings are suspicious. • Overcharge of refrigerant • Insufficient charge of refrigerant • Intrusion of air, nitrogen, etc. In such occasion, it is necessary to recover refrigerant, vacuum-dry and recharge refrigerant. * Since there could be many causes of noise/ vibration, the above do not cover all. In such case, check the conditions when, where, how the noise/vibration occurs according to following check point. 3. Condition of Error displayed • Indoor/outdoor unit • Cooling/heating/fan mode • Startup/stop/during operation • Operating condition (Indoor/outdoor temperatures, pressure) • Time it occurred • Operation data retained by the remote controller such as compressor rotation speed, heat exchanger temperature, EEV opening degree, etc. • Tone (If available, record the noise) • Any other anomalies 4. Presumable cause Note: - 60 - '10 • PAC-SM-137 Error code Remote controller: None LED Green Red Content Louver motor failure (FDT, FDTC and FDEN series) Indoor .HHSVÀDVKLQJ Stays OFF Outdoor .HHSVÀDVKLQJ Stays OFF 1.Applicable model 5. Troubleshooting FDT, FDTC and FDEN series only Diagnosis Countermeasure Check at the indoor unit side. Operate after waiting for more than 1 minute. 2. Error detection method Does the louver operate at the power on? NO NO Is LM wiring broken? YES YES Is LM locked? NO YES Is the louver operable with the remote controller? YES Repair wiring. Defective indoor control PCB ª Replace. Replace LM. Normal 3. Condition of Error displayed NO LM: louver motor 4. Presumable cause • Defective LM • LM wire breakage • Faulty indoor control PCB Note: - 61 - Adjust LM lever and then check again. '10 • PAC-SM-137 Error code Remote controller: None 1.Applicable model LED Green Red Power supply system error (Power supply to indoor control PCB) Outdoor Stays OFF 2 times flash Content Indoor Stays OFF Stays OFF 5. Troubleshooting All models Diagnosis Is AC220/240V detected between 1 and 2 on the terminal block of indoor unit? YES 2. Error detection method Countermeasure NO Is AC380/415V for 3-phase unit detected between 1, 2 and 3 on the teminal block of outdoor unit or is AC220/240V for 1-phase unit detected between 1 and 2 on the terminal block of outdoor unit? Note(1) FDT, FDTC Series: F200, F201 Other than FDT, FDTC: Fuse between wires (1) Are fuses OK (2 pcs.)? YES Defective outdoor control 3&%1RLVH¿OWHU Misconnection or breakage of connecting wires NO (2) Is the check of resistance between NO - of CNW0 OK? Note (2) Remove the transformer for YES other than FDT or FDTC Series. Is the (CNW1) checked result NO of resistance of FM, LM, etc OK? YES 3. Condition of Error displayed NO FDEN, FDUM, FDU Series FDT, FDTC Series (3) Is DC5V detected between - of CNW2? Defective indoor control or power PCB ª Replace. Replace FM, LM, etc. YES Replace fuse. NO Defective indoor power PCB ª Replace. Note (3) for GND YES Is JX1 open? NO YES 4. Presumable cause • Misconnection or breakage of connecting wires • Blown fuse • Faulty transformer • Faulty indoor control or power PCB • Broken harness • Faulty outdoor control PCB (Noise filter) Is AC19V or higher detected between RedRed (CNW2) at transformer secondary side? Open JX1. Defective indoor control PCB ª Replace. NO Replace transformer. NO Open JX1. YES Is JX1 open? YES Defective indoor control PCB ª Replace. Note: - 62 - '10 • PAC-SM-137 Error code Remote controller: None LED Green Red Content Power supply system error (Power supply to remote controller) Indoor .HHSVÀDVKLQJ Stays OFF Outdoor .HHSVÀDVKLQJ WLPHVÀDVK 1.Applicable model 5. Troubleshooting All models Diagnosis Countermeasure Isn't there any loose connection of remote controller wires? YES Correct. YES Replace wires. YES Replace remote controller. NO 2. Error detection method Isn't remote controller wire broken or short-circuited? NO Disconnect remote controller wires. 3. Condition of Error displayed Is DC15V or higher detected between X-Y of indoor unit terminal block? FDEN, FDUM, FDU Series NO FDT, FDTC Series Is DC180V between - of CNW2? NO Defective indoor power PCBªReplace. YES Defective indoor control PCBªReplace. 4. Presumable cause • Remote controller wire breakage/short-circuit • Defective remote controller • Malfunction by noise • Faulty indoor power PCB • Broken harness • Faulty indoor control PCB Is 24V or higher between (Brown-Brown) of transformer secondary side? NO YES Note: - 63 - Replace transformer. Defective indoor control PCBªReplace. '10 • PAC-SM-137 Error code Remote controller: INSPECT I/U LED Green Red Content Outdoor .HHSVÀDVKLQJ WLPHVÀDVK 1.Applicable model INSPECT I/U Indoor .HHSVÀDVKLQJ Stays OFF (When 1 or 2 remote controllers are connected) 5. Troubleshooting All models Diagnosis Countermeasure Are 2 units of remote controller connected? YES NO ⑴, ⑵ 2. Error detection method Communication between indoor unit and remote controller is disabled for more than 30 minutes after the power on. ⑵ Is it set at the slave remote controller? Set one remote controller for “Master” and the other for “Slave” Note (1) Use SW1 to set at master or slave. YES Set SW1 on remote controller PCB at “Master”. Note (2) “Slave” is displayed on the remote controller LCD. NO Does it become normal? NO Do more than one indoor units have the same address? Set address again. (SW2 on indoor control PCB) YES Separate remote controller wires from high voltage wires. NO 3. Condition of Error displayed Same as above YES Are remote controller wires laid along high voltage wires? NO Disconnect the connecting wire between the indoor and outdoor unit. 4. Presumable cause • Improper setting • Surrounding environment • Defective remote controller communication circuit • Faulty indoor control PCB Power supply reset Does DM start 60 seconds later automatically. YES NO Note: If any error is detected 30 minutes after displaying “ WAIT “INSPECT I/U”. - 64 - Defective indoor control PCBªReplace. Defective remote controller ªChange. ” on the remote controller, the display changes to '10 • PAC-SM-137 Error code emote controller: INSPECT I/U R ED L rGeen eRd Content Indoor .HHSVÀDVKLQJ Stays OFF (Connection of 3 units or more remote controller) Outdoor .HHSVÀDVKLQJ WLPHVÀDVK 1.Applicable model INSPECT I/U 5. Troubleshooting All models Diagnosis Are more than 3 units of remote controller connected? Countermeasure YES Reduce to 2 units or less. NO 2. Error detection method Indoor unit cannot communicate for more than 30 minutes after the power on with remote controller. Does remote controller display “Slave”? YES Change remote controller setting to “Master”. (SW1 on remote controller PCB) NO Do more than one indoor units have the same address? YES Change address. (SW2 on indoor control PCB) YES Change to master. (SW5-1, 2 on indoor control PCB) YES Correct NO Correct NO Defective outdoor control PCBªReplace. NO Broken connecting wireª Correct. NO Is it set to a slave indoor unit. SW5-1, 2? NO 3. Condition of Error displayed Is there loose or wrong connection at the termanal of wiring between indoor and outdoor units? NO Same as above Is the grounding wire connected properly? YES Is approx. DC20V detected between - on the outdoor unit terminal block? YES 4. Presumable cause • Improper setting • Surrounding environment • Defective remote controller communication circuit • Faulty indoor control or power PCB • Faulty outdoor control PCB Is approx. DC20V detected between - on the indoor unit terminal block? YES Defective indoor control or power PCBªReplace. Note: If any error is detected 30 minutes after displaying “ WAIT “INSPECT I/U”. - 65 - ” on the remote controller, the display changes to '10 • PAC-SM-137 LED Error code Remote controller: WAIT Green Red Content Communication error at initial operation (1/3) Indoor .HHSVÀDVKLQJ Stays OFF Outdoor .HHSVÀDVKLQJ WLPHVÀDVK 1.Applicable model 5. Troubleshooting All models Diagnosis Countermeasure “ WAIT ” is still displayed on the remote controller LED 2 minutes after power ON. See next page. A YES Is the outdoor unit control green LED flashing? NO 2. Error detection method YES Is the indoor unit green LED flashing? NO Defective indoor control PCBªReplace. NO Defective indoor control PCBª Replace. Defective remote controllerªReplace. Broken remote controller wire Yª Replace. Correct connection wires between indoor and outdoor units. YES Is the outdoor unit control red LED flashing twice? YES Are wires connected properly between indoor/ outdoor units? NO YES 3. Condition of Error displayed Is approx. DC20V detected between - on the outdoor unit terminal block? Defective outdoor control PCBªReplace. NO YES Is approx. DC20V detected between - on the indoor unit terminal block? YES 4. Presumable cause • Faulty indoor control or power PCB • Defective remote controller • Broken remote controller wire • Faulty outdoor control PCB • Broken connection wires Note: - 66 - NO Defective connection wire (Broken) Noise Defective indoor control or power PCBªReplace. '10 • PAC-SM-137 LED Error code Remote controller: WAIT Green Red Content Communication error at initial operation (2/3) Indoor .HHSVÀDVKLQJ Stays OFF Outdoor .HHSVÀDVKLQJ WLPHVÀDVK 1.Applicable model 5. Troubleshooting All models Diagnosis Countermeasure Diagnosis for when the outdoor control PCB LED is turned off A 2. Error detection method Shut down the breaker and back on again the breaker 3 minutes later. NO Does it reset normally? YES (1) Isn’t the outdoor unit controller power supply fuse (71:20A, 100~140:30A) blown? Note (1) 1-phase model only Normal (Malfunction by noise) NO To check method for inverter PCB before replacment of blown power supply fuse. YES See next page. B Is AC220/240V detected at the noise filter secondary side? NO 5HSODFHQRLVH¿OWHU NO Check connection of diode stack and electrolytic capacitor by refering main electrical circuit diagram YES 3. Condition of Error displayed Is DC255-310V detected at CNA2? YES Isn’t fuse 〔250V, 2A〕on the outdoor control PCB blown? NO Defective outdoor control PCBªReplace. NO Defective outdoor control PCBªReplace. NO Defective outdoor fan motor NO Defective inverter PCB ªReplace. YES Is DC5V detected on the outdoor control PCB (Between - of CNI1)? 4. Presumable cause • Faulty noise filter • Faulty indoor control PCB • Faulty outdoor control PCB • Faulty inverter PCB • Faulty fan motor YES Is DC5V detected if the connector of outdoor unit fan motor is disconnected? YES Is DC5V detected if the inverter power supply connector (CNI2) is disconnected? YES Note: - 67 - Defective outdoor control PCBªReplace. '10 • PAC-SM-137 ED L Error code Remote controller: WAIT rGeen Red Content Indoor .HHSVÀDVKLQJ Stays OFF Outdoor .HHSVÀDVKLQJ WLPHVÀDVK 1.Applicable model 5. Troubleshooting All models Diagnosis Communication error at initial operation (3/3) Countermeasure Method to check for inverter PCB before replacement of blown power supply fuse. B Isn’t there a short-circuit between phases of the noise filter? YES Replace the noise filter. NO 2. Error detection method Isn’t there a short-circuit between phases of inverter PCB input terminals? YES NO Isn’t there any crack, burning on the power transistor module? YES Replace the inverter PCB. NO Is the reactor OK? NO 3. Condition of Error displayed Replace the reactor. YES Is the electrolytic capacitor OK? Replace the electrolytic capacitor. YES 4. Presumable cause Replace the power supply fuse. • Blown fuse • Faulty noise filter • Faulty inverter PCB • Faulty reactor • Faulty electrolytic capacitor Note: - NO 68 - '10 • PAC-SM-137 Error code Remote controller: None LED Green Red Content Indoor .HHSVÀDVKLQJ Stays OFF No display Outdoor .HHSVÀDVKLQJ WLPHVÀDVK 1.Applicable model 5. Troubleshooting All models Diagnosis Countermeasure Remote controller does not display anything after the power on. Is DC10V or higher detected at remote controller connection terminals? YES Defective remote controller NO 2. Error detection method Is DC10V or higher detected on remote controller wires if the remote controller is removed? YES Defective remote controller YES Defective connecting wire. Defective remote controller wire (Short-circuit, etc.) NO Are wires connected properly between the indoor/outdoor units? NO Defective indoor control PCBªReplace. 3. Condition of Error displayed 4. Presumable cause • Faulty indoor control PCB • Defective remote controller • Broken remote controller wire Note: - 69 - '10 • PAC-SM-137 Error code Remote controller: E1 LED Green Red Content Indoor .HHSVÀDVKLQJ Stays OFF Outdoor .HHSVÀDVKLQJ Stays OFF 1.Applicable model Remote controller communication circuit error 5. Troubleshooting All models Diagnosis Is it possible to reset normally by the power reset? Countermeasure Malfunction by noise Check peripheral environment. YES NO 2. Error detection method When normal communication between the remote controller and the indoor unit is interrupted for more than 2 minutes. (Detectable only with the remote controller) Turn SW7-1 to OFF. ON Remove the wire connecting between indoor/outdoor units. Power reset Does the drain pump restart automatically 1 minute later? Defective indoor control PCB ª Replace. YES NO Note (2) Does the remote controller still display “ after 3 minutes? WAIT ” even Defective remote controller ª Replace. 3. Condition of Error displayed Same as above 4. Presumable cause • Defective communication circuit between remote controller-indoor unit • Noise • Defective remote controller • Faulty indoor control PCB Note:If the indoor unit cannot communicate normally with the remote controller for 180 seconds, the indoor unit PCB starts to reset automatically. - 70 - '10 • PAC-SM-137 Error code Remote controller: E5 LED Green Red Content Indoor .HHSVÀDVKLQJ WLPHVÀDVK Communication error during operation Outdoor .HHSVÀDVKLQJ See below 1.Applicable model 5. Troubleshooting All models Diagnosis Countermeasure In case that the outdoor unit red LED flashes 2-times Note (1) Inspect faulty connections (disconnection, looseness) on the outdoor unit terminal block. Is the connection of signal wires at the outdoor unit side OK? 2. Error detection method When normal communication between indoor and outdoor unit is interrupted for more than 2 minutes. NO Repair signal wires. YES Note (2) Check for faulty connection or breakage of signal wires between indoor-outdoor units. Is the connection of signal NO wires between indoor-outdoor units OK? Repair signal wires. YES Power reset Has the remote controller LCD returned to normal state? NO To the diagnosis of “ WAIT ” YES Unit is normal. (Malfunction by temporary noise, etc.) 3. Condition of Error displayed In case that the outdoor unit red LED stays OFF Same as above is detected during operation. Power reset NO Has the remote controller LCD returned to normal state? NO YES 4. Presumable cause Defective outdoor control PCB (Defective network communication circuit) ª Replace. Unit is normal. (Malfunction by temporary noise, etc.) • Unit No. setting error • Broken remote controller wire • Faulty remote controller wire connection • Faulty outdoor control PCB Note: Pressing the pump-down switch cancels communications between indoor and outdoor unit so that “communication error-E5” is displayed on indoor unit and remote controller, but it is normal. - 71 - '10 • PAC-SM-137 Error code Remote controller: E6 LED Green Red Content Indoor heat exchanger temperature thermistor anomaly Indoor .HHSVÀDVKLQJ WLPHÀDVK Outdoor .HHSVÀDVKLQJ Stays OFF 1.Applicable model 5. Troubleshooting All models Diagnosis Countermeasure Is the connection of indoor heat exchanger temperature thermistor connector OK? NO Correct. ª Insert connector securely. YES 2. Error detection method Anomalously low temperature or high temperature (resistance) is detected on the indoor heat exchanger thermistor (ThI-R1, R2 or R3). Are characteristics of indoor heat exchanger temperature thermistor OK? NO YES 3. Condition of Error displayed Temperature-resistance characteristic (Broken wire) 15 Temperature thermistor resistance (k) • When the temperature thermistor detects -50 (-28)°C or lower for 5 (15) seconds continuously, the compressor stops. After 3-minutes delay, the compressor starts again automatically, but if this error occurs again within 60 minutes after the initial detection. Note (1) Value in ( ) are for the models SRK 50, 60. • Or if 70°C or higher is detected for 5 seconds continuously. (FDTC, FDT, FDEN, FDUM, FDU series only) 10 5k at 25°C 5 (Shot circuit) 4. Presumable cause 0 10 20 30 Temperature (°C) • Defective indoor heat exchanger thermistor connector • Indoor heat exchanger temperature thermistor anomaly • Faulty indoor control PCB Note: - 72 - 40 50 Defective indoor heat exchanger temperature thermistor ª Replace. Defective indoor control PCB ª Replace. (Defective indoor unit heat exchanger temperature thermistor input circuit) '10 • PAC-SM-137 Error code Remote controller: E7 LED Green Red Content Indoor .HHSVÀDVKLQJ WLPHÀDVK Outdoor .HHSVÀDVKLQJ Stays OFF 1.Applicable model Return air temperature thermistor anomaly 5. Troubleshooting All models Diagnosis Is the connection of return air temperature thermistor connector OK? Countermeasure NO Correct. ª Connect connector. NO Defective return air temperature thermistor ª Replace. YES Defective indoor control PCB ª Replace. (Defective return air temperature thermistor input circuit) YES Anomalously low temperature or high temperature (resistance) is detected by indoor return air temperature thermistor (Thi-A) 3. Condition of Error displayed • When the temperature thermistor detects -50 (-45)°C or lower for 5 (15) seconds continuously, the compressor stops. After 3-minute delay, the compressor starts again automatically, but if this error occurs again within 60 minutes after the initial detection. Note (1) Value in ( ) are for the models SRK 50, 60. 4. Presumable cause Are the characteristics of return air temperature thermistor OK? Temperature-resistance characteristic (Broken wire) Temperature thermistor resistance (k) 2. Error detection method 15 10 5k at 25°C 5 (Shot circuit) 0 • Defective return air temperature thermistor connector • Defective return air temperature thermistor • Faulty indoor control PCB 10 20 30 Temperature (°C) Note: - 73 - 40 50 '10 • PAC-SM-137 Error code Remote controller: E8 LED Green Red Content Indoor .HHSVÀDVKLQJ WLPHÀDVK Heating overload operation Outdoor .HHSVÀDVKLQJ Stays OFF 1.Applicable model 5. Troubleshooting All models Diagnosis Is the air filter clogged? NO 2. Error detection method Indoor heat exchanger temperature thermistor (ThI-R1, R2, R3) Countermeasure Is the indoor heat exchanger temperature thermistor connection OK? YES Wash. NO Defective indoor heat exchanger temperature thermistor connectorª Correct. NO Defective indoor heat exchanger temperature thermistor. NO Check refrigerant system. YES Adjust YES (2) Are the characteristics of indoor heat exchanger temperature thermistor OK? YES Check the error data with the remote controller. 3. Condition of Error displayed Is the unit operating in the state of heating overload? When it is detected 5 times within 60 minutes from initial detection or when the overload condition is detected for 6 minutes continuously. Note (1) Judge if it is in the state of overload or not as follows. Is there any short-circuit of air? Isn’t there any fouling or clogging on the indoor heat exchanger? Is the outdoor fan control normal? Isn't the room and outdoor air temperature too high? Note (2) For characteristics of indoor heat exchanger temperature thermistor, see the error display E6. Error stop 4. Presumable cause Reset • Clogged air filter • Defective indoor heat exchanger temperature thermistor connector • Defective indoor heat exchanger temperature thermistor • Anomalous refrigerant system 56 63 Indoor heat exchanger temperature (°C) Note: During heating operation; After starting compressor, compressor rotation speed is decreased by detecting indoor heat exchanger temperature (Thi-R) in order to control high pressure. - 74 - '10 • PAC-SM-137 Error code Remote controller: E9 LED Green Red Content Drain trouble (FDT, FDTC, FDU, and FDUM series) Indoor .HHSVÀDVKLQJ WLPHÀDVK Outdoor .HHSVÀDVKLQJ Stays OFF 1.Applicable model 5. Troubleshooting FDT, FDTC, FDU and FDUM series only Diagnosis Countermeasure Check the error data in the remote controller. Is there any overflow? NO (1) Is DC 12V at CNI connector. NO &KHFNÀRDWVZLWFK YES 2. Error detection method Note(1) FDUM, FDU only. Float switch is activated Is the CNI connected firmly? YES NO Defective indoor control PCB ª Replace. NO Defective indoor control PCB ª Replace. YES Is there any anomaly on the optional equipment? Is the humidifier connected? Check optional equipment YES YES Is the humidifier Drain Motor interlocked by the indoor unit function setting of remote controller? 3. Condition of Error displayed ,IWKHÀRDWVZLWFK23(1 is detected for 3 seconds FRQWLQXRXVO\RULIÀRDW switch connector or wire is disconnected. Correct setting to ³+XPLGL¿HU'0LQWHUORFN´ NO NO YES Drain motor ON from the remote controller Is AC220/240V detected at CNR connector? NO Does DM operate? NO YES Defective indoor control PCB ª Replace. (Replace power PCB on FDT and FDTC Series.) Check wiring of Drain motor YES 4. Presumable cause • Defective indoor control or power PCB • Float switch setting error • Humidifier DM interlock setting error • Optional equipment setting error • Drain piping error • Defective drain motor • Disconnection of drain motor wiring Is the drain piping unclogged? Is the drain pipe slop OK? NO YES Correct. Check drain motor. Note::KHQWKLVHUURURFFXUUHGDWSRZHU21GLVFRQQHFWLRQRIZLUHRUFRQQHFWRURIWKHÀRDWVZLWFKLVVXVSHFWHG&KHFNDQG correct it (or replace it, if necessary). - 75 - '10 • PAC-SM-137 Error code Remote controller: E10 LED Green Excessive number of connected indoor units (more than 17 units) by controlling with one remoto controller Red Content Indoor .HHSVÀDVKLQJ Stays OFF Outdoor .HHSVÀDVKLQJ Stays OFF 1.Applicable model 5. Troubleshooting All models Diagnosis Aren't more than 17 indoor units connected to one remote controller? Countermeasure NO YES 2. Error detection method When it detects more than 17 of indoor units connected to one remote contorller 3. Condition of Error displayed Same as above 4. Presumable cause • Excessive number of indoor units connected • Defective remote controller Note: - 76 - Defective remote controller ª Replace. Reduce to 16 or less units. '10 • PAC-SM-137 Error code emote controller: E14 R ED L rGeen eRd ontent C Communication error between master and slave indoor units Indoor Keeps flashing 3 times flash Outdoor Keeps flashing Stays Off 1.Applicable model 5. Troubleshooting All models Diagnosis Countermeasure Is it OK the unit address setting for master and slave indoor units? Correct unit address setting. NO YES 2. Error detection method Isn’t the remote controller wiring between indoor units defective? When communication error between master and slave indoor units occurs YES Correct wiring. NO Defective indoor control PCB Replace. YES • Malfunction by noise • Check surrounding environment. NO Is it restored by resetting the power supply? Note (1) Set dip switches SW5-1 and SW5-2 as shown in the following table. (Factory default setting – “Master”) 3. Condition of Error displayed Indoor unit Same as above Dip switch Master Slave-a Slave-b Slave-c SW5-1 OFF OFF ON ON SW5-2 OFF ON OFF ON 4. Presumable cause • Unit address setting error • Broken remote controller wire • Defective remote controller wire connection • Defective indoor control PCB Note: - 77 - '10 • PAC-SM-137 Error code Remote controller: E16 LED Green Red Content Indoor .HHSVÀDVKLQJ Stays OFF (-) Indoor fan motor anomaly (In case of FDTC, FDT and SRK series) Outdoor .HHSVÀDVKLQJ Stays OFF Note (1) Value in ( ) are for the model SRK. 1.Applicable model 5. Troubleshooting FDTC, FDT and SRK series only Diagnosis Countermeasure Does any foreign material intervene in rotational area of fan propeller? Remove foreign material. YES NO 2. Error detection method Does the fan rotate smoothly when turned by hand? Replace the fan motor. NO Detected by rotation speed of indoor fan motor YES Note (1) , for GND (1) Is DC280V detected between -(-) of fan motor connector CNM (CNU)? YES NO SRK series NO Is the fuse F202 blown? Power supply reset YES 3. Condition of Error displayed • When actual rotation speed of indoor fan motor drops to lower than 200rpm for 30 seconds continuously, the compressor and the indoor fan motor stop. • After 2-seconds, it starts again automatically, but if this error occurs 4 times within 60 minutes after the initial detection. (FDTC, FDT series only) NO Is it normalized? YES 4. Presumable cause • Defective indoor power (control) PCB • Foreign material at rotational area of fan propeller • Defective fan motor • Dust on control PCB • Blown fuse • External noise, surge Note: - 78 - Replace indoor control PCB FDTC, FDT series Check power voltage. Replace faulty fan motor and power PCB. Replace fan motor. (If the error persists after replacing the fan motor, replace the indoor control PCB.) Malfunction by temporary noise '10 • PAC-SM-137 Error code Remote controller: E19 LED Green Red Content Indoor .HHSVÀDVKLQJ WLPHÀDVK Outdoor .HHSVÀDVKLQJ Stays OFF 1.Applicable model Indoor unit operation check, drain motor check setting error 5. Troubleshooting All models Diagnosis Countermeasure E19 occurs when the power ON 2. Error detection method After indoor operation check, when the communication between indoor and outdoor unit is established and SW7-1 is still kept ON. Is SW7-1 on the indoor control PCB ON ? NO Defective indoor control PCB (Defective SW7) ªReplace Turn SW7-1 on the indoor control PCB OFF and reset the power YES 3. Condition of Error displayed Same as above 4. Presumable cause Mistake in SW7-1 setting (Due to forgetting to turn OFF SW7-1 after indoor operation check) Note: - 79 - '10 • PAC-SM-137 Error code Remote controller: E28 LED Green Red Content Remote controller temperature thermistor anomaly Indoor .HHSVÀDVKLQJ Stays OFF Outdoor .HHSVÀDVKLQJ Stays OFF 1.Applicable model 5. Troubleshooting All models 2. Error detection method Detection of anomalously low temperature (resistance) of remote controller temperature thermistor (Thc) Diagnosis Is the remote controller temperature thermistor connected properly? Countermeasure NO YES Are the characteristics of remote controller temperature thermistor OK? Is the thermistor wire OK? NO YES 3. Condition of Error displayed When the temperature thermistor detects -50°C or lower for 5 seconds continuously, the compressor stops. After 3-minutes delay, the compressor starts again automatically, but if this error occurs again within 60 minutes after the initial detection. 4. Presumable cause • Faulty connection of remote controller temperature thermistor • Defective remote controller temperature thermistor • Defective remote controller PCB Correct. Defective remote controller temperature thermistor ª Replace. Defective remote controller PCB ª Replace. (Defective remote controller temperature thermistor input circuit) Resistance-temperature characteristics of remote controller temperature thermistor (ThC) Temperature (°C) Resistance value (k) Temperature (°C) Resistance value (k) 0 65 30 16 1 62 32 15 2 59 34 14 4 53 36 13 6 48 38 12 8 44 40 11 10 40 42 9.9 12 36 44 9.2 14 33 46 8.5 16 30 48 7.8 18 27 50 7.3 20 25 52 6.7 22 23 54 6.3 24 21 56 5.8 26 19 58 5.4 28 18 60 5.0 Note: After 10 seconds has passed since remote controller thermistor was switched from valid to invalid, E28 will not be displayed even if the thermistor harness is disconnected. At same time the thermistor, which is effective, is switched from remote controller thermistor to indoor return air temperature thermistor. Even though the remote controller thermistor is set to be Effective, the return air temperature displayed on remote controller for checking still shows the value detected by indoor return air temperature thermistor, not by remote controller temperature thermistor. - 80 - '10 • PAC-SM-137 Error code Remote controller: E34 LED Green Red Content Open L3 phase on power supply Indoor Keeps flashing Stays OFF (3-phase model only) Outdoor Keeps flashing 1 time flash 1.Applicable model 5. Troubleshooting 3-phase model only Diagnosis Measure the power supply voltage. Is AC380/415V between respective phases? Countermeasure NO Check power supply. YES 2. Error detection method When 0V is detected on any of L1, L2, L3 for 5 seconds continuously after turning power on. Is AC380/415V detected between respective phases at the secondary side of noise filter? NO 5HSODFHQRLVH¿OWHU NO Connect properly. YES Is wiring between the noise filter and the outdoor control PCB connected properly? YES 3. Condition of Error displayed Same as above 4. Presumable cause • Anomalous power supply • Blown power supply fuse • Defective noise filter • Defective wire connection on noise filter control PCB • Defective outdoor control PCB Note: - 81 - Defective outdoor control PCBªReplace. '10 • PAC-SM-137 Error code Remote controller: E35 LED Green Red Content Cooling overload operation Indoor Keeps flashing Stays OFF Outdoor Keeps flashing 1 time flash 1.Applicable model 5. Troubleshooting All models Diagnosis Countermeasure * For the characteristics of outdoor heat exchanger temperature Are the thermistor, refer to E37. characteristics of outdoor heat exchanger NO temperature thermistor normal? Replace outdoor heat exchanger temperature thermistor. YES 2. Error detection method For the error detection method, refer to the protective control by controlling compressor rotation speed and cooling high pressure protective control of micro computer control function for corresponding models. Is the unit operating in the state of cooling overload? YES NO Is the high pressure control normal? Check unit side. • Isn’t the air circulation of outdoor unit shortcircuited? • Are installation spaces adequate? • Isn’t there any fouling or clogging on heat exchanger? NO Control operation check * NO Defective outdoor control PCBªReplace. YES 3. Condition of Error displayed Is the temperature (measured actually) at detection of error correct? When outdoor heat exchanger temperature anomaly is detected 5 times within 60 minutes or this anomalous state is detected 60 minutes continuously including compressor stop. YES * For the contents of control, refer to the protective control by controlling compressor rotation speed and cooling high pressure protective control of micro computer control function for corresponding models. 4. Presumable cause • Defective outdoor heat exchanger temperature thermistor • Defective outdoor control PCB • Indoor, outdoor unit installation spaces • Short-circuit of air on indoor, outdoor units • Fouling, clogging of heat exchanger • Excessive refrigerant amount Note: - 82 - Excessive refrigerant amount : Recharge refrigerant by weighing proper amount on a scale. '10 • PAC-SM-137 Error code Remote controller: E36 LED Green Red Content Indoor .HHSVÀDVKLQJ Stays OFF Discharge pipe temperature error Outdoor .HHSVÀDVKLQJ WLPHÀDVK 1.Applicable model 5. Troubleshooting All models Diagnosis Countermeasure * For the characteristics of discharge Are the pipe temperature, refer to E39. characteristics of discharge pipe temperature NO thermistor normal? Replace discharge pipe temperature thermistor. YES 2. Error detection method For the error detection method, refer to the protective control by controlling compressor rotation speed and cooling high pressure protective control of micro computer control function for corresponding models. Is the discharge pipe temperature error persisted during cooling operation? YES ,QVXI¿FLHQWUHIULJHUDQW amount : Recharge refrigerant by weighing proper amount on a scale. NO Is the discharge pipe temperature control normal? NO Control operation check * NO Defective outdoor control PCBªReplace. YES 3. Condition of Error displayed When discharge pipe temperature anomaly is detected 2 times within 60 minutes or this anomalous state is detected 60 minutes continuously including compressor stop. Is the temperature (measured actually) at detection of error correct? YES * For the contents of control, refer to the protective control by controlling compressor rotation speed and cooling high pressure protective control of micro computer control function for corresponding models. 4. Presumable cause • Defective outdoor control PCB • Defective discharge pipe temperature thermistor • Clogged filter • Indoor, outdoor unit installation spaces • Short-circuit of air on indoor, outdoor units • Fouling, clogging of heat exchanger Note: - 83 - Check unit side: • Isn’t filter clogged? • Are adequate indoor, outdoor unit installation spaces? • Isn’t there any shortcircuit of air? • Isn’t there any fouling, clogging on indoor heat exchanger? '10 • PAC-SM-137 Error code Remote controller: E37 LED Green Red Content Outdoor heat exchanger temperature themistor anomaly Indoor .HHSVÀDVKLQJ Stays OFF Outdoor .HHSVÀDVKLQJ WLPHÀDVK 1.Applicable model 5. Troubleshooting All models Diagnosis Countermeasure Is the outdoor heat exchanger temperature thermistor connector connected properly? For the characteristics of outdoor heat exchanger temperature thermistor, see the following graph. Are the characteristics of outdoor heat exchanger temperature thermistor OK? NO Defective outdoor heat exchanger temperature thermistorªReplace. YES Defective outdoor control PCBªReplace. (Defective outdoor heat exchanger temperature thermistor input circuit) Temperature-resistance characteristics 3. Condition of Error displayed 4. Presumable cause Temperature thermistor resistance (k) (Broken wire) • When the temperature thermistor detects -50°C or lower for 20 seconds continuously within 2 minutes to 2 minutes 20 seconds after the compressor ON, the compressor stops. After 3-minutes delay, the compressor starts again automatically, but if this anomalous temperature is detected 3 times within 40 minutes. • When -50°C or lower is detected for 5 seconds continuously within 20 second after compressor ON. Correct connector. YES 2. Error detection method Detection of anomalously low temperature (resistance) on the outdoor heat exchanger temperature thermistor NO (Shot circuit) 15 10 5k at 25°C 5 0 10 20 30 40 Temperature (°C) • Defective outdoor control PCB • Broken thermistor harness or temperature sensing section • Disconnected wire connection (connector) Note: - 84 - 50 '10 • PAC-SM-137 Error code Remote controller: E38 LED Green Red Content Outdoor air temperature thermistor anomaly Indoor .HHSVÀDVKLQJ Stays OFF Outdoor .HHSVÀDVKLQJ WLPHÀDVK 1.Applicable model 5. Troubleshooting All models Diagnosis Is the outdoor air temperature thermistor connector connected properly? Countermeasure NO Correct connector. YES For the characteristics of outdoor air temperature thermistor, see the following graph. Is the characteristics of the NO outdoor air temperature thermistor OK? 2. Error detection method Detection of anomalously low temperature (resistance) on outdoor air temperature thermistor YES Temperature-resistance characteristics 3. Condition of Error displayed • When the temperature thermistor detects -45°C or lower for 5 seconds continuously within 2 minutes to 2 minutes 20 seconds after the compressor ON, the compressor stops. After 3-minutes delay, the compressor starts again automatically, but if this anomalous temperature is detected 3 times within 40 minutes. • When -45°C or lower is detected for 5 seconds continuously within 20 second after compressor ON. Temperature thermistor resistance (k7) (Broken wire) 35 (Shot circuit) 30 25 20 15 10 5 0 0 10 20 30 40 Temperature (°C) 4. Presumable cause • Defective outdoor control PCB • Broken thermistor harness or temperature sensing section (Check molding.) • Disconnected wire connection (connector) Note: - 85 - 50 Defective outdoor air temperature thermistorª Replace. Defective outdoor control PCBªReplace. (Defective outdoor air temperature thermistor input circuit) '10 • PAC-SM-137 Error code Remote controller: E39 LED Green Red Content Discharge pipe temperature thermistor anomaly Indoor .HHSVÀDVKLQJ Stays OFF Outdoor .HHSVÀDVKLQJ WLPHÀDVK 1.Applicable model 5. Troubleshooting All models Diagnosis Countermeasure Is the discharge pipe temperature thermistor connector connected properly? Correct connector. NO YES 2. Error detection method For the characteristics of discharge pipe Are the temperature thermistor, see the following graph. characteristics of discharge pipe NO temperature thermistor OK? Detection of anomalously low temperature (resistance) on the discharge pipe temperature thermistor Defective outdoor control PCBªReplace. (Defective temperature thermistor input circuit) YES (Broken wire) Temperature thermistor resistance (k7) 10 (Shot circuit) 温度センサ抵抗 When the temperature thermistor detects -10°C or lower for 5 seconds continuously within 10 minutes to 10 minutes 20 seconds after the compressor ON, the compressor stops. After 3-minutes delay, the compressor starts again automatically, but if this anomalous temperature is detected 3 times within 40 minutes. Temperature-resistance characteristics 温度センサ抵抗 3. Condition of Error displayed 100200 180 〔T?80?〕 160 140 120 50100 80 60 (k) 40 20 0 0 0 0 〔T?80?〕 T?80? T?80? 5 (k) 20 40 60 80 80 100100 120 50 Temperature (°C) 温 度〔T〕 (?) 4. Presumable cause • Defective outdoor control PCB • Broken thermistor harness or temperature sensing section (Check molding.) • Disconnected wire connection (connector) Note: - 86 - 0 140 Defective discharge pipe temperature thermistorª Replace. 160 '10 • PAC-SM-137 LED Error code Remote controller: E40 Green Red Content High pressure error (63H1 activated) Indoor Keeps flashing Stays OFF Outdoor Keeps flashing 1 time flash 1.Applicable model 5. Troubleshooting All models Diagnosis Countermeasure If the power supply breaker is turned OFF and ON too quickly, E40 may be displayed. (This is normal.) Is the service valve fully opened? 2. Error detection method When the high pressure switch 63H1 is activated. Open service valve. NO YES Has 63H1 activated? NO Compressor OFF Compressor ON 3.15 4.15 High pressure (MPa) 3. Condition of Error displayed If 63H1 turns OFF (opened), the compressor stops. After 3-minutes delay, the compressor restarts. If this anomaly occurs 5 times within 60 minutes or continues for 60 minutes continuously. On operation of 63H1 YES 1. During cooling ・Is the outdoor fan motor running? ・Isn’t any short-circuit of air on the outdoor unit? ・Are sufficient return air/supply air space secured? 2. During heating ・Isn’t the indoor heat exchanger temperature thermistor disconnected from the thermistor casing? ・Isn’t the filter clogged? * Under the condition of overcharging refirgerant, 63H1 may activate due to delay of starting the preventive control by compressor speed control, because detected heat exhanger temperature, which conducts compressor speed control, becomes lower than normal condition due to excess sub-cooling degree. Is 63H1 connector connected properly? Correct 63H1 connector. NO Correct electronic expansion valve connector. YES Is the electronic expansion valve connector connection OK? If any anomaly exists on the electronic expansion valve connector connection, the power supply must be reset. YES 4. Presumable cause NO Defective outdoor control PCBªReplace. (Defective 63H1 input circuit) • Short circuit of air flow, disturbance of air flow and clogging filter at outdoor heat exchanger/Breakdown of fan motor • Defective outdoor control PCB • Defective 63H1 connector • Defective electronic expansion valve connector • Closed service valve • Mixing of non-condensing gas (nitrogen, etc.) Note: In the protective control range for compressor startup (initial startup after power ON), even if 63H1 is activated only once (63H1turns OFF), immediately the error is displayed. – 87 – '10 • PAC-SM-137 LED Indoor control PCB Green Keeps flashing Red Stays OFF Remote controller: E41 Outdoor control PCB Keeps flashing 1 time flash Error code Outdoor inverter PCB 1.Applicable model Content Power transistor overheat (Single phase model only) Yellow LED 6 times flash or 2 times flash 5. Troubleshooting Single phase model only Diagnosis Is it possible to reset the error for about 10 minute after the compressor stopped? Countermeasure NO NODefective inverter PCB YES Is it reset? Is the installation space of outdoor unit enough? NO YES Correct. YES NO OK Replace power transistor. 2. Error detection method Anomalous rise of the internal power transistor temperature Is the outdoor fan running? NO Replace the fan motor or outdoor control PCB. YES Are the characteristics of power transistor temperature thermistor OK? NO YES Replace the power transistor temperature thermistor. Is the power transistor temperature thermistor connector connection OK? NO YES Connect. 3. Condition of Error displayed When anomalous rise of the internal power transistor temperature is detected 5 times within 1 hour. Is it OK the fixing to power transistor radiator fin? ・Fixed screw ・Application of radiation silicone Fix properly. NO YES YES • Defective inverter PCB • Defective outdoor fan motor • Improperly fixed power transistor radiator fin • Delective power transistor temperature thermistor • Inadequate installation space NO * Characteristics of power transistor temperature thermistor (Broken wire) Temperature thermistor resistance (k) 4. Presumable cause Does it recur? Temperature-resistance characteristics 200 180 160 140 120 100 80 60 40 20 0 0 20 40 60 (Shot circuit) 80 100 Temperature (°C) Note: – 88 – 120 140 OK '10 • PAC-SM-137 LED Indoor control PCB Green Keeps flashing Red Stays OFF Remote controller: E42 Outdoor control PCB Keeps flashing 1 time flash Error code Outdoor inverter PCB 1.Applicable model Yellow LED Stays off or 4 times flash Content Current cut (1/2) 5. Troubleshooting All models Diagnosis Is the Power supply voltage OK? Countermeasure NO Check power supply. NO Open the valves. YES 2. Error detection method In order to prevent from overcurrent of inverter, if the current exceeds the VSHFL¿FDWLRQVLWPDNHVWKH compressor stopping. Are the service valves opened? YES Is the high pressure during operation OK? NO YES 3. Condition of Error displayed • If the output current of inveter H[FHHGVWKHVSHFL¿FDWLRQV it makes the compressor stopping. • After 3-minute delay, the compressor restarts, but if this amonaly occurs 4 times within 30 minute after the intial detection. Is the checked result of insulation resistance and NO coil resistance (1) of compressor motor OK? (1) 1.154 or more at 20°C (Model FDC71VNX) 0.293 or more at 20°C (Models FDC100∼140VNX) 1.172 or more at 20°C (Models FDC100∼140VSX) YES Continues to next page. 4. Presumable cause • The valves closed • Faulty power supply • Insufficient refrigerant amount • Faulty compressor • Faulty power transistor module Note: – 89 – Check refrigerant amount and refregerant circuit *In case of transitional increase of high pressure and/or test run, several times restarting may recover it, because liquid refrigerant (migrated) in the compresser is discharged from the compressor. Replace compressor. '10 • PAC-SM-137 Error code LED Indoor Remote controller: E42 Outdoor control PCB Outdoor inverter PCB 1.Applicable model Green Keeps flashing Red Stays OFF Keeps flashing 1 time flash Yellow LED 1 time flash or 5 times flash Content Current cut (2/2) 5. Troubleshooting All models Diagnosis Countermeasure Continue from previous page Is the checked result of power transistor module OK? 2. Error detection method In order to prevent from overcurrent of inverter, if the current exceeds the VSHFL¿FDWLRQVLWPDNHVWKH compressor stopping. NO Defective inverter PCBª Replace. YES • Is the space for installation of indoor and/or outdoor unit enough? • Is there any short circuit of air on indoor and/or outdoor unit? • At cooling, does the outdoor fan motor run? Are the service valves fully opened? Is the filter clogged? • At heating, does the indoor fan motor run? Are the service valves fully opened? Is the filter clogged? • Is there any liquid flooding? Is the superheat within normal range? Is the low pressure sensor and suction pipe temperature thermistor normal? • Is there any anoumalous sound on the compressor? YES 3. Condition of Error displayed • If the output current of inveter H[FHHGVWKHVSHFL¿FDWLRQV it makes the compressor stopping. • After 3-minute delay, the compressor restarts, but if this amonaly occurs 4 times within 30 minute after the intial detection. After resetting power for several times does it become normal? NO YES Temporary noise may cause of anomaly. If noise source can be found, take countermeasure. 4. Presumable cause • Defective outdoor control PCB • Defective inverter PCB • Faulty power supply • Insufficient refrigerant amount • Faulty compressor • Faulty power transistor module Note: – 90 – Defective inverter PCBª Replace. '10 • PAC-SM-137 Error code Remote controller: E45 LED Green Red Content Inverter communication error Indoor Keeps flashing Stays OFF Outdoor Keeps flashing 1 time flash 1.Applicable model 5. Troubleshooting All models Diagnosis Is the connector connection between the outdoor control PCB and the inverter PCB OK? Countermeasure NO Correct connector. NO Change to OFF. YES 2. Error detection method Are JSW10, 11 on the inverter PCB all OFF? YES Is LED on the inverter PCB flashing? NO Check why power is not supplied to inverter PCB. • Defective fan motor YES 3. Condition of Error displayed When communication is not established between the inverter PCB and the outdoor control PCB. Is the communication wire between the control PCB and the inverter PCB connected properly? NO Connect communication wire securely. NO Defective inverter PCBª Replace. YES OK YES Replace the outdoor control PCB. 4. Presumable cause Is normal state restored? • Defective inverter PCB • Defective connector between the outdoor control PCB and inverter PCB • Defective outdoor control PCB Note: – 91 – '10 • PAC-SM-137 Error code LED Indoor Remote controller: E47 Outdoor control PCB Outdoor Inverter PCB 1.Applicable model Green Keeps flashing Red Stays off Keeps flashing 1 time flash Content Inverter PCB A/F module anomaly Yellow LED 7 times flashing (Model FDC71VNX) 5. Troubleshooting Model FDC71 Diagnosis Is the Power supply voltage OK? Countermeasure NO Check power supply. YES 2. Error detection method In order to prevent from overcurrent of A/F, if the current H[FHHGVWKHVSHFL¿FDWLRQVLW makes the compressor stopping. Is the checked results of insulation resistance and NO coil resistance (1) of compressor motor OK? (1) 1.154 or more at 20°C (FDC71) Replace compressor. YES Defective outdoor Inverter PCBªReplace. 3. Condition of error displayed • If the output current of A/F H[FHHGVWKHVSHFL¿FDWLRQV it makes the compressor stopping. 4. Presumable cause • Defective inverter PCB Note: – 92 – '10 • PAC-SM-137 Error code Remote controller: E48 LED Green Red Content Outdoor fan motor anomaly Indoor Keeps flashing Stays OFF Outdoor Keeps flashing 1 time flash 1.Applicable model 5. Troubleshooting All models Diagnosis Countermeasure Does any foreign material intervene in rotational area of fan propeller? Remove foreign material. YES NO 2. Error detection method Does the fan rotate smoothly when turned by hand? Replace fan motor. If resistance between (Vm):red -(GND):blue is detected 1k: or lower, it is faulty. NO Detected by rotation speed of outdoor fan motor YES Is DC280V detected between (CNFAN (red)- (blue)) of fan motor connector? NO (1) Is F2 fuse blown? NO YES 3. Condition of Error displayed When actual rotation speed of outdoor fan motor (FMo1) drops to 100min-1 or lower for 30 minutes continuously, the compressor and the outdoor fan motor stop. After 3-minutes delay, it starts again automatically, but if this anomaly occurs 5 times within 60 minutes after the initial detection. YES Power supply reset Note (1) Fuse of model 71 is F3. NO Is normal state restored? YES Check power supply voltage. Replace faulty fan motor and control PCB. Replace fan motor (If anomaly persists after replacing fan motor, replace control PCB.) Malfunction by temporary noise 4. Presumable cause • Defective outdoor control PCB • Foreign material at rotational area of fan propeller • Defective fan motor • Dust on outdoor control PCB • Blow fuse • External noise, surge Note: When E48 error occurs, in almost cases F2 fuse (4A) [Model 71:F3 fuse (2A)]on the outdoor control PCB is blown. There are a lot of cases that fuse is blown and E48 occurs due to defective fan motor. And even though only the outdoor control PCB ( or fuse) is replaced,, another trouble (*1) could occur. Therefore when fuse is blown, check whether the fan motor is OK or not. $IWHUFRQ¿UPLQJWKHIDQPRWRUQRUPDOFKHFNE\SRZHU21'RQ WSRZHU21ZLWKRXWFRQ¿UPLQJWKHIDQPRWRUQRUPDO *1 The error which does not seem to relate E48 may occur like as “ WAIT ”, Stay OFF of LED on outdoor control PCB, inverter communication error (E45) and etc. – 93 – '10 • PAC-SM-137 Error code Remote controller: E49 LED Green Red Content Low pressure error or low pressure sensor anomaly (1/2) Indoor Keeps flashing Stays OFF Outdoor Keeps flashing 1 time flash 1.Applicable model 5. Troubleshooting All models Diagnosis Countermeasure Is the low pressure sensor connection OK (at PCB side)? 2. Error detection method Correct. NO YES Detected by low pressure drop and suction superheat Check the low pressure value during following state from the remote controller Compressor is stopping Compressor is operating 3. Condition of Error displayed When the low pressure sensor detects 0.079MPa or lower for 15 seconds continuously, compressor stops and it restarts automatically after 3-minutes delay. And if this anomaly occurs 3 times within 60 minutes, 10 minutes after the compressor starts, if the low pressure sensor detects 0.15MPa or lower for 60 minutes continuously and compressor suction superheat is detected 30degC or higher for 60 minutes continuously. And if this anomaly occurs 3 times within 60 minutes, If low pressure sensor detects 0.079MPa or lower for 5 minutes continuously (including the compressor stop status), NO During both and state low pressure detected at around 0MPa without any fluctuation. YES Check the insulation resistance of pressure sensor. Is the insulation resistance more than 100? at DC500V? YES * After connecting the gauge manifold on the low pressure line, measure at the state above. Compare the result with the value indicated on the remote controller. Is the pressure difference less than 0.2MPa? YES 4. Presumable cause • Defective outdoor control PCB • Defective low pressure sensor connector • Defective low pressure sensor • Defective suction pipe temperature thermistor connector • Defective suction pipe temperature thermistor Replace low pressure sensor. NO To checking of refrigerant amount, refrigerant circuit, etc. (next page) NO Connect the pressure sensor of spare part to outdoor control PCB in the condition open to atmosphere. Is the pressure 0MPa displayed on the remote controller? YES NO Defective outdoor control PCBªReplace. Replace low pressure sensor. Note: * Connect the gauge manifold to the service valve check joint during cooling, or connect it to the check joint at internal piping of outdoor unit during heating. – 94 – '10 • PAC-SM-137 Error code Remote controller: E49 LED Green Red Content Low pressure error or low pressure sensor anomaly (2/2) Indoor Keeps flashing Stays OFF Outdoor Keeps flashing 1 time flash 1.Applicable model All models 5. Troubleshooting Diagnosis Countermeasure Continued from previous page. 2. Error detection method Is the service valve fully opened? NO Open fully. NO Correct. YES 3. Condition of Error displayed Are the connections of low pressure sensor and suction pipe temprerature thermister connector OK? YES Are the characteristics of low pressure sensor, suction pipe temperature thermistor OK? NO Defective low pressure sensor, suction pipe temperature thermistorª Replace. YES Is the low pressure normal during operation? NO YES 4. Presumable cause Note: – 95 – Charge refrigerant. Defective outdoor control PCBªReplace. (Defective low pressure sensor, suction pipe temperature thermistor circuits) '10 • PAC-SM-137 Error code LED Green Indoor control PCB Keeps flashing Red Stays OFF Remote controller: E51 Outdoor control PCB Keeps flashing 1 time flash Outdoor Yellow LED inverter 2 times flash or 6 times flash PCB 1.Applicable model All models Content Inverter and fan motor anomaly 5. Troubleshooting Diagnosis Countermeasure Is DC15V detected between the connector YES CNI4 - (CNI2 -) on the inverter PCB? Value in ( ) are for the 3-phase models. Defective inverter PCBª Replace. NO 2. Error detection method When power transistor anomaly is detected for 15 minutes continuously Is DC15V detected between the hanesses at the control PCB side after disconnecting the connector (CNI4 or 2)? YES Broken harness wire YES Replace fan motor. NO Is DC15V detected on the fan motor connector? NO Defective outdoor control PCBªReplace. 3. Condition of Error displayed Same as above 4. Presumable cause • Defective outdoor fan motor • Defective inverter PCB • Defective outdoor control PCB Note: – 96 – '10 • PAC-SM-137 Error code Remote controller: E53 LED Green Red Content Suction pipe temperature thermistor anomaly Indoor Keeps flashing Stays OFF Outdoor Keeps flashing 1 time flash 1.Applicable model 5. Troubleshooting All models 2. Error detection method When the suction pipe temperature thermistor detects anomalously low temperature Diagnosis Countermeasure Is the connection of suction pipe temperature thermistor connector OK? NO Correct connection of suction pipe temperature thermistor connector. YES Are the characteristics of suction pipe temperature thermistor OK? NO Defective outdoor control PCBªReplace. (Defective suction pipe temperature thermistor input circuit) YES 3. Condition of Error displayed 4. Presumable cause • Defective suction pipe temperature thermistor connection • Defective suction pipe temperature thermistor • Defective outdoor control PCB Temperature-resistance characteristics (Broken wire) Temperature thermistor resistance (k) If the temperature thermistor detects -50°C or lower for 5 seconds continuously within 10 minutes to 10 minutes 20 seconds after compressor ON, the compressor stops. When the compressor is restarted automatically after 3-minutes delay, if this anomaly ocuurs 3 times within 40 minute. (Shot circuit) 15 10 5k at 25°C 5 0 10 20 30 Temperature (°C) Note: – 97 – 40 Defective suction pipe temperature thermistorª Replace. 50 '10 • PAC-SM-137 Error code Remote controller: E54 LED Green Red Content Low pressure sensor anomaly Indoor Keeps flashing Stays OFF Outdoor Keeps flashing 1 time flash 1.Applicable model All models 5. Troubleshooting Diagnosis Are the connection of low pressure sensor connectors (at sensor side and PCB side) OK? Countermeasure NO Correct low pressure sensor connector connection. YES 2. Error detection method When anomalous voltage (pressure) is detected Are the pressure (actual measurement) matched with the value indicated on the remote controller? YES Is refrigerant amount charged properly? Is there any anomaly on the refrigeration circuit? NO Replace the low pressure sensor. 3. Condition of Error displayed Is normal condition restored? If the pressure sensor detects 0V or lower and 3.49V or higher for 5 seconds continuously within 2 minutes to 2 minutes 20 seconds after compressor ON, the compressor stops. When the compressor is restarted automatically after 3-minuts delay, if this anomaly occurs 3 times within 40 minutes NO YES 4. Presumable cause • Defective low pressure sensor connection • Defective low pressure sensor • Defective outdoor control PCB • Improper amount of refrigerant • Anomalous refrigeration circuit Note: – 98 – Defective outdoor control PCBªReplace. (Defective low pressure sensor input circuit) OK '10 • PAC-SM-137 Error code Remote controller: E57 LED Green Red Content ,QVXI¿FLHQWUHIULJHUDQWDPRXQW or detection of service valve closure Indoor Keeps flashing Stays OFF Outdoor Keeps flashing 1 time flash 1.Applicable model 5. Troubleshooting All models Diagnosis Countermeasure Is the service valve fully opened? NO Open fully. NO Correct indoor heat exchanger, return air temperature thermistor connector connections. NO Defective indoor heat exchanger, return air temperature thermistor ª Replace. NO Charge refrigerant. YES 2. Error detection method • Judge insufficient refrigerant amount by detecting the temperature differnce between indoor heat exchanger (ThI-R) and indoor return air (ThI-A). • It detects at initial startup in cooling or dehumidifying mode after power ON. (In case of model 71 it cannot detect) Are the connections of indoor heat exchanger and/or return air temperature thermistor connectors OK? YES Are the characteristics of indoor heat exchanger and/or return air temperature thermistor OK? YES Is the low pressure during operation normal? YES 3. Condition of Error displayed 4. Presumable cause • Defective indoor heat exchanger temperature thermistor • Defective indoor return air temperature thermistor • Defective indoor control PCB • Insufficient refregerant amount Indoor heat exchanger, return air temperature thermistor Temperature-resistance characteristics (Broken wire) Temperature thermistor resistance (k) :KHQWKHLQVXI¿FLHQWUHIULJHUDQW amount is detected 3 times within 30 minutes. (In case of Models 100 ∼ 140 it makes anomalous stop at initial detection) Defective indoor control PCBªReplace. (Defective indoor heat exchanger, return air temperature thermistor input circuits) (Shot circuit) 15 10 5k at 25°C 5 0 10 20 30 40 50 Temperature (°C) 1RWH,QVXI¿FLHQWUHIULJHUDQWDPRXQWSUHYHQWLYHFRQWUROPDNHVFRPSUHVVRUVWRSSHGLILWMXGJHVLQVXI¿FLHQWUHIULJHUDQWDPRXQWE\GHWHFWLQJWKH temperature difference between indoor heat exchanger (ThI-R) and return air temperature (ThI-A) for 1 minute after compressor ON in cooling or dehumidifying mode and for 9 minutes after compressor ON in heating mode. [ in cooling mode: (ThI-A)-(ThI-R)>4degC, in heating mode: (ThI-R)-(ThI-A)<4degC] – 99 – '10 • PAC-SM-137 LED Indoor control PCB Green Keeps flashing Red Stays OFF Remote controller: E59 Outdoor control PCB Outdoor inverter PCB Keeps flashing 1 time flash Error code 1.Applicable model Content Compressor startup failure Yellow LED Stays off or 4 times flash 5. Troubleshooting All models Diagnosis Compressor does not start at all. Neither noise nor vibration cannot be heard Does compressor startup? Countermeasure Disconnect the outdoor fan motor connector and try to startup YES Replace outdoor fan motor NO 2. Error detection method If it fails to change over to the rotor detection operation of compressor motor (If the compressor speed cannot increase 11Hz or higher) Is power supply voltage OK? NO Check power supply voltage NO Check refrigerant amount and refrigerant circuit NO Repalce compressor YES Is the pressure balance at starting OK? YES Is the insulation resistance and coil resistance of compressor OK ? YES 3. Condition of Error displayed If compressor fails to startup for 20 times (10 patterns x 2 times). (It is availabel to reset by remote controller after 3 minutes delay) Is power transistor module OK? • Faulty outdoor fan motor • Faulty inverter PCB • Anomalous power supply voltage • Improper refrigerant amount and refrigerant circuit • Faulty compressor (Motor bearing) Defective inverter PCBª Replace. YES Is the output of inverter checker OK ? YES 4. Presumable cause NO (Inverter PCB is defective) Try to startup several times Does it start? NO Defective inverter PCBª Replace. Note: Several times restarting may resolve it, because migrated liquid refrigerant in the compresser is discharged from the compressor. NO Repalce compressor Note: Insulation resistance • The unit is left for long period without power supply or soon after installation, migrated liquid refrigerant may dissolve in the refrigerant oil in the compressor. In such case insulation resistance decreases upto several M: or lower. If the electric leakage breaker is activated due to low insulation resistance, check followings. Check whehter the insulation resistance can recover or not, ater 6 hours has passed since power ON. (By energize the crankcase heater, migrated liquid refrigerant in the refrigerant oil in compressor can be evaporated) &KHFNZKHWKHUWKHHOHFWULFOHDNDJHEUHDNHFRQIRUPVWRKLJKKHUPRQLFVSHFL¿FDWLRQV (As units has inverter, in order to prevent from improper operation, be sure to use high-hermonic one.) – 100 – – 101 – TB1 1 2 3 Y/GN WH CNW0 1 3 Y 2 Y 1 t° 1 4 6 7 6 4 3 6 4 3 FMI M RD BL BR OR WH 5 RD BL BR OR WH 5 RD BL BR OR WH 5 Power circuit Power PCB F202 (1.0A) X4 WH BR M DM 1∼ BL CNR2 WH CNR F203 (0.16A) 1 F201(3.15A) BL F200(3.15A) 3 5 ThC X Y 2 2 WH CNM4 RD RD BL CNW1 CNM3 WH CNM BK WH CNW2 X Y TB2 M LM4 M LM3 M LM2 M LM1 5 4 1 2 3 2 3 4 5 1 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 WH CNJ2 BK BK BK BK BK BK BK BK BK BK BK BK BK BK BK BK BK BK BK BK Indication lamp(Red-Inspection) Louver motor Remote controller communication address Plural units Master/Slave setting Model capacity setting Operation check,Drain motor test run Remote controller Y/GN WH 7 RD Y/GN Y/GN Y/GN Y/GN SW5 SW6 SW7-1 LED・3 LM1∼4 SW2 Notes 1. indicates wiring on site. 2. TB1 is the terminal block for heavy current(connecting line between indoor unit and outdoor unit), and TB2 is the terminal block for weak current(remote controller). 3. See the wiring diagram of outside unit about the line between inside unit and outside unit. 4. Use twin core cable(0.3mm 2 X2)at remote controller line. See spec sheet of remote controller in case that the total length is more than 100m. 5. Do not put remote controller line alongside power source line. Power source line 1 2 3 Signal line Earth ] Connector Drain motor Fuse Fan motor Float switch Indication lamp (Green-Normal operation) Connecting line between indoor unit and outdoor unit [ CNB∼Z DM F200∼203 FM I FS LED・2 BL BL BL BL BL RD RD RD RD RD BK BK BK BK BK BK BK BK BK BK BK BK BK BK BK BK BK BK BK BK CNJ BL CNW4 RD CNW3 WH CNB 1 2 3 4 5 6 7 8 9 10 11 WH 12 13 14 15 16 17 18 19 20 1 3 4 5 2 2 3 4 5 1 3 1 LED・2 SW7 SW6 SW5 SW2 LED・3 1 3 6 5 4 +12 1 2 3 BL 4 5 6 CNT Y CNN 2 1 BK 2 CNH 1 BL 2 CNI XR1 9 8 7 6 5 4 3 BK BK Y Y RD RD BL BL WH WH XR4 1 6 5 4 3 2 1 2 1 2 BK CNN2 BK BK BK BK BK BK WH CNH2 BK BK WH CNI2 RD RD (Operation) (Heating) (Compressor ON) (Inspection) WH CNC XR2 10 Option XR3 1 2 t° t° t° t° FS ThI-R3 ThI-R2 ThI-R1 ThI-A XR5(Remote operation input:volt-free contact) BK BK Y Y RD RD BL BL WH WH Terminal block(Power source) (□ mark) Terminal block(Signal line) (□mark) Thermistor(Remote controller) Thermistor(Return air) Thermistor(Heat exchanger) Relay for DM Closed-end connector Control PCB TB2 Thc ThI-A ThI-R1,2,3 X4 ■ mark TB1 Color Marks Mark Color BK Black BL Blue BR Brown OR Orange RD Red WH White Y Yellow Y/GN Yellow/Green '10 • PAC-SM-137 3. ELECTRICAL WIRING (1) Indoor units (a) Ceiling cassette-4 way compact type (FDTC) Models FDTC40VD, 50VD, 60VD PJA003Z340 B – 102 – 1 2 3 TB1 1 2 3 WH CNW0 DM WH CNR 1 1㨪 M 3 F201㧔3.15A㧕 F200㧔3.15A㧕 F203 㧔0.16A㧕 1 3 BL 5 RD WH Y㧛GN FMI M 7 6 5 1 4 F202 㧔1.0A㧕 X4 er Pow circuit Notes 1. indicates wiring on site. ޓޓ2. See the wiring diagram of outside unit about the line between inside unit and outside unit. ޓޓ3. Use twin core cable㧔0.3mm2 X2㧕at remote controller line. See spec ޓޓsheet of remote controller in case that the total length is more than 100m. ޓޓ4. Do not put remote controller line alongside power source line. Power source line Signal line Earth Y㧛GN Y㧛GN 7 RD Y㧛GN Y Power PCB BL Y㧛GN BR Connecting line between indoor unit and outdoor unit Y WH CNM Remote controller Th 㧯 X Y t˚ OR Y㧛GN WH M LM4 M LM3 M LM2 M LM1 BL 2 3 4 5 CNW1 1 1 CNW2 2 RD 3 4 5 TB2 X Y BK BK BK BK BK BK BK BK BK BK RD RD RD RD RD RD RD RD RD RD WH CNJ2 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 BK WH 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 BL BL BL BL BL RD RD RD RD RD BK BK BK BK BK BK BK BK BK BK BK BK BK BK BK BK BK BK BK BK WH CNB 1 2 3 4 5 6 7 8 9 CNJ 10 WH 11 12 13 14 15 16 17 18 19 20 2 1 CNW4 3 BL 4 5 1 2 CNW3 RD 3 4 5 3 1 LED3 SW7 SW6 SW5 SW2 LED2 Control PCB 2 1 2 1 6 5 4 3 2 RD CNV 4 3 1 2 +12 1 2 CNT 3 BL 4 5 6 BL CNI BK CNH Y CNN 1 XR3 XR1 XR4 BK BK PS Mark BK BL BR R O SW5 SW6 SW7-1 TB1 TB2 Th 㧯 ThI -A ThI -R1,2,3 X4 عmark SW2 olo r C Black Blue Brown O range olor Mark s C 㧔Inspection㧕 XR2 FS Thl -A ThI -R3 ThI -R2 ThI -R1 㧔Operation㧕 㧔Heating㧕 㧔Compressor ON㧕 Option t˚ t˚ t˚ t˚ XR5㧔Remote operation input: volt-free contact㧕 RD RD BK BK BK BK BK BK BK BK CNB ޓZ DM F200ޓ203 FMI FS LED2 LED3 LM1ޓ4 PS olor C Red White Yello w Yellow㧛Green Mark RD WH Y Y㧛GN Closed-end connector Relay for DM ThermistorާReturn air㧕 ThermistorާHeat exchanger㧕 ThermistorާRemote controller㧕 Terminal blockާPower source㧕㧔غmark㧕 Terminal blockާSignal line㧕㧔غmark㧕 Model capacity setting Operation check, Drain motor test run Plural units Master㧛Slave setting Remote controller communication address Louver motor Panel switch Connector Drain motor Fuse Fan motor Float switch Indication lamp㧔Green-Normal operation㧕 Indication lamp㧔Red-Inspection㧕 '10 • PAC-SM-137 (b) Ceiling cassette-4 way type (FDT) Models FDT40VD, 50VD, 60VD, 71VD, 100VD, 125VD, 140VD PJF000Z190 – 103 – 3 1 2 3 Y㧛GN WH RD 1 CNF1 WH CNFI 1 WH C 1 M 1 X6 5 CF I 1 CNM3 WH FMI 1 CNW0 RD F㧔3.15A㧕 BL F㧔3.15A㧕 WH 3 Y㧛GN L M H UH 9 5 7 X3 3 X1 X2 BL P BR OR RD CNJ WH 1 2 3 4 5 C BK 1 3 7-segment display Switches for setting Back-up switch㧔Operation㧛Stop㧕 LED4 SW4 Remote controller Receiver PCB SW4 LED3 AMP LED2 SW1 CNB2 WH SW2 t 5 SW7 SW6 LED4 SW1 6 BK SW5 ThR-I 3 BK Wireless specification CNB X Y TB2 4 CNN Y 3 2 LED3 CNB WH LED2 1 Th-RI 2 Indication lamp 㧔Yellow-Timer㧛Inspection㧕 24V t LED3 CNW2 BK RD RD BR BR Indication lamp 㧔Green-Normal operation㧕 CNI BL 19V ThR-I 1 BK LED2 Receiver PCB CNR WH 1 3 X4 CNW1 WH 220㨺240V BK WH M t BK LM Notes 1. indicates wiring on site. ޓޓ2. See the wiring diagram of outside unit about the line between indoor unit and outdoor unit. ޓޓ3. Use twin core cable㧔0.3mm2 X2㧕at remote controller line. See spec ޓޓsheet of remote controller in case that the total length is more than 100m. ޓޓ4. Do not put remote controller line alongside power source line. Earth Signal line Power source line 1 2 BR 5 BK RD BL TB1 RD BK BK Connecting line between indoor unit and outdoor unit OR WH OR WH BK Trl Th-AI BK 2 1 2 XR3 XR1 XR4 XR2 Option X Y X Y t Thc Remote controller Wired specification ATTENTION Ԙ ޓInsulate with tape the removed line. ԙ The LED of that removed connector will not be able to make any indication. X4 Mark BK BL BR OR P Relay for DM Relay for FM Transfor m e r Mark RD WH Y Y㧛GN Color Red White Yellow Yellow㧛Green ThermistorާHeat exchanger㧕 ThermistorާReturn air㧕 ThermistorާRemote controller㧕 Terminal blockާSignal line㧕㧔غmark㧕 Terminal blockާPower source㧕㧔غmark㧕 Operation check, Drain motor test run Model capacity setting Plural units Master㧛Slave setting Remote controller communication address Louver motor Indication lamp㧔Red-Inspection㧕 Color Black Blue Brown Orange Pink Color Marks X1 ޓ3,6 Trl Thl -R1,2,3 Thl -A Thc TB2 TB1 SW7-1 SW6 SW5 㧔Heating㧕 㧔Compressor ON㧕 LM 㧔Inspection㧕 SW2 Indication lamp㧔Green-Normal operation㧕 Fan motor㧔with thermostat㧕 FMI 1 LED2 Connector Fuse CNB ޓZ I F Capciator for FM CFI 1 㧔Operation㧕 LED3 XR5㧔Remote operation input : volt-free contact㧕 TB2 6 5 CNT 3 BL 4 +12 Control PCB CNH BK 1 BK ̪When wired remote controller are used only㧔wireless type㧕 It is necessary to remove the line that is connected to the receiver. Remove signal line connected to the receiver from primary side of terminal block㧔X,Y㧕. t '10 • PAC-SM-137 (c) Ceiling suspended type (FDEN) Models FDEN40VD, 50VD PFA003Z819 A 3 Signal line – 104 – Y㧛GN WH CNF1 WH CNFI 1 WH C 1 M 1 X6 5 5 CF I 1 CNM3 WH FMI 1 CNW0 RD F㧔3.15A㧕 BL 1 F㧔3.15A㧕 WH 3 RD 5 5 Y㧛GN FMI 2 L M H UH 9 5 7 X3 3 X1 X2 C CFI 2 1 M 5 CNFI 2 WH Y㧛GN CNF2 WH CNJ WH 1 2 3 4 5 BK CNI BL 19V RD RD BR BR 1 3 ThI-R3 5 SW1 7-segment display Switches for setting Back-up switch㧔Operation㧛Stop㧕 LED4 SW1 SW4 Remote controller 6 BK SW7 SW6 SW5 LED4 Receiver PCB SW4 LED3 AMP LED2 Indication lamp㧔Yellow-Timer㧛Inspection㧕 CNB2 WH SW2 t Wireless specification CNB X Y TB2 4 CNN Y 3 2 LED3 CNB WH LED2 1 ThI-R2 LED3 24V t BK Indication lamp㧔Green-Normal operation㧕 CNW2 BK ThI-R1 BK LED2 Receiver PCB CNR WH 1 3 X4 CNW1 WH 220㨺240V BK WH M t BK LM Notes 1. indicates wiring on site. ޓޓ2. See the wiring diagram of outside unit about the line between indoor unit and outdoor unit. ޓޓ3. Use twin core cable㧔0.3mm2 X2㧕at remote controller line. See spec ޓޓsheet of remote controller in case that the total length is more than 100m. ޓޓ4. Do not put remote controller line alongside power source line. Earth 1 2 RD BR Power source line 1 2 3 BK TB1 BL Connecting line between indoor unit and outdoor unit OR WH OR RD OR BK BK BL P BR OR RD OR WH BK Trl ThI-A BK 2 6 5 CNT 3 BL 4 2 +12 1 Control PCB CNH BK 1 BK XR4 X Y TB2 X Y t Thc Remote controller Wired specification ATTENTION ޓInsulate with tape the removed line. Ԙ ԙ The LED of that removed connector will not be able to make any indication. عmark # Mark BK BL BR OR P Mark RD WH Y Y㧛GN Closed-end connector )/%;*24 )/%;*24 4%15*240)4 ThermistorާHeat exchanger㧕 ThermistorާReturn air㧕 Color Red White Yellow Yellow㧛Green ThermistorާRemote controller㧕 Terminal blockާSignal line㧕㧔غmark㧕 Terminal blockާPower source㧕㧔غmark㧕 3)4%6-21',)'.4%-1026246)56471 Model capacity setting Plural units Master㧛Slave setting )026)'21642//)4'20071-'%6-21%((4)55 Louver motor Color Black Blue Brown Orange Pink Color Marks # ޓ 4/ ,/ ,/ ,' " SW6 " " 1(-'%6-21/%03㧔4))1240%/23)4%6-21㧕 1(-'%6-21/%03㧔)(153)'6-21㧕 75) %102624㧔9-6,6,)40256%6㧕 / 211)'624 ޓ$ %3%'-624*24 㧔Operation㧕 㧔Heating㧕 㧔Compressor ON㧕 LM 㧔Inspection㧕 XR5㧔Remote operation input : volt-free contact㧕 XR3 XR2 Option XR1 ̪When wired remote controller are used only㧔wireless type㧕 It is necessary to remove the line that is connected to the receiver. Remove signal line connected to the receiver from primary side of terminal block㧔X,Y㧕. t '10 • PAC-SM-137 Models FDEN60VD, 71VD, 100VD, 125VD, 140VD PFA003Z820 B – 105 – 3 1 2 3 Y䋯GN WH F䋨3.15A䋩 F䋨3.15A䋩 5 BL 1 WH 3 RD WH FMI1 WH M 1䌾 Y䋯GN H 5 L M 5 9 Y 5 4 CNN UH 7 X3 3 3 X1 X2 2 C 1 X6 CFI1 CNM3 CNF3 RD CNW0 1 Notes 1. indicates wiring on site. 䇭䇭 2. See the wiring diagram of outside unit about the line between inside unit and outside unit. 䇭䇭 3. Use twin core cable䋨0.3mm 2 X2䋩at remote controller line. See spec 䇭䇭 sheet of remote controller in case that the total length is more than 100m. 䇭䇭 4. Do not put remote controller line alongside power source line. Earth Signal line Power source line 1 2 RD Control PCB WH t㫦 BK ThI-R3 GR t㫦 BR TB1 BK BK Connecting line between indoor unit and outdoor unit BK BL GR WH DM BL 1 ThI-A BK CNH 1䌾 M 1 3 X4 CNR CNR2 F䋨0.16A䋩 6 t㫦 BK t㫦 BK RD 2 BK BR Y ThI-R2 FS BL CNI CNW1 WH 220䍎240V RD ThI-R1 WH WH Y 19V TrI t㫦 TB2 Remote controller Thc X Y X Y 3 WH CNB SW2 1 SW7 SW6 SW5 BK CNW2 24V WH BK RD RD RD BR BR BK Color Marks Mark Color BK Black BL Blue BR Brown Gray GR RD Red WH White Y Yellow Y䋯GN Yellow䋯Green LED䊶3 LED䊶2 BL 6 5 4 CNT 3 2 +12 1 XR4 XR2 SW5 SW6 Transformer Relay for FM Trl X1䌾3,6 Relay for DM Thermistor䋨Heat exchanger䋩 Thl -R1,2,3 X4 Thermistor䋨Return air䋩 Thermistor䋨Remote controller䋩 Terminal block䋨Signal line䋩䋨䂔mark䋩 Terminal block䋨Power source䋩䋨䂔mark䋩 Thl -A Thc TB2 Plural units Master䋯Slave setting Model capacity setting SW2 Operation check, Drain motor test run Indication lamp䋨Red-Inspection䋩 Remote controller communication address LED䊶3 䋨Operation䋩 SW7-1 䋨Heating䋩 䋨Compressor ON䋩 TB1 䋨Inspection䋩 XR5䋨Remote operation : volt-free contact䋩 XR3 XR1 Option FMI1 Indication lamp䋨Green-Normal operation䋩 Fuse Fan motor䋨with thermostat䋩 F Float switch Drain motor DM FS Connector CNB䌾Z LED䊶2 Capacitor for FMI CFI1 '10 • PAC-SM-137 (d) Duct connected-Low/Middle static pressure type (FDUM) Models FDUM50VD, 60VD, 71VD PJR002Z244 B BK – 106 – Earth 3 Y㧛GN F㧔3.15A㧕 F㧔3.15A㧕 BL 1 WH 3 RD 5 FM I 1 CF I 1 1 M FMI 2 M 5 CFI 2 1 Y㧛GN WH Y㧛GN CNF4 5 WH 5 WH 5 L H UH 9 M 5 3 7 X3 C X1 X2 CNM3 1 X6 Y CNF3 RD CNW0 Notes 1. indicates wiring on site. ޓޓ2. See the wiring diagram of outside unit about the line between inside unit and outside unit. ޓޓ3. Use twin core cable㧔0.3mm2 X2㧕at remote controller line. See spec ޓޓsheet of remote controller in case that the total length is more than 100m. ޓޓ4. Do not put remote controller line alongside power source line. Signal line WH RD 5 BK 4 t° GR CNN WH Power source line 1 2 1 2 3 3 2 BR TB1 BK BK 1 t° BK BL Connecting line between indoor unit and outdoor unit Control PCB t° BK RD GR X4 BK CNH DM BL CNR2 1㨪 M CNR 1 3 WH 1 BK F㧔0.16A㧕 6 t° Th I -A 2 BK BR Y ThI -R3 FS CNI BL WH CNW1 220㨺240V RD ThI -R2 19V Tr I BK ThI -R1 WH WH Y t° Remote controller Thc X Y X Y 3 1 TB2 SW2 CNB WH SW7 SW6 SW5 BK CNW2 24V WH BK RD RD RD BR BR BK Color Marks Mark Color Black BK Blue BL Brown BR Gray GR RD Red WH White Y Yellow Y㧛GN Yellow㧛Green LED 3 LED2 6 XR4 XR2 XR5㧔Remote operation : volt-free contact㧕 XR3 CNT 3 BL 4 5 XR1 2 +1 2 1 Option 㧔Operation㧕 㧔Heating㧕 㧔Compressor ON㧕 㧔Inspection㧕 Remote controller communication address Plural units Master㧛Slave setting LED3 SW2 SW5 Operation check, Drain motor test run عmark Closed-end connector Relay for DM Relay for FM X4 Transform e X1ޓ3,6 r ThermistorާHeat exchanger㧕 ThermistorާReturn air㧕 ThermistorާRemote controller㧕 Terminal blockާSignal line㧕㧔غmark㧕 Terminal blockާPower source㧕㧔غmark㧕 Trl Thl -R1,2,3 Thl -A Thc TB2 TB1 SW7-1 SW6 Indication lamp㧔Red-Inspection㧕 LED2 Model capacity setting Float switch Indication lamp㧔Green-Normal operation㧕 FS Fuse Fan motor㧔with thermostat㧕 Drain motor DM I FMl 1, 2 Conector CNBޓZ F CapacitororfFM CFI 1,2 '10 • PAC-SM-137 Models FDUM100VD, 125VD, 140VD PJR002Z245 B Earth 3 1 2 3 TB1 F㧔3.15A㧕 RD BL WH 1 3 5 WH CNM3 RD CNW0 H UH C Y㧛GN 5 X1 X2 BL CNI 3 1 X6 Control PCB FS CFIޓ M 1 FMI F㧔0.16A㧕 1 L 9 M 7 X3 BK 19V DM BL CNR2 WH CNR 3 BK M 1 X4 WH CNW1 220㨺240V Trl RD RD BR BR BK CNW2 t˚ 1 t˚ TB2 SW2 2 BK Remote Controller Thc X Y X Y 3 1 WH CNB LED3 LED2 24V t˚ Thl -R1 3 Thl -R2 BK SW7 SW6 6 1 2 BL 6 5 4 CNT 3 2 +12 1 BK 5 t˚ Thl -A Y BK CNH 4 GR CNN t˚ Thl -R3 GR Color Pink Red White Yellow Yellow㧛Green F㧔3.15A㧕 Y㧛GN WH RD Mark P RD WH Y Y㧛GN Notes 1. indicates wiring on site. ޓޓ2. See the wiring diagram of outside unit about the line between inside unit and outside unit. ޓޓ3. Use twin core cable㧔0.3mm2 X2㧕at remote controller line. See spec ޓޓsheet of remote controller in case that the total length is more than 100m. ޓޓ4. Do not put remote controller line alongside power source line. Signal line Power source line 1 2 Connecting line between indoor unit and outdoor unit Color Black Blue Brown Gray Orange WH BR BK Mark BK BL BR GR OR BL RD BK Y RD RD BL OR WH WH Y BR Y BK WH – 107 – BK BK Color Marks XR4 XR2 㧔Operation㧕 㧔Heating㧕 㧔Compressor ON㧕 㧔Inspection㧕 XR5㧔Remote operation input: volt-free contact㧕 XR3 XR1 Option Indication lamp㧔Red-Inspection㧕 Remote controller communication address Model capacity setting SW2 SW6 Terminal blockާSignal line㧕㧔غmark㧕 Relay for DM Closed-end connector X4 عmark Transformer Relay for FM X1ޓ3,6 ThermistorާHeat exchanger㧕 ThermistorާReturn air㧕 Trl Thl -R1,2,3 Thl -A ThermistorާRemote controller㧕 TB2 Thc Terminal blockާPower source㧕㧔غmark㧕 TB1 Operation check, Drain motor test run Indication lamp㧔Green-Normal operation㧕 LED3 SW7-1 Float switch FS LED2 Fuse Fan motor㧔with thermostat㧕 DM F Connector Drain motor CNB Z FMI Capacitor for FMI CF I '10 • PAC-SM-137 (e) Duct connected-High static pressure type (FDU) Model FDU71VD PJD001Z304 Earth 3 1 2 3 TB1 Y㧛GN BL WH RD 1 3 5 F㧔5A㧕 WH CNM3 RD CNW0 L 52FH 52FM 52FL C UH M CFI M 1 F㧔5A㧕 F㧔3.15A㧕 F㧔3.15A㧕 Y㧛GN WH RD FMI 5 H UH C X1 X2 3 1 X6 BL CNI 52FL 52FM 52FH F㧔0.16A㧕 1 L 9 BK 19V Trl DM BL CNR2 WH CNR 3 BK M 1 X4 WH CNW1 220㨺240V M 7 X3 Notes1. ޓindicates wiring on site. ޓޓ2. See the wiring diagram of outside unit about the line between inside unit and outside unit. ޓޓ3. Use twin core cable㧔0.3mm2 X2㧕at remote controller line. See spec ޓޓsheet of remote controller in case that the total length is more than 100m. ޓޓ4. Do not put remote controller line alongside power source line. Signal line Power source line 1 2 Connecting line between indoor unit and outdoor unit Control PCB FS RD RD BR BR BK CNW2 t˚ 1 t˚ TB2 SW2 2 BK Remote Controller Thc X Y X Y 3 1 WH CNB LED3 LED2 24V t˚ Thl -R1 3 Thl -R2 BK SW7 SW6 1 2 2 1 BL 6 5 4 CNT 3 +12 BK 6 t˚ Thl -A CNH BK Y 5 GR CNN 4 t˚ Thl -R3 GR Color Pink Red White Yellow Yellow㧛Green WH Mark P RD WH Y Y㧛GN RD RD RD WH Color Black Blue Brown Gray Orange P RD BK BK Mark BK BL BR GR OR Y WH WH BK BK OR BL WH BR WH P BL BL RD WH P RD RD WH WH Y BR Y BK WH – 108 – BK BK Color Marks XR4 XR2 㧔Operation㧕 㧔Heating㧕 㧔Compressor ON㧕 㧔Inspection㧕 XR5㧔Remote operation input: volt-free contact㧕 XR3 XR1 Option Remote controller communication address Model capacity setting LED3 SW2 SW6 Electromagnetic contactor for FMI 52FL,FM,FH Relay for DM Closed-end connector X4 عmark Transformer Relay for FM X1ޓ3,6 ThermistorާHeat exchanger㧕 ThermistorާReturn air㧕 ThermistorާRemote controller㧕 Terminal blockާSignal line㧕㧔غmark㧕 Trl Thl -R1,2,3 Thl -A Thc TB2 TB1 Terminal blockާPower source㧕㧔غmark㧕 Operation check, Drain motor test run Indication lamp㧔Red-Inspection㧕 LED2 SW7-1 Float switch Indication lamp㧔Green-Normal operation㧕 FS Fuse Fan motor㧔with thermostat㧕 Drain motor DM FMI Connector CNBޓZ F Capacitor for FMI CF I '10 • PAC-SM-137 Models FDU100VD, 125VD, 140VD PJD001Z217 B t t Th2 1 Th2 2 – 109 – HEAT EXCHANGER SC-BIKN-E INTERFACE KIT Th3 t Th1 DISPLAY WIRELESS RECEIVER BACK-UP SW S䋯N J L RD BK G CNS CNF CNG CNE WH Y䋯G 5 2 12 U F 250V 3.15A Va DS PRINTED CIRCUIT BOARD HEAT EXCHANGER 1 3 CNU 4 5 6 CNY CNX2 CNX1 RD BL Y WH BK 3 2䋯N 1 5 5 5 5 5 T 5 5 5 5 5 FMI M LS IM SM2 SM1 LM2 LM1 SIGNAL WIRE POWER WIRES TO OUTDOOR UNIT Power source 1 phase 220 - 240 V 50Hz M M M M M 3 1 2/N Item CNE-CNY FMI SM1,2 LM1,2 IM Th1 Th21,2 Th3 LS DS F T Va BK BL RD WH Y Y䋯G Black Blue Red White Yellow Yellow䋯Green Color Marks Mark Color Limit switch Diode stack Fuse Terminal block Varistor Connector Fan motor Flap motor Louver motor Inlet motor Room temp. sensor Heat exch. sensor Humidity sensor Description '10 • PAC-SM-137 (f) Wall mounted type (SRK) Models SRK50ZIX-S, 60ZIX-S RWA000Z215 L1 YE C1 T26 T27 + CNI4 㧔WH㧕 CNA2 㧔WH㧕 CNA1 㧔WH㧕 CNI3 㧔WH㧕 BL CNI2 㧔WH㧕 RD BL CNI1 㧔WH㧕 BL RD BL CNG1 㧔BK㧕 BK CNG2 㧔BK㧕 T11 T10 T9 – 110 – 17 71 1 CNH 㧔PK㧕 52X4 CNS 㧔RD㧕 52X1 CNR 㧔WH㧕 OPTIONAL DH 3 CNW2 㧔OR㧕 1 CNN 㧔YE㧕 PWB1 Power cable size 㧔mm 2 㧕 3.5 3 CNW 㧔WH㧕 F3㧔4A㧕 20S 63H1 21 Power cable length 㧔m㧕 CH t° M SM2 3 2 1 TB 7 Tho-S 3 t° Tho-A 2 1 Tho-IPM t° BK CNQ2 㧔BK㧕 LPT Tho-R2 t° 6 6 ON 1 2 1 2 CNQ2 SW3 㧔BK㧕 ON CNQ1 SW5 㧔WH㧕 3 3 4 4 ON ON 1 2 2 SW7 1 SW8 3 3 SW9 Snow guard fan control Defrost control change SW5-3,4 Trial operation SW3-2 SW3-1 Color Black Blue Brown Orange Red White Yellow Yellow㧛Green Gray Pink Mark BK BL BR OR RD WH YE YE㧛GN GY PK Method of trial operation 1. Trial operation can be performed by using SW5-3. 2. Cooling trial operation will be performed when SW5-4 is OFF, and heating trial operation when SW5-4 is ON. 3. Be sure to turn OFF SW5-3 after the trial operation is finished. When this switch is turned ON, the outdoor unit fan will run for 10 seconds in every 10 minutes, when outdoor temperature falls to 3㩩C or lower and the compressor is not running when the unit is used in a very snowy country, set this switch to ON. The defrosting operation interval becomes shorter by turning ON this switch. This switch should be turned ON in the area where outside temperature becomes below the freezing point. Local setting switch SW3, SW5㧔Set up at shipment OFF㧕 BK CNQ1 㧔WH㧕 CNB 㧔RD㧕 CNFAN 㧔WH㧕 7 6 5 4 1 CNPS 㧔WH㧕 Ǿ1.6mm t° 4 M FM01 CNIP 㧔YE㧕 Ǿ1.6mm x 3 Tho-D 5 LED2 CNEEV1 㧔WH㧕 6 5 4 3 2 1 2 Earth wire size 㧔mm㧕 t° 6 LED1 CNTH 㧔WH㧕 M SM1 TO INDOOR UNIT POWER WIRES 1 SIGNAL WIRE 3 indoor-outdoor wire size x number 㧔mm㧕 Tho-R1 8 52X3 CNEEV2 㧔RD㧕 6 5 4 3 2 1 The specifications shown in the above table are for units without heaters. For units with heaters, refer to the installation instructions or the construction instructions of the indoor unit. Switchgear of Circuit breaker capacity which is calculated from MAX. over current should be chosen along the regulations in each country. The cable specifications are based on the assumption that a metal or plastic conduit is used with no more than three cables contained in a conduit and a voltage drop is 2%. For an installation falling outside of these conditions, please follow the internal cabling regulations. Adapt it to the regulation in effect in each country. Refer to installation manual or technical manual about usage of local setting switch. Don't operate SW3-3,SW5-1,SW5-2,SW7,SW8 MAX over current 㧔A㧕 Model Power cable, indoor-outdoor connecting wires CM MS 3㨪 W V U W V U CN01 㧔WH㧕 INV PWB2 T28 T29 T30 IPM RD T25 T24 T21 T22 WH T13 N㧛F PWB3 T6 CNO2?WH? T5 T4 BK BK RD RD WH BL YE㧛GN ELCB T1 F6㧔5A㧕 T8 BK T2 BK BR YE㧛GN BR MCCB BK WH RD BL BL OR GY BK GY BR BK BK WH YE OR BL BK F㧔20A㧕 BK RD RD BK RD BK WH YE OR BL BK WH BK N BK L1 BK WH RD BK TB BK WH OR BR BL RD BK POWER SOURCE 1㨪220㨺240V 50Hz㧛1㨪220V 60Hz Item Tho-IPM LPT IPM TB F,F3 CnA㨪Z SW9 SW3,5 LED1 LED2 L1 Tho-S Tho-R1,R2 Tho-D CM FM01 CH DH 52X1 52X3 52X4 20S SM1 SM2 63H1 Tho-A Description Compressor motor Fan motor Crankcase heater Drain pan heater Auxilliary relay㧔for CH㧕 Auxilliary relay㧔for 20S㧕 Auxilliary relay㧔for DH㧕 Solenoid valve for 4 way valve Expansion valve for cooling Expansion valve for heating High pressure switch Thermistor 㧔Outdoor air temp.㧕 Thermistor 㧔Discharge pipe temp.㧕 Thermistor 㧔Heat exchanger temp.㧕 Thermistor 㧔Suction pipe temp.㧕 Thermistor 㧔IPM㧕 Low pressure sensor Intelligent power module Terminal block Fuse Connector Pump down switch Local setting switch Indication lamp㧔GREEN㧕 Indication lamp㧔RED㧕 Reactor '10 • PAC-SM-137 (2) Outdoor units Model FDC71VNX PCA001Z605 a – 111 – CM L1o + - DM N1 - L1 L L2 A㧛F MODULE + N2 P CNACT1 㧔WH㧕 N2 E1 E P2 CT 2 RD INVERTER PWB2 P1 No BL GN P 5.5 Power cable size 㧔mm 2 㧕 + 29 125 Optional DH RD 30 31 24 5.5 8 Power cable length 㧔m㧕 Power cable size 㧔mm 2 㧕 23 25 CNR 㧔WH㧕 CNF 52X3 㧔BK㧕 52X2 52X1 㧔OR㧕 CNW2 TO INDOOR UNIT CNS 20S Ǿ1.6mm x 3 indoor-outdoor wire size x number Ǿ1.6mm x 3 㧔BR㧕 CNH CONTROL PWB1 WIRES [ POWER SIGNAL WIRE 㧔RD㧕 indoor-outdoor wire size x number CH BL The specifications shown in the above table are for units without heaters. For units with heaters, refer to the installation instructions or the construction instructions of the indoor unit. Switchgear of Circuit breaker capacity which is calculated from MAX. over current should be chosen along the regulations in each country. The cable specifications are based on the assumption that a metal or plastic conduit is used with no more than three cables contained in a conduit and a voltage drop is 2%. For an installation falling outside of these conditions, please follow the internal cabling regulations. Adapt it to the regulation in effect in each country. 30 25 100 140 MAX over current 㧔A㧕 Model CNA2 㧔WH㧕 CNA1 㧔WH㧕 CNW WH 㧔BK㧕 WH Power cable length 㧔m㧕 BL RD BL RD CNI3 㧔WH㧕 BL CNI4 㧔WH㧕 N2 CNI1 㧔WH㧕 BL F㧔4A㧕 CNI2 㧔WH㧕 GN ̪At the connection with the duct type indoor unit. 140 26 24 100 125 MAX over current 㧔A㧕 Model Power cable, indoor-outdoor connecting wires GN W MS 3㨪 V U RD U W V WH RD RD WH BL BK IPM BL NOISE FILTER PWB3 RD WH WH BR BL BL BR Y㧛GN Ni 1 2 3 BL WH BK 1 ] M SM1 2 t° 㧔WH㧕 CNTH LED1 㧔WH㧕 CNEEV1 4 3 2 1 THo-R1 THo-D t° 6 3 1 Ǿ1.6 Earth wire size 㧔mm㧕 Ǿ1.6 Earth wire size 㧔mm㧕 63H1 BK WH BK L1 N BK RD BK BL OR Y WH BK TB t° LED2 6 THo-S t° M SM2 THo-A ON OFF 㧔RD㧕 t° 㧔Y㧕 CNIP THo-P 㧔WH㧕 LPT SW5 1 2 3 4 CNPS ON OFF 㧔WH㧕 CNFAN1 7 6 5 4 1 1 2 3 4 SW3 M FMO1 M FMO2 THo-R2 t° CNB 㧔RD㧕 SW1 SW3-3,4 SW3-2 SW3-1 Trial operation Snow guard fan control Defrost control change Thermistor㧔Heat exchanger pipe temp. 㧕 THo-R1,2 Auxilliary relay㧔for CH㧕 High pressure switch 63H1 Method of trial operation 1 Trial operation can be performed by using SW3-3,4. 2 Compressor will be in the operation when SW3-3 is ON. 3 Cooling trial operation will be performed when SW3-4 is OFF, and heating trial operation when SW3-4 is ON. 4 Be sure to turn OFF SW3-3 after the trial operation is finished. The defrosting operation interval becomes shorter by turning ON this switch. This switch should be turned ON in the area where outside temperature becomes below the freezing point. When this switch is turned ON, the outdoor unit fan will run for 30 seconds in every 10 minutes, when outdoor temperature falls to 3͠ or lower and the compressor is not runnning when the unit is used in a very snowy country, set this switch to ON. Auxilliary relay㧔for 20S㧕 52X3 Auxilliary relay㧔for DH㧕 52X1 52X2 Solenoid valve for 4 way valve 20S Thermistor㧔Suction pipe temp.㧕 Thermistor㧔IPM㧕 THo-P THo-S Thermistor㧔Outdoor air temp.㧕 Thermistor㧔Discharge pipe temp.㧕 THo-D TB THo-A Local setting switch Terminal block SW3,5 Expansion valve for heating Pump down switch SW1 Expansion valve for cooling SM1 SM2 Low pressure sensor LPT CNFAN2 㧔WH㧕 Indication lamp㧔GREEN㧕 Reactor L Indication lamp㧔RED㧕 Yellow㧛Green LED2 Yellow Y Y㧛GN Fan motor Fuse F Intelligent power module Diode module DM IPM Current sensor CT 7 6 5 4 1 White WH Compressor motor CM FM01 Crankcase heater Drain pan heater CH Description DH Connector Item CnA㨪Z LED1 Red RD Green Gray GN GR Orange Brown BR Pink Blue BL P Black BK OR Color Local setting switch SW3㧔Set up at shipment OFF㧕 4 3 2 1 CNEEV2 Y RD RD RD RD BL OR Y WH Y F㧔8A㧕 BK L1i BK F㧔30A㧕 BK RD WH TB BK POWER SOURCE 1㨪220㨺240V 50Hz㧛1㨪220V 60Hz BK WH OR BR BL RD RD WH OR BR BL RD Mark '10 • PAC-SM-137 Models FDC100VNX, 125VNX, 140VNX PCA001Z570 A – 112 – 3 1 2 Optional RD 1 BK 2 BL 3 Y㧛GN 63H1 DH BK BK CH 15 MAX over current 㧔A㧕 18 125 20S 3.5 3.5 Power cable size 㧔mm 2 㧕 t° THo-S CNFAN2 㧔WH㧕 SM2 SM1 21 23 26 Power cable length 㧔m㧕 27 Power cable length 㧔m㧕 M M Ǿ1.6mm x 3 indoor-outdoor wire size x number Ǿ1.6mm x 3 indoor-outdoor wire size x number FMo1 M FMo2 M 18V 15V Ǿ1.6 Earth wire size 㧔mm㧕 Ǿ1.6 Earth wire size 㧔mm㧕 CNA2 㧔WH㧕 BL RD RD CNA1 㧔WH㧕 BL CNI1 BL 㧔WH㧕 CNI 3 1 4 5 6 7 SW1 CNPS 㧔WH㧕 1 4 5 6 7 CNFAN1 㧔WH㧕 SW5 1 2 3 4 CNM 㧔GR㧕 LPT 6 CNEEV2 㧔RD㧕 SW3 52C 1 2 3 4 LED2 CT 6 CNEEV1 㧔WH㧕 LED1 1 2 3 4 CONTROL PWB1 CNTH 㧔WH㧕 t° t° THo-D THo-R1 WH BL 1 2 3 4 52X2 52X3 CNB 㧔RD㧕 CNS 㧔RD㧕 52X6 52X1 CNIP 㧔Y㧕 t° THo-A t° THo-R2 F㧔4A㧕 GN BK RD The specifications shown in the above table are for units without heaters. For units with heaters, refer to the installation instructions or the construction instructions of the indoor unit. Switchgear of Circuit breaker capacity which is calculated from MAX. over current should be chosen along the regulations in each country. The cable specifications are based on the assumption that a metal or plastic conduit is used with no more than three cables contained in a conduit and a voltage drop is 2%. For an installation falling outside of these conditions, please follow the internal cabling regulations. Adapt it to the regulation in effect in each country. 19 16 100 140 MAX over current 㧔A㧕 Model THo-P T12 CN2-1 NOISE FILTER PWB3 Power cable size 㧔mm 2 㧕 ̪At the connection with the duct type indoor unit. 140 125 100 Model t° CNH 㧔BR㧕 CNR 㧔WH㧕 CNF WH 㧔BK㧕 WH CNW2 㧔OR㧕 CNW 㧔BK㧕 Power cable, indoor-outdoor connecting wires WIRES [ POWER SIGNAL WIRE ] TO INDOOR UNIT TB Y㧛GN CN1 L1o L2o L3o No RD RD WH Y OR BL BK F㧔8A㧕 BK BK RD L1i L2i L3i Ni BK BK WH Y OR BL R1 R2 U Va R5 +4 RD DM -6 AC1 AC2 AC3 BL K G 52C L R4 R3 RD + + C3 R5 C2 WH C1 SW3-3,4 SW3-2 SW3-1 Trial operation Snow guard fan control Defrost control change N CNO1 㧔RD㧕 CNI2 㧔WH㧕 CNW1 㧔WH㧕 TB6 TB5 INVERTER PWB2 IPM W V U BL W WH V RD U CM MS 3㨪 Reactor High pressure switch 63H1 Yellow Yellow㧛Green Y Y㧛GN P Pink Gray White WH GR Orange Red RD Brown BR OR Blue BL Color Black BK Mark Auxilliary relay㧔for 52C㧕 52X6 Auxilliary relay㧔for 20S㧕 Auxilliary relay㧔for DH㧕 52X3 Auxilliary relay㧔for CH㧕 52X2 20S Relay Thermistor㧔IPM㧕 Solenoid valve for 4 way valve THo-P 52X1 Thermistor㧔Suction pipe temp.㧕 THo-S 52C Thermistor㧔Discharger pipe temp.㧕 Thermistor㧔Heat exchanger pipe temp. 㧕 THo-R1,2 Thermistor㧔Outdoor air temp.㧕 THo-A THo-D Local setting switch Terminal block TB Pump down switch SW3,5 SW1 Expansion valve for heating Expansion valve for cooling SM1 SM2 Low pressure sensor Indication lamp㧔RED㧕 Indication lamp㧔GREEN㧕 LPT LED2 LED1 L Fan motor Intelligent power module IPM Fuse Diode module Drain pan heater FMo1,2 F DM DH Current sensor Connector CnA㨪Z CT Compressor motor CM Description Crankcase heater Item CH The defrosting operation interval becomes shorter by turning ON this switch. This switch should be turned ON in the area where outside temperature becomes below the freezing point. When this switch is turned ON, the outdoor unit fan will run for 30 seconds in every 10 minutes, when outdoor temperature falls to 3͠ or lower and the compressor is not runnning when the unit is used in a very snowy country, set this switch to ON. Method of trial operation 1 Trial operation can be performed by using SW3-3,4. 2 Compressor will be in the operation when SW3-3 is ON. 3 Cooling trial operation will be performed when SW3-4 is OFF, and heating trial operation when SW3-4 is ON. 4 Be sure to turn OFF SW3-3 after the trial operation is finished. BL RD BK RD BL P CNW2 BL 㧔WH㧕 RD CNR BK 㧔WH㧕 GN RD Local setting switch SW3㧔Set up at shipment OFF㧕 C4 RD 4 3 2 1 RD RD L1 WH L2 BL L3 BK N RD TB BR WH RD BK BK BL BL RD BL BR OR WH RD WH BK BR Y Y BK BK BL BK WH RD RD BL BR OR WH RD BL POWER SOURCE 3N㨪380㨺415V 50Hz '10 • PAC-SM-137 Models FDC100VSX, 125VSX, 140VSX PCA001Z571 A '10 • PAC-SM-137 4. PIPING SYSTEM (1) Single type Model 71 Indoor unit Outdoor unit Cooling cycle Heating cycle Check joint Gas line (㱢15.88) Thermistor (ThO-A) Muffler 4way valve Service valve (Flare connecting) Flare connecting Check joint Thermistor (Heat exchanger) (ThI-R3) Thermistor (Return air) (ThI-A) Heat exchanger Thermistor (ThO-S) High pressure switch 63H1 Check valve Thermistor (ThO-D) Heat exchanger Lower pressure sensor (LPT) Thermistor (ThO-R1) Muffler Thermistor (Heat exchanger) (ThI-R2) Accumlator (Discharge) Thermistor (Heat exchanger) (ThI-R1) Compressor Thermistor (ThO-R2) (Suction) Flare connecting Liquid line (㱢9.52) Solenoid valve (SV1) Service valve (Flare connecting) Strainer Strainer Strainer Strainer Electronic expansion valve (heating)(EEVH) Electronic expansion valve (cooling)(EEVC) Receiver Models 100,125,140 Indoor unit Outdoor unit Cooling cycle Heating cycle Check joint Gas line (㱢15.88) Thermistor (ThO-A) Muffler Service valve (Flare connecting) Flare connecting 4way valve Thermistor (Heat exchanger) (ThI-R3) Thermistor (Return air) (ThI-A) Heat exchanger Check valve Muffler Thermistor (ThO-D) Lower pressure sensor (LPT) Thermistor (ThO-R1) Thermistor (ThO-S) Thermistor (Heat exchanger) (ThI-R2) Check joint Heat exchanger High pressure switch 63H1 (Discharge) Accumlator Thermistor (Heat exchanger) (ThI-R1) Compressor Thermistor (ThO-R2) (Suction) Flare connecting Sub-cooling coil Liquid line (㱢9.52) Service valve (Flare connecting) Strainer Strainer Electronic expansion valve (cooling)(EEVC) Strainer Receiver – 113 – Strainer Electronic expansion valve (heating)(EEVH) '10 • PAC-SM-137 (2) Twin type Model 71 Gas branch pipe (㱢12.7) Indoor unit Indoor unit Outdoor unit Cooling cycle Heating cycle Check joint Gas line (㱢15.88) Thermistor (ThO-A) Muffler 4way valve Service valve (Flare connecting) Flare connecting Check joint Thermistor (Heat exchanger) (ThI-R3 or Th22) Thermistor (Return air) (ThI-A or Th1) Heat exchanger Thermistor (ThO-S) High pressure switch 63H1 Check valve Thermistor (ThO-D) Heat exchanger Lower pressure sensor (LPT) Thermistor (ThO-R1) Muffler Thermistor (Heat exchanger) (ThI-R2 or Th21) Thermistor (Heat exchanger) (ThI-R1) Flare connecting (㱢6.35) Diameter joint of different Accumlator (Discharge) Compressor Thermistor (ThO-R2) (Suction) Liquid line (㱢9.52) Solenoid valve (SV1) Service valve (Flare connecting) Strainer Strainer Liquid branch pipe Electronic expansion valve (heating)(EEVH) Electronic expansion valve (cooling)(EEVC) (㱢9.52) Strainer Strainer Receiver Models 100,125,140 Gas branch pipe Indoor unit Indoor unit 50,60:㱢12.7 71 :㱢15.88 Outdoor unit Cooling cycle Heating cycle Check joint Gas line (㱢15.88) Thermistor (ThO-A) Muffler Service valve (Flare connecting) Flare connecting 4way valve Thermistor (Heat exchanger) (ThI-R3 ) Thermistor (Return air) (ThI-A) Heat exchanger Check valve Muffler Thermistor (ThO-D) Lower pressure sensor (LPT) Thermistor (ThO-R1) Thermistor (ThO-S) Thermistor (Heat exchanger) (ThI-R2) Thermistor (Heat exchanger) (ThI-R1) Check joint Heat exchanger High pressure switch 63H1 (Discharge) Accumlator Compressor Thermistor (ThO-R2) Flare connecting 50,60:㱢6.35 71 :㱢9.52 Diameter joint of different (50,60 only) (Suction) Sub-cooling coil Liquid line (㱢9.52) Service valve (Flare connecting) Strainer Liquid branch pipe Strainer Electronic expansion valve (cooling)(EEVC) (㱢9.52) Strainer Electronic expansion valve (heating)(EEVH) Receiver – 114 – Strainer '10 • PAC-SM-137 (3) Triple type Model 140 Indoor unit Indoor unit Indoor unit Gas branch pipe (㱢12.7) Cooling cycle Check joint Gas line (㱢15.88) Flare connecting Thermistor (Heat exchanger) (ThI-R3 or Th22) Thermistor (Return air) (ThI-A or Th1) Heat exchanger Thermistor (Heat exchanger) (ThI-R2 or Th21) Thermistor (Heat exchanger) (ThI-R1) Liquid branch pipe (㱢9.52) Flare connecting (㱢6.35) Outdoor unit Liquid line (㱢9.52) Diameter joint of different Heating cycle Thermistor (ThO-A) Muffler Service valve (Flare connecting) 4way valve High pressure switch (63H1) Check valve Muffler (Discharge) Compressor Service valve (Flare connecting) Lower pressure sensor (LPT) Thermistor (ThO-R1) Thermistor (ThO-S) Thermistor (ThO-D) Check joint Heat exchanger (Suction) Strainer Strainer Electronic expansion valve (cooling)(EEVC) Accumlator Thermistor (ThO-R2) Sub-cooling coil Strainer Electronic expansion valve (heating)(EEVH) Receiver Preset point of the protective devices Parts name Thermistor (for protection overloading in heating) Mark ThI-R (Th2) Equipped unit 71,100,125, 140 model 㪦㪝㪝㩷㪍㪊㩿㪍㪉㪀㷄 㪦㪥㩷㪌㪍㩿㪋㪏㪅㪌㪀㷄 㪠㫅㪻㫆㫆㫉㩷㫌㫅㫀㫋 㪦㪝㪝㩷㪈㪅㪇㩿㪉㪅㪌㪀㷄 㪦㪥㩷㪈㪇㩿㪏㪀㷄 Thermistor (for frost prevention) Thermistor (for protection high pressure in cooling.) Tho-R 㪦㫌㫋㪻㫆㫆㫉㩷㫌㫅㫀㫋 㪦㪝㪝㩷㪌㪈㷄 㪦㪥㩷㪍㪌㷄 Thermistor (for detecting discharge Tho-D pipe temp.) 㪦㫌㫋㪻㫆㫆㫉㩷㫌㫅㫀㫋 㪦㪝㪝㩷㪈㪈㪌㷄 㪦㪥㩷㪏㪌㷄 High pressure switch (for protection) 63H1 㪦㫌㫋㪻㫆㫆㫉㩷㫌㫅㫀㫋 㪦㪝㪝㩷㪋㪅㪈㪌㪤㪧㪸㩷 㪦㪥㩷㪊㪅㪈㪌㪤㪧㪸㩷 Low pressure sensor (for protection) LPT 㪦㫌㫋㪻㫆㫆㫉㩷㫌㫅㫀㫋 㪦㪝㪝㩷㪇㪅㪉㪉㪎㪤㪧㪸㩷 㪦㪥㩷㪇㪅㪇㪎㪐㪤㪧㪸㩷 㪥㫆㫋㪼㩿㪈㪀㩷㩷㪭㪸㫃㫌㪼㫊㩷㫀㫅㩷㩿㩷㩷㩷㪀㩷㫊㪿㫆㫎㩷㫀㫅㩷㫋㪿㪼㩷㪺㪸㫊㪼㩷㫆㪽㩷㫄㫆㪻㪼㫃㩷㪪㪩㪢㩷㪅 – 115 – Strainer '10 • PAC-SM-137 5 APPLICATION DATA 5.1 Installation of indoor unit (1) Ceiling cassette-4way compact type (FDTC) – 116 – '10 • PAC-SM-137 ① Before installation ③ Preparation before installation c Accessory items Accessory itme Ceiling opening, Suspension bolts pitch, Pipe position 1 For drain hose mounting 530 (Suspension bolts pitch) F F xAreas where the indoor unit can deliver hot and cold wind sufficiently. Suggest to the user to use a circulator if the ceiling height is over 3m to avoid warm air being accumulated on the ceiling. xAreas where there is enough space to install and service. xAreas where it can be drained properly. Areas where drain pipe descending slope can be taken. xAreas where there is no obstruction of airflow on both air return grille and air supply port. xAreas where fire alarm will not be accidentally activated by the air conditioner. xAreas where the supply air does not short-circuit. xAreas where it is not influenced by draft air. xAreas not exposed to direct sunlight. xAreas where dew point is lower than around 28°C and relative humidity is lower than 80%. This indoor unit is tested under the condition of JIS (Japan Industrial Standard) high humidity condition and confirmed there is no problem. However, there is some risk of condensation drop if the air conditioner is operated under the severer condition than mentioned above. If there is a possibility to use it under such a condition, attach additional insulation of 10 to 20mm thick for entire surface of indoor unit, refrigeration pipe and drain pipe. xAreas where TV and radio stays away more than 1m. (It could cause jamming and noise.) xAreas where any items which will be damaged by getting wet are not placed such as food, table wares, server, or medical equipment under the unit. xAreas where there is no influence by the heat which cookware generates. xAreas where not exposed to oil mist, powder and/or steam directly such as above fryer. xAreas where lighting device such as fluorescent light or incandescent light doesn’t affect the operation. (A beam from lighting device sometimes affects the infrared receiver for the wireless remote controller and the air conditioner might not work properly.) N Check if the place where the air conditioner is installed can hold the weight of the unit. If it is not able to hold, reinforce the structure with boards and beams strong enough to hold it. If the strength is not enough, it could cause injury due to unit falling. O If there are 2 units of wireless type, keep them away for more than 5m to avoid malfunction due to cross communication. P When plural indoor units are installed nearby, keep them away for more than 4m. Symbol A B C D E F F Control box 185 190 Content Gas piping Liquid piping Drain piping Hole for wiring Suspension bolts Air outlet opening for ducting 21 200 B □413 □700 48 Drain hose piece (Accessory) (Installed on site) □570 325 A Air return Air supply grille D 223 C 145 140 60 E 88 ② Selection of installation location for the indoor unit M Select the suitable areas to install the unit under approval of the user. Decorative panel Hole 6-Ǿ4 Holes for tapping screws 140 1 For drain pipe connecting 100 1 For heat insulation of drain socket 35 1 For heat insulation of drain socket Hose clamp 556 67 4 For pipe cover fixing Drain hose 210 248 1 For heat insulation of liquid tube Pipe cover(big) Pipe cover(small) 88 8 4 1 For adjustment For heat For unit hanging in hoisting in the insulation unit's main body of gas pipe For draom pipe Strap 100 35 For refrigerant pipe Pipe cover (small) 530( Suspension bolts pitch) 350 326 Pipe cover(big) 192 132 For unit hanging Flat washer Level gauge (M10) (Insulation) z If suspension bolt becomes longer, do reinforcement of earthquake resistant. c For grid ceiling When suspension bolt length is over 500mm, or the gap between the ceiling and roof is over 700mm, apply earthquake resistant brace to the bolt. c In case the unit is hanged directly from the slab and is installed on the ceiling plane which has enough strength. When suspension bolt length is over 1000mm, apply the earthquake resistant brace to the bolt. z Prepare four (4) sets of suspension bolt, nut and spring washer (M10 or M8) on site. 45 or more z Install correctly according to the installation manual. z Confirm the following points: c Unit type/Power supply specification c Pipes/Wires/Small parts Hanger plate for suspension bolt F ④ Installation of indoor unit Work procedure 1. This units is designed for 2 x 2 grid ceiling. If necessary, please detach the T bar temporarily before you install it. If it is installed on a ceiling other than 2 x 2 grid ceiling, provide an inspection port on the control box side. 2. Arrange the suspension bolt at the right position (530mm×530mm). 3. Make sure to use four suspension bolts and fix them so as to be able to hold 500N load. 4. Ensure that the lower end of the suspension bolt should be 45mm above the ceiling plane. Temporarily put the four lower nuts 88mm above the ceiling plane and the upper nuts on distant place from the lower nuts in order not to obstruct hanging the indoor unit or adjust the indoor unit position, and then hang the indoor unit. Control box Space for installation and service T bar z When it is not possible to keep enough space between indoor unit and wall or between indoor units, close the air supply port where it is not possible to keep space and confirm there is no short circuit of airflow. z Install the indoor unit at a height of more than 2.5m above the floor. 4000mm or more Indoor unit Indoor unit Ceiling panel 5. Adjust the indoor unit position after hanging it by inserting the level gauge attached on the package into the air supply port and checking if the gap between the ceiling plane and the indoor unit is appropriate. In order to adjust the indoor unit position, adjust the lower nuts while the upper nuts are put on distant place. Confirm there is no backlash between the hanger plate for suspension bolt and the lower nut and washer. Drain piping Suspension bolt 1000mm or more Nut (upper) 2500mm or more Decorative panel 1000mm or more Flat washer Obstacle Spring washer Floor Nut (lower) 88mm 45mm Level gauge Use level gauges as reference, adjust the bottom to the face of the indoor unit. Use level gauges as reference, adjust the bottom to the face of the indoor unit. 30 Ceiling surface 30 Wall Refrigerant piping Ceiling surface Diffuser Level gauge (insulation) Diffuser Ceiling panel Level gauge (insulation) T-bar Ceiling panel T-bar When the ceiling panel comes below the T bar, align the bottom of the level gauge to the lower face of the ceiling panel. Correct Unit Touch the nut (lower) and washer without any play – 117 – Wrong Unit Play is left between the fixture and the nut (lower) and washer. '10 • PAC-SM-137 ④ Installation of indoor unit (continued) ⑥ Drain pipe (continued) 6. Make sure to install the indoor unit horizontally. Confirm the levelness of the indoor unit with a level gauge or transparent hose filled with water. Keep the height difference at both ends of the indoor unit within 3mm. 7. Tighten four upper nuts and fix the unit after height and levelness adjustment. Work procedure 1. Make sure to insert the drain hose (the end mode of soft PVC) to the end of the step part of drain socket. Attach the hose clamp to the drain hose around 10mm from the end, and fasten the screw within 5mm left to the nut. z Do not apply adhesives on this end. Indoor unit hose Caution z Do not adjust the height by adjusting upper nuts. It will cause unexpected stress on the indoor unit and it will lead to deformation of the unit, failure of attaching a panel, and generating noise from the fan. z Make sure to install the indoor unit horizontally and set the gap between the unit underside and the ceiling plane properly. Improper installation may cause air leakage, dew condensation, water leakage and noise. z Even after decorative panel attached, still the unit height can be adjusted finely. Refer to the installation manual for decorative panel for details. z Make sure there is no gap between decoration panel and ceiling surface, and between decoration panel and the indoor unit. The gap may cause air leakage, dew condensation and water leakage. z In case decorative panel is not installed at the same time, or ceiling material is installed after the unit installed, put the cardboard template for installation attached on the package (packing material of cardboard box) on the bottom of the unit in order to avoid dust coming into the indoor unit. ippe oc ev r (big) (F or insulation ) cesso (A ry) Joint f or P -20V repare on site) (P nit U Drain socket The step part Drain hose rain hos e D ce( sso A ry) rain so D No adhesive allowed C p lam cessor kc et (A -20 P V repare on site) (P onnect C iPpe oc ver s( m al ) (F or insulation ) repare on site) (P y iPpe oc ev r (salm ) (F or insulation ) cesso (A ry) Fasten the screw within 5 mm left to the nut. Hose clamp Drain hose Drain socket ⑤ Refrigerant pipe Caution Metal plate z Use the new refrigerant pipe. When re-using the existing pipe system for R22 or R407C, pay attention to the following items. xChange the flare nuts with the attached ones (JIS category 2), and reprocess the flare parts. xDo not use thin-walled pipes. z Use phosphorus deoxidized copper alloy seamless pipe (C1220T specified in JIS H3300) for refrigeration pipe installation. In addition, make sure there is no damage both inside and outside of the pipe, and no harmful substances such as sulfur, oxide, dust or a contaminant stuck on the pipes. z Do not use any refrigerant other than R410A. Using other refrigerant except R410A (R22 etc.) may degrade inside refrigeration oil. And air getting into refrigeration circuit may cause over-pressure and resultant it may result in bursting, etc. z Store the copper pipes indoors and seal the both end of them until they are brazed in order to avoid any dust, dirt or water getting into pipe. Otherwise it will cause degradation of refrigeration oil and compressor breakdown, etc. z Use special tools for R410 refrigerant. 10mm 2. Prepare a joint for connecting VP-20 pipe, adhere and connect the joint to the drain hose (the end made of rigid PVC), and adhere and connect VP-20 pipe (prepare on site). As for drain pipe, apply VP-20 made of rigid PVC which is on the market. z Make sure that the adhesive will not get into the supplied drain hose. It may cause the flexible part broken after the adhesive is dried up and gets rigid. z Do not bend or make an excess offset on the drain hose as shown in the picture. Bend or excess offset will cause drain leakage. Over 20mm Work procedure 1. Remove the flare nut and blind flanges on the pipe of the indoor unit. Make sure to loosen the flare nut with holding the nut on pipe side with a spanner and giving torque to the nut with another spanner in order to avoid unexpected stress to the copper pipe, and then remove them. (Gas may come out at this time, but it is not abnormal.) z Pay attention whether the flare nut pops out. (as the indoor unit is sometimes pressured.) 2. Make a flare on liquid pipe and gas pipe, and connect the refrigeration pipes on the indoor unit. Bend the pipe with as big radius as possible and do not bend the pipe repeatedly. In addition, do not twist and crush the pipes. Do a flare connection as follows: z Make sure to loosen the flare nut with holding the nut on pipe side with a spanner and giving torque to the nut with another spanner in order to avoid unexpected stress to the copper pipe, and then remove them. z When fastening the flare nut, align the refrigeration pipe with the center of flare nut, screw the nut for 3-4 times by hand and then tighten it by spanner with the specified torque mentioned in the table below. Make sure to hold the pipe on the indoor unit securely by a spanner when tightening the nut in order to avoid unexpected stress on the copper pipe. 3. Cover the flare connection part of the indoor unit with attached insulation material after a gas leakage inspection, and tighten both ends with attached straps. z Make sure to insulate both gas pipes and liquid pipes completely. Incomplete insulation may cause dew condensation or water dropping. 4. Refrigerant is charged in the outdoor unit. As for the additional refrigerant charge for the indoor unit and piping, refer to the installation manual attached to the outdoor unit. trapA S ce( sso Pipe diameter I 6.35 I 9.52 I 12.7 I 15.88 I 19.05 Tightening torque N·m 14 to 18 34 to 42 49 to 61 68 to 82 100 to 120 ry) ipe oc P ver A ce( ssor y) 3. Make sure to make descending slope of greater than 1/100 and do not make up-down bend and/or trap in the midway. z Pay attention not to give stress on the pipe on the indoor unit side, and support and fix the pipe as close place to the unit as possible when connecting the drain pipe. z Do not set up air vent. 1.5m ~ 2m Supporting metal Trapped air will generate noises. No bump No trap Air vent Not touching the water Insulation material Descending slope greater than 1/100 z When sharing a drain pipe for more than one unit, lay the main pipe 100mm below the drain outlet of the unit. In addition, select VP-30 or bigger size for main drain pipe. sw A ide sa possib (about10m ) le -30or ibge P V r escendingstopgreater than /10 D 4. Insulate the drain pipe. z Be sure to insulate the drain socket and rigid PVC pipe installed indoors otherwise it may cause dew condensation and water leakage. After drainage test implementation, cover the drain socket part with pipe cover (small size), then use the pipe cover (big size) to cover the pipe cover (small size), clamps and part of the drain hose, and fix and wrap it with tapes to wrap and make joint part gapless. Drain up The thic nk ess ofinsultaion should eb 0m 2or omre . z The position for drain pipe outlet can be raised up to 600mm above the ceiling. Use elbows for installation to avoid obstacles inside ceiling. If the horizontal drain pipe is too long before vertical pipe, the backflow of water will increase when the unit is stopped, and it may cause overflow of water from the drain pan on the indoor unit. In order to avoid overflow, keep the horizontal pipe length and offset of the pipe within the limit shown in the figure below. ⑥ Drain pipe Caution – 118 – 295 to 325mm Drain hose 100 or less 600mm or less z Install the drain pipe according to the installation manual in order to drain properly. Imperfection in draining may cause flood indoors and wetting the household goods etc. z Do not put the drain pipe directly into the ditch where toxic gas such as sulfur, the other harmful and inflammable gas is generated. Toxic gas would flow into the room and it would cause serious damage to user’s health and safety (some poisoning or deficiency of oxygen). In addition, it may cause corrosion of heat exchanger and bad smell. z Connect the pipe securely to avoid water leakage from the joint. z Insulate the pipe properly to avoid condensation drop. z Check if the water can flow out properly from both the drain outlet on the indoor unit and the end of the drain pipe after installation. z Make sure to make descending slope of greater than 1/100 and do not make up-down bend and/or trap in the midway. In addition, do not put air vent on the drain pipe. Check if water is drained out properly from the pipe during commissioning. Also, keep sufficient space for inspection and maintenance. Joint for VP-20 (Prepare on site) '10 • PAC-SM-137 ⑥ Drain pipe (continued) ⑧ Panel installation z After wiring work finished, install the panel on the indoor unit. z Refer to attached panel installation manual for details. (see next page) Drain test z After installation of drain pipe, make sure that drain system work in good condition and no water leakage from joint and drain pan. Check if the motor sound of drain pump is normal or not. z Do drain test even if installation of heating season. z For new building cases, make sure to complete the test before hanging the ceiling. 1. Pour water of about 1000cc into the drain pan in the indoor unit by pump so as not to get the electrical component wet. 2. Make sure that water is drained out properly and there is no water leakage from any joints of the drain pipe at the test. Confirm that the water is properly drained out while the drain motor is operating. At the drain socket (transparent), it is possible to check if the water is drained out properly. 3. Unplug the drain plug on the indoor unit to remove remaining water on the drain pan after the test, and re-plug it. And insulate the drain Drain plug pipe properly finally. Accessory items 1 Hook 1 piece 2 Chain 2 pieces 3 Bolt 4 pieces For installing the panel 4 5 Screw Screw 1 piece 2 pieces For attaching a hook For attaching a chain z Attach the panel on the indoor unit after electrical wiring work. z Refer to attached manual for panel installation for details.(See next page) Drain pump operation ⑨ Check list after installation c In case electrical wiring work finished Drain pump can be operated by remote controller (wired). For the operation method, refer to Operation for drain pump in the installation manual for wiring work. c In case electrical wiring work not finished Drain pump will run continuously when the dip switch“SW7-1” on the indoor unit PCB is turned ON, the Connector CNB is disconnected, and then the power supply (220-240VAC on the terminal block [ ① and ②] or [ Ⓛ and Ⓝ ] ) is turned ON. Make sure to turn OFF “SW7-1” and reconnect the Connector CNB after the test. ⑦ Wiring-out position and wiring connection z Check the following items after all installation work completed. Check if The indoor and outdoor units are fixed securely? Inspection for leakage is done? Insulation work is properly done? Water is drained properly? Supply voltage is same as mentioned in the model name plate? There is mis-wiring or mis-connection of piping? Earth wiring is connected properly? Cable size comply with specified size? Any obstacle blocks airflow on air inlet and outlet? z Electrical installation work must be performed according to the installation manual by an electrical installation service provider qualified by a power provider of the country, and be executed according to the technical standards and other regulations applicable to electrical installation in the country. Be sure to use an exclusive circuit. z Use specified cord, fasten the wiring to the terminal securely, and hold the cord securely in order not to apply unexpected stress on the terminal. z Do not put both power source line and signal line on the same route. It may cause miscommunication and malfunction. z Be sure to do D type earth work. z For the details of electrical wiring work, see attached instruction manual for electrical wiring work. 1. 2. 3. 4. For fixing temporarily Remove a lid of the control box (1 screws). Hold each wiring inside the unit and fasten them to terminal block securely. Fix the wiring with clamp. Install a lid of the control box back to original place. Single split (PAC) series 6 6 Power source side terminal block Earth Wiring between indoor and outdoor unit Remote controller line Wiring clamp Signal side terminal block VRF (KX) series 6 6 Power source side terminal block Earth Indoor power source line Signal line (shielded cord) Remote controller line Wiring clamp Earth (signal line) Signal side terminal block – 119 – Expected trouble Falling, vibration, noise Insufficient capacity Water leakage Water leakage PCB burnt out, not working at all PCB burnt out, not working at all Electric shock PCB burnt out, not working at all Insufficient capacity Check '10 • PAC-SM-137 PJA012D783 – 120 – a '10 • PAC-SM-137 – 121 – '10 • PAC-SM-137 (2) Ceiling cassette-4way type (FDT) – 122 – '10 • PAC-SM-137 – 123 – '10 • PAC-SM-137 – 124 – '10 • PAC-SM-137 (See next page) – 125 – '10 • PAC-SM-137 PJF012D003A – 126 – A '10 • PAC-SM-137 – 127 – '10 • PAC-SM-137 (3) Ceiling suspended type (FDEN) – 128 – '10 • PAC-SM-137 – 129 – '10 • PAC-SM-137 – 130 – '10 • PAC-SM-137 – 131 – '10 • PAC-SM-137 (4) Duct connected-Low / Middle static pressure type (FDUM) – 132 – '10 • PAC-SM-137 – 133 – '10 • PAC-SM-137 – 134 – '10 • PAC-SM-137 Following table shows the maximum external static pressure for models adapted to the fan setting speed (Hi, UH). Select at site the fan setting speed according to the external static pressure. Taps should not be used under external static pressure mentioned above. Dew condensation may occur with the unit and wet the ceiling or furniture. Do not use under external static pressure of 60Pa or less. Water drops may be blown from the diffuser outlet of the unit and wet the ceiling or furniture. – 135 – '10 • PAC-SM-137 (5) Duct connected-High static pressure type (FDU) – 136 – '10 • PAC-SM-137 ٤5IJTNPEFMJTNJEEMFTUBUJDEVDUFEUZQFBJSDPOEJUJPOJOHVOJU5IFSFGPSFEPOPUVTFUIJTNPEFMGPSEJSFDU CMPXUZQFBJSDPOEJUJPOJOHVOJU Ԙ#FGPSFJOTUBMMBUJPO Ԛ1SFQBSBUJPOCFGPSFJOTUBMMBUJPO ٨*GTVTQFOTJPOCPMUCFDPNFTMPOHFSEPSFJOGPSDFNFOUPGFBSUIRVBLFSFTJTUBOU ޓ٤'PSHSJEDFJMJOH ޓޓ8IFOUIFTVTQFOTJPOCPMUMFOHUIJTPWFSNNPSUIFHBQCFUXFFOUIFDFJMJOHBOESPPG JTPWFSNNBQQMZFBSUIRVBLFSFTJTUBOUCSBDFUPUIFCPMU ٤*ODBTFUIFVOJUJTIBOHFEEJSFDUMZGSPNUIFTMBCBOEJTJOTUBMMFEPOUIFDFJMJOHQMBOFXIJDI IBTFOPVHITUSFOHUI ޓޓ8IFOTVTQFOTJPOCPMUMFOHUIJTPWFSNNBQQMZUIFFBSUIRVBLFSFTJTUBOUCSBDFUPUIFCPMU ٨1SFQBSFGPVS TFUTPGTVTQFOTJPOCPMUOVUBOETQSJOHXBTIFS. POTJUF ٨*OTUBMMDPSSFDUMZBDDPSEJOHUPUIFJOTUBMMBUJPONBOVBM ٨$POmSNUIFGPMMPXJOHQPJOUT ޓ٤6OJUUZQF1PXFSTVQQMZTQFDJmDBUJPO ޓ٤1JQFT8JSFT4NBMMQBSUT ޓ٤"DDFTTPSZJUFNT "DDFTTPSZJUFN 4VTQFOTJPO#PMU-PDBUJPO 'PSSFGSJHFSBOUQJQF 1JQFDPWFSTNBMM 4USBQ 1JQFDPWFSCJH 4VTQFOTJPOCPMU. "DDFTTPSZQBSUTBSFTUPSFEJOTJEF UIJTTVDUJPOTJEF 'PSIFBUJOTVMBUJPO PGHBTQJQF 6OJU " 'PSIFBUJOTVMBUJPO 'PSQJQFDPWFSmYJOH PGMJRVJEUVCF 6/*5NN .VMUJUZQF 4JOHMFUZQF " 'PSESBJOQJQF 1JQFDPWFSCJH 1JQFDPWFSTNBMM %SBJOIPTF ٤"EIFSFUPUIF NFBTVSFNFOUTHJWFO CFMPXGPSUIFMFOHUIPG UIFTVTQFOTJPOCPMUT 6OEFSNN )PTFDMBNQ 1JQFMPDBUJPOT 6/*5NN .VMUJUZQF 4JOHMFUZQF 'PSESBJOIPTF NPVOUJOH ԙ4FMFDUJPOPGJOTUBMMBUJPOMPDBUJPOGPSUIFJOEPPSVOJU .VMUJUZQF 4JOHMFUZQF %SBJO $POOFDUBCMFXJUI71 %SBJO /BUVSBMESBJOBHF71 -JRVJE QJQJOH (BT QJQJOH "JSPVUMFUEVDU %SBJO $POOFDUBCMFXJUI71 %SBJO /BUVSBMESBJOBHF71 ԛ*OTUBMMBUJPOPGJOEPPSVOJU *OTUBMMBUJPO <)BOHJOH> )BOHUIFVOJUVQ *GUIFNFBTVSFNFOUTCFUXFFO UIFVOJUBOEUIFDFJMJOHIPMFEP OPUNBUDIVQPOJOTUBMMBUJPOJU NBZCFBEKVTUFEXJUIUIFMPOH IPMFEJOTUBMMBUJPOUPPM 4VTQFOTJPOCPMU 6OJU *OTUBMMBUJPO4QBDF (BT QJQJOH "JSPVUMFUEVDU .OVU 4QBDFGPSJOTUBMMBUJPOBOETFSWJDF ٨.BLFJOTUBMMBUJPOBMUJUVEFPWFSN *OEPPS6OJU -JRVJE QJQJOH Ԙ4FMFDUUIFTVJUBCMFBSFBTUPJOTUBMMUIFVOJUVOEFSBQQSPWBMPGUIFVTFS "ޓSFBTXIFSFUIFJOEPPSVOJUDBOEFMJWFSIPUBOEDPMEXJOETVGmDJFOUMZ4VHHFTUUPUIFVTFS UPVTFBDJSDVMBUPSJGUIFDFJMJOHIFJHIUJTPWFSNUPBWPJEXBSNBJSCFJOHBDDVNVMBUFEPO UIFDFJMJOH "SFBTXIFSFUIFSFJTFOPVHITQBDFUPJOTUBMMBOETFSWJDF "SFBTXIFSFJUDBOCFESBJOFEQSPQFSMZ"SFBTXIFSFESBJOQJQFEFTDFOEJOHTMPQFDBOCF UBLFO "SFBTXIFSFUIFSFJTOPPCTUSVDUJPOPGBJSnPXPOCPUIBJSSFUVSOHSJMMFBOEBJSTVQQMZQPSU "SFBTXIFSFmSFBMBSNXJMMOPUCFBDDJEFOUBMMZBDUJWBUFECZUIFBJSDPOEJUJPOFS "SFBTXIFSFUIFTVQQMZBJSEPFTOPUTIPSUDJSDVJU "SFBTXIFSFJUJTOPUJOnVFODFECZESBGUBJS "SFBTOPUFYQPTFEUPEJSFDUTVOMJHIU "SFBTXIFSFEFXQPJOUJTMPXFSUIBOBSPVOE¡$BOESFMBUJWFIVNJEJUZJTMPXFSUIBO 5IJTJOEPPSVOJUJTUFTUFEVOEFSUIFDPOEJUJPOPG+*4+BQBO*OEVTUSJBM4UBOEBSE IJHIIVNJE JUZDPOEJUJPOBOEDPOmSNFEUIFSFJTOPQSPCMFN)PXFWFSUIFSFJTTPNFSJTLPGDPOEFOTB UJPO ESPQ JG UIF BJS DPOEJUJPOFS JT PQFSBUFE VOEFS UIF TFWFSFS DPOEJUJPO UIBO NFOUJPOFE BCPWF *GUIFSFJTBQPTTJCJMJUZUPVTFJUVOEFSTVDIBDPOEJUJPOBUUBDIBEEJUJPOBMJOTVMBUJPOPGUP NNUIJDLGPSFOUJSFTVSGBDFPGJOEPPSVOJUSFGSJHFSBUJPOQJQFBOEESBJOQJQF "SFBTXIFSF57BOESBEJPTUBZTBXBZNPSFUIBON*UDPVMEDBVTFKBNNJOHBOEOPJTF "SFBTXIFSFBOZJUFNTXIJDIXJMMCFEBNBHFECZHFUUJOHXFUBSFOPUQMBDFETVDIBTGPPE UBCMFXBSFTTFSWFSPSNFEJDBMFRVJQNFOUVOEFSUIFVOJU "SFBTXIFSFUIFSFJTOPJOnVFODFCZUIFIFBUXIJDIDPPLXBSFHFOFSBUFT "SFBTXIFSFOPUFYQPTFEUPPJMNJTUQPXEFSBOEPSTUFBNEJSFDUMZTVDIBTBCPWFGSZFS "SFBTXIFSFMJHIUJOHEFWJDFTVDIBTnVPSFTDFOUMJHIUPSJODBOEFTDFOUMJHIUEPFTOUBGGFDU UIFPQFSBUJPO "CFBNGSPNMJHIUJOHEFWJDFTPNFUJNFTBGGFDUTUIFJOGSBSFESFDFJWFSGPSUIFXJSFMFTTSFNPUF DPOUSPMMFSBOEUIFBJSDPOEJUJPOFSNJHIUOPUXPSLQSPQFSMZ ԙ$IFDLJGUIFQMBDFXIFSFUIFBJSDPOEJUJPOFSJTJOTUBMMFEDBOIPMEUIFXFJHIUPGUIFVOJU*GJUJT OPUBCMFUPIPMESFJOGPSDFUIFTUSVDUVSFXJUICPBSETBOECFBNTTUSPOHFOPVHIUPIPMEJU*GUIF TUSFOHUIJTOPUFOPVHIJUDPVMEDBVTFJOKVSZEVFUPVOJUGBMMJOH 'PSESBJOQJQF DPOOFDUJOH 'PSIFBUJOTVMBUJPO PGESBJOTPDLFU 'PSIFBUJOTVMBUJPO PGESBJOTPDLFU 8BTIFSGPS. 4QSJOHXBTIFSGPS. "EKVTUNFOUGPSIPSJ[POUBMJUZ *OTQFDUJPO IPMF ٤&JUIFSVTFBMFWFMWJBMPSBEKVTUUIFMFWFMBDDPSEJOHUPUIFNFUIPECFMPX ٨"EKVTUTPUIFCPUUPNTJEFPGUIFVOJUXJMMCFMFWFMFEXJUIUIFXBUFSTVSGBDFBT JMMVTUSBUFECFMPX 1JQFTJEF 1PVSXBUFS 8BUFS TVSGBDF " 6/*5NN .VMUJUZQF 4JOHMFUZQF " _NN 7JOZMIPTF -FUUIFQJQFTJEFCFTMJHIUMZTMPQFE ٤*GUIFVOJUJTOPUMFWFMFEJUNBZDBVTFNBMGVODUJPOTPSJOPQFSBUJPOPGUIFnPBUTXJUDI – 137 – '10 • PAC-SM-137 Ԝ%VDU8PSL ԝ3FGSJHFSBOUQJQFDPOUJOVFE "DPSSVHBUFECPBSEGPSQSFWFOUJOHTQVUUFSJOH JTBUUBDIFEUPUIFNBJOCPEZPGUIFBJSDPOEJUJPOFS POUIFPVUMFUQPSU %POPUSFNPWFJUVOUJMDPOOFDUJOHUIFEVDU Ԙ٨5IFBJSDPOEJUJPOFSNBJOVOJUEPFTOPUIBWFBOBJSmMUFS*ODPSQPSBUFJUJOUPUIFFBTZUPDMFBO TVDUJPOHSJMMF ԙ#MPXPVUEVDU ٨5IFEVDUTTIPVMECFBUUIFJSNJOJNVNMFOHUIT ٨,FFQUIFCFOETUPBNJOJNVN5IFCFOEJOHSBEJVTTIPVMECFBTMBSHFBTQPTTJCMF 8PSLQSPDFEVSF #BEFYBNQMF #BEFYBNQMF (PPEFYBNQMF ٨$POEVDUUIFEVDUXPSLCFGPSFDFJMJOHBUUBDINFOU Ԛ4VDUJPOEVDU ٨.BLFTVSFUPJOTVMBUFUIFEVDUUPQSFWFOUEFXJOHPOJU ԛ-PDBUJPOBOEGPSNPGCMPXPVUMFUTIPVMECFTFMFDUFETPUIBUBJSGSPNUIFPVUMFUXJMMCFEJTUSJC VUFEBMMPWFSUIFSPPNBOEFRVJQQFEXJUIBEFWJDFUPDPOUSPMBJSWPMVNF Ԝ.BLFTVSFQSPWJEFBOJOTQFDUJPOIPMFPOUIFDFJMJOH*UJTJOEJTQFOTBCMFUPTFSWJDFFMFDSJD FRVJQNFOUNPUPSGVODUJPOBMDPNQPOFOUTBOEDMFBOJOHPGIFBUFYDIBOHFS "JSDPOEJUJPOFSNBJOVOJU 3FNPWFUIFnBSFOVUBOECMJOEnBOHFTPOUIFQJQFPGUIFJOEPPSVOJU ̪.BLFTVSFUPMPPTFOUIFnBSFOVUXJUIIPMEJOHUIFOVUPOQJQFTJEFXJUIBTQBOOFSBOEHJWJOHUPSRVF UPUIFOVUXJUIBOPUIFSTQBOOFSJOPSEFSUPBWPJEVOFYQFDUFETUSFTTUPUIFDPQQFSQJQFBOEUIFO SFNPWFUIFN (BTNBZDPNFPVUBUUIJTUJNFCVUJUJTOPUBCOPSNBM ٨1BZBUUFOUJPOXIFUIFSUIFnBSFOVUQPQTPVUBTUIFJOEPPSVOJUJTTPNFUJNFTQSFTTVSFE .BLFBnBSFPOMJRVJEQJQFBOEHBTQJQFBOEDPOOFDUUIFSFGSJHFSBUJPOQJQFTPOUIFJOEPPSVOJU ̪#FOEUIFQJQFXJUIBTCJHSBEJVTBTQPTTJCMFBOEEPOPUCFOEUIFQJQFSFQFBUFEMZ*OBEEJUJPO EPOPUUXJTUBOEDSVTIUIFQJQFT ̪%PBnBSFDPOOFDUJPOBTGPMMPXT ٨.BLFTVSFUPMPPTFOUIFnBSFOVUXJUIIPMEJOHUIFOVUPOQJQFTJEFXJUIBTQBOOFSBOEHJWJOH UPSRVFUPUIFOVUXJUIBOPUIFSTQBOOFSJOPSEFSUPBWPJEVOFYQFDUFETUSFTTUPUIFDPQQFS QJQFBOEUIFOSFNPWFUIFN ٨8IFOGBTUFOJOHUIFnBSFOVUBMJHOUIFSFGSJHFSBUJPOQJQFXJUIUIFDFOUFSPGnBSFOVUTDSFX UIFOVUGPSUJNFTCZIBOEBOEUIFOUJHIUFOJUCZTQBOOFSXJUIUIFTQFDJmFEUPSRVF NFOUJPOFEJOUIFUBCMFCFMPX.BLFTVSFUPIPMEUIFQJQFPOUIFJOEPPSVOJUTFDVSFMZCZB TQBOOFSXIFOUJHIUFOJOHUIFOVUJOPSEFSUPBWPJEVOFYQFDUFETUSFTTPOUIFDPQQFSQJQF $PWFSUIFnBSFDPOOFDUJPOQBSUPGUIFJOEPPSVOJUXJUIBUUBDIFEJOTVMBUJPONBUFSJBMBGUFSBHBT MFBLBHFJOTQFDUJPOBOEUJHIUFOCPUIFOETXJUIBUUBDIFETUSBQT ٨.BLFTVSFUPJOTVMBUFCPUIHBTQJQFTBOEMJRVJEQJQFTDPNQMFUFMZ ̪*ODPNQMFUFJOTVMBUJPONBZDBVTFEFXDPOEFOTBUJPOPSXBUFSESPQQJOH 3FGSJHFSBOUJTDIBSHFEJOUIFPVUEPPSVOJU "TGPSUIFBEEJUJPOBMSFGSJHFSBOUDIBSHFGPSUIFJOEPPSVOJUBOEQJQJOHSFGFSUPUIFJOTUBMMBUJPO NBOVBMBUUBDIFEUPUIFPVUEPPSVOJU $FJMJOHTVSJBDF 4VDUJPOEVDU NBSLFUFEJUFN #MPXPVUMFU #MPXPVUEVDU PQUJPOBMPSNBSLFUFEJUFN *OTQFDUJPOIPMF 1JQFEJBNFUFS 4VDUJPOIPMF NBSLFUFEJUFN XJUIBJSmMUFS #BEFYBNQMFPGEVDUXPSL Ԙ*GBEVDUJTOPUQSPWJEFEBUUIFTVDUJPOTJEFCVUJUJTTVCTUJUVUFEXJUIUIFTQBDFPWFSUIFDFJMJOH IVNJEJUZJOUIFTQBDFXJMMJODSFBTFCZUIFJOnVFODFPGDBQBDJUZPGWFOUJMBUJPOGBOTUSFOHUIPG XJOECMPXJOHBHBJOTUUIFPVUEPPSBJSMPVWFSXFBUIFSSBJOZEBZ BOEPUIFST B .PJTUVSFJOBJSJTMJLFMZUPDPOEFOTFPWFSUIFFYUFSOBMQMBUFTPGUIFVOJUBOEUPESJQPOUIF DFJMJOH6OJUTIPVMECFPQFSBUFEVOEFSUIFDPOEJUJPOTBTMJTUFEJOUIFBCPWFUBCMFBOEXJUIJO UIFMJNJUBUJPOPGXJOEWPMVNF8IFOUIFCVJMEJOHJTBDPODSFUFTUSVDUVSFFTQFDJBMMZJNNFEJ BUFMZBGUFSUIFDPOTUSVDUJPOIVNJEJUZUFOETUPSJTFFWFOJGUIFTQBDFPWFSUIFDFJMJOHJTOPU TVCTUJUVUFEJOQMBDFPGBEVDU*OTVDIPDDBTJPOJUJTOFDFTTBSZUPJOTVMBUFUIFFOUJSFVOJUXJUI HMBTTXPPMNN 6TFBXJSFOFUPSFRVJWBMFOUUPIPMEUIFHMBTTXPPMJOQMBDF C *UNBZSVOPVUUIFBMMPXBCMFMJNJUPGVOJUPQFSBUJPO&YBNQMF8IFOPVUEPPSBJSUFNQFSBUVSF JT ¡$ %# TVDUJPO BJS UFNQFSBUVSF JT ¡$8# BOE JU DPVME SFTVMU JO TVDI USPVCMFT BT DPNQSFTTPSPWFSMPBEFUD D 5IFSFJTBQPTTJCJMJUZUIBUUIFCMPXBJSWPMVNFNBZFYDFFEUIFBMMPXBCMFSBOHFPGPQFSBUJPO EVFUPUIFDBQBDJUZPGWFOUJMBUJPOGBOPSTUSFOHUIPGXJOECMPXJOHBHBJOTUFYUFSOBMBJSMPVWFS TPUIBUESBJOBHFGSPNCFIFBUFYDIBOHFSNBZGBMMUPSFBDIUIFESBJOQBOCVUMFBLPVUTJEF &YBNQMFESJQPOUPUIFDFJMJOH XJUIDPOTFRVFOUJBMXBUFSMFBLBHFJOUIFSPPN ԙ*GWJCSBUJPOEBNQJOHJTOPUDPOEVDUFECFUXFFOUIFVOJUBOEUIFEVDUBOECFUXFFOUIFVOJUBOE UIFTMBCWJCSBUJPOXJMMCFUSBOTNJUUFEUPUIFEVDUBOEWJCSBUJPOOPJTFNBZPDDVS"MTPWJCSBUJPO NBZCFUSBOTNJUUFEGSPNUIFVOJUUPUIFTMBC7JCSBUJPOEBNQJOHNVTUCFQFSGPSNFE #BEFYBNQMFPGEVDUXPSL 4USBQ"DDFTTPSZ 5JHIUFOJOHUPSRVF/rN I UP I UP I UP I UP I UP 1JQFDPWFS"DDFTTPSZ 5IFUIJDLOFTTPGJOTVMBUJPOTIPVMECFNNPSNPSF Ԟ%SBJOQJQF $BVUJPO ٨*OTUBMMUIFESBJOQJQFBDDPSEJOHUPUIFJOTUBMMBUJPONBOVBMJOPSEFSUPESBJOQSPQFSMZ *NQFSGFDUJPOJOESBJOJOHNBZDBVTFnPPEJOEPPSTBOEXFUUJOHUIFIPVTFIPMEHPPETFUD ٨%POPUQVUUIFESBJOQJQFEJSFDUMZJOUPUIFEJUDIXIFSFUPYJDHBTTVDIBTTVMGVSUIFPUIFSIBSNGVMBOE JOnBNNBCMFHBTJTHFOFSBUFE5PYJDHBTXPVMEnPXJOUPUIFSPPNBOEJUXPVMEDBVTFTFSJPVT EBNBHFUPVTFSTIFBMUIBOETBGFUZTPNFQPJTPOJOHPSEFmDJFODZPGPYZHFO *OBEEJUJPOJUNBZ DBVTFDPSSPTJPOPGIFBUFYDIBOHFSBOECBETNFMM ٨$POOFDUUIFQJQFTFDVSFMZUPBWPJEXBUFSMFBLBHFGSPNUIFKPJOU ٨*OTVMBUFUIFQJQFQSPQFSMZUPBWPJEDPOEFOTBUJPOESPQ ٨$IFDLJGUIFXBUFSDBOnPXPVUQSPQFSMZGSPNCPUIUIFESBJOPVUMFUPOUIFJOEPPSVOJUBOEUIFFOE PGUIFESBJOQJQFBGUFSJOTUBMMBUJPO ٨.BLFTVSFUPNBLFEFTDFOEJOHTMPQFPGHSFBUFSUIBOBOEEPOPUNBLFVQEPXOCFOEBOEPSUSBQ JOUIFNJEXBZ*OBEEJUJPOEPOPUQVUBJSWFOUPOUIFESBJOQJQF$IFDLJGXBUFSJTESBJOFEPVUQSPQFSMZGSPN UIFQJQFEVSJOHDPNNJTTJPOJOH"MTPLFFQTVGmDJFOUTQBDFGPSJOTQFDUJPOBOENBJOUFOBODF 8PSLQSPDFEVSF -PVWFSUP PVUEPPSBJS .BLFTVSFUPJOTFSUUIFESBJOIPTFUIFFOENPEFPGTPGU17$ UPUIFFOEPGUIFTUFQQBSUPG ESBJOTPDLFU "UUBDIUIFIPTFDMBNQUPUIFESBJOIPTFBSPVOENNGSPNUIFFOEBOEGBTUFOUIFTDSFX XJUIJONNMFGUUPUIFOVU ޓ٨%POPUBQQMZBEIFTJWFTPOUIJTFOE ޓ٨%POPUVTFBDFUPOFCBTFEBEIFTJWFTUPDPOOFDUUPUIFESBJOTPDLFU 'PSWFOUJMBUJPO ԝ3FGSJHFSBOUQJQF 71 1SFQBSFPOTJUF $BVUJPO 71 1SFQBSFPOTJUF ٨6TFUIFOFXSFGSJHFSBOUQJQF 1JQFDPWFSCJH 'PSJOTVMBUJPO "DDFTTPSZ ޓ8IFOSFVTJOHUIFFYJTUJOHQJQFTZTUFNGPS3PS3$QBZBUUFOUJPOUPUIFGPMMPXJOHJUFNT ޓ$IBOHFUIFnBSFOVUTXJUIUIFBUUBDIFEPOFT+*4DBUFHPSZ BOESFQSPDFTTUIFnBSFQBSUT ޓ%POPUVTFUIJOXBMMFEQJQFT %SBJOTPDLFU ٨6TFQIPTQIPSVTEFPYJEJ[FEDPQQFSBMMPZTFBNMFTTQJQF$5TQFDJmFEJO+*4) GPSSFGSJHFSBUJPOQJQFJOTUBMMBUJPO *ޓOBEEJUJPONBLFTVSFUIFSFJTOPEBNBHFCPUIJOTJEFBOEPVUTJEFPGUIFQJQFBOEOPIBSNGVM TVCTUBODFTTVDIBTTVMGVSPYJEFEVTUPSBDPOUBNJOBOUTUVDLPOUIFQJQFT ٨%POPUVTFBOZSFGSJHFSBOUPUIFSUIBO3" 4UBHFEJGnFSODFQBSU %SBJOTPDLFU ޓ6TJOHPUIFSSFGSJHFSBOUFYDFQU3"3FUD NBZEFHSBEFJOTJEFSFGSJHFSBUJPOPJM"OEBJSHFUUJOHJOUP SFGSJHFSBUJPODJSDVJUNBZDBVTFPWFSQSFTTVSFBOESFTVMUBOUJUNBZSFTVMUJOCVSTUJOHFUD ٨4UPSFUIFDPQQFSQJQFTJOEPPSTBOETFBMUIFCPUIFOEPGUIFNVOUJMUIFZBSFCSB[FEJOPSEFSUPBWPJEBOZEVTUEJSUPS XBUFSHFUUJOHJOUPQJQF0UIFSXJTFJUXJMMDBVTFEFHSBEBUJPOPGSFGSJHFSBUJPOPJMBOEDPNQSFTTPSCSFBLEPXOFUD ٨6TFTQFDJBMUPPMTGPS3SFGSJHFSBOU 1JQJOHXPSL 3FGSJHFSBOUQJQF NN 4FDUJPOXIFSFBUUBDIFE JOBTUSBJHIUMJOF 8IFODPOEVDUJOHQJQJOHXPSLNBLFTVSFUPBMMPXUIFQJQFT UPCFBMJHOFEJOBTUSBJHIUMJOFGPSBUMFBTUNNBTTIPXO JOUIFMFGUJMMVTUSBUJPO5IJTJTOFDFTTBSZGPSUIFESBJOQVNQ UPGVODUJPO – 138 – +PJOUGPS71 1SFQBSFPOTJUF 6OJU %SBJOIPTF %SBJOIPTF "DDFTTPSZ $MBNQ"DDFTTPSZ /PBEIFTJWFBMMPXFE 1JQFDPWFS'PSJOTVMBUJPO 1SFQBSFPOTJUF 1JQFDPWFSTNBMM 'PSJOTVMBUJPO "DDFTTPSZ 'BTUFOUIFTDSFXXJUIJONNMFGUUPUIFOVU )PTFDMBNQ %SBJOTPDLFU .FUBMQMBUF NN %SBJOIPTF '10 • PAC-SM-137 Ԟ%SBJOQJQFDPOUJOVFE Ԟ%SBJOQJQFDPOUJOVFE 1SFQBSFBKPJOUGPSDPOOFDUJOH71QJQFBEIFSFBOEDPOOFDUUIFKPJOUUPUIFESBJOIPTF UIFFOENBEFPGSJHJE17$ BOEBEIFSFBOEDPOOFDU71QJQFQSFQBSFPOTJUF ̪"TGPSESBJOQJQFBQQMZ71NBEFPGSJHJE17$XIJDIJTPOUIFNBSLFU ٨8IFOJOTUBMMJOHESBJOQJQFVTF71GPSUIFQJQFHPFTVQUIFDMPTFTUUPUIFVOJUBOE 71PSIJHIFSOVNCFSQSPEVDUGPSGBSUIFSQJQFT ٨.BLFTVSFUIBUUIFBEIFTJWFXJMMOPUHFUJOUPUIFTVQQMJFEESBJOIPTF *UNBZDBVTFUIFnFYJCMFQBSUCSPLFOBGUFSUIFBEIFTJWFJTESJFEVQBOEHFUTSJHJE ٨5IFnFYJCMFESBJOIPTFJTJOUFOEFEUPBCTPSCBTNBMMEJGGFSFODFBUJOTUBMMBUJPOPGUIFVOJU PSESBJOQJQFT*OUFOUJPOBMCFOEJOHFYQBOEJOHNBZDBVTFUIFnFYJCMFIPTFCSPLFOBOE XBUFSMFBLBHF %SBJOQVNQPQFSBUJPO ٤*ODBTFFMFDUSJDBMXJSJOHXPSLmOJTIFE ޓ%SBJOQVNQDBOCFPQFSBUFECZSFNPUFDPOUSPMMFSXJSFE 'ޓPSUIFPQFSBUJPONFUIPESFGFSUP0QFSBUJPOGPSESBJOQVNQJOUIFJOTUBMMBUJPONBOVBMGPSXJSJOH XPSL ٤*ODBTFFMFDUSJDBMXJSJOHXPSLOPUmOJTIFE %SBJOQVNQXJMMSVODPOUJOVPVTMZXIFOUIFEJQTXJUDIi48wPOUIFJOEPPSVOJU1$#JTUVSOFE0/UIF$POOFD UPS$/#JTEJTDPOOFDUFEBOEUIFOUIFQPXFSTVQQMZ7"$POUIFUFSNJOBMCMPDLԘBOEԙ JTUVSOFE0/ .BLFTVSFUPUVSO0''i48wBOESFDPOOFDUUIF$POOFDUPS$/#BGUFSUIFUFTU ԟ8JSJOHPVUQPTJUJPOBOEXJSJOHDPOOFDUJPO .BLFTVSFUPNBLFEFTDFOEJOHTMPQFPGHSFBUFSUIBOBOEEPOPUNBLFVQEPXOCFOE BOEPSUSBQJOUIFNJEXBZ ٨1BZBUUFOUJPOOPUUPHJWFTUSFTTPOUIFQJQFPOUIFJOEPPSVOJUTJEFBOETVQQPSUBOEmYUIF QJQFBTDMPTFQMBDFUPUIFVOJUBTQPTTJCMFXIFODPOOFDUJOHUIFESBJOQJQF ٨%POPUTFUVQBJSWFOU 5SBQQFEBJSXJMM HFOFSBUFOPJTFT /PUSBQ /PUUPVDIJOHUIFXBUFS *OTVMBUJPONBUFSJBM %FTDFOEJOHTMPQFHSFBUFSUIBO "TXJEFBTQPTTJCMF BCPVUNN ٨8IFOTIBSJOHBESBJOQJQFGPSNPSFUIBO POF VOJU MBZ UIF NBJO QJQF NN CFMPX UIF ESBJO PVUMFU PG UIF VOJU *O BEEJUJPOTFMFDU71PSCJHHFSTJ[FGPS NBJOESBJOQJQF 71PSCJHHFS %FTDFOEJOHTMPQFHSFBUFSUIBO *OTVMBUFUIFESBJOQJQF ٨#FTVSFUPJOTVMBUFUIFESBJOTPDLFUBOESJHJE17$QJQFJOTUBMMFEJOEPPSTPUIFSXJTFJUNBZ DBVTFEFXDPOEFOTBUJPOBOEXBUFSMFBLBHF ̪"GUFSESBJOBHFUFTUJNQMFNFOUBUJPODPWFSUIFESBJOTPDLFUQBSUXJUIQJQFDPWFSTNBMMTJ[F UIFO VTFUIFQJQFDPWFSCJHTJ[F UPDPWFSUIFQJQFDPWFSTNBMMTJ[F DMBNQTBOEQBSUPGUIFESBJO IPTFBOEmYBOEXSBQJUXJUIUBQFTUPXSBQBOENBLFKPJOUQBSUHBQMFTT %SBJOVQ $/5 $// $/) $/; $/4 $/7 $/5 $// $/) &BSUI 4IJFMEFEDPSE 4VQFSMZOLMJOF 4IJFMEFEDPSE $/; 3FNPUF DPOUSPMMFSMJOF $/3 .BYJNVNMPDBM ESBJOVQEJNFOTJPO $/7 3FNPUF DPOUSPMMFSMJOF *OOFSPVUFS DPOOFDUJOHMJOF &BSUI $MBNQGPSXJSJOHBUTJUF 4JOHMFVOJUXJSJOHDPOOFDUJPO *OEPPSQPXFSTPVSDFMJOF &BSUI .VMUJVOJUXJSJOHDPOOFDUJPO $MBNQGPSXJSJOHBUTJUF Ԡ$IFDLMJTUBGUFSJOTUBMMBUJPO _NN 3JHIUPWFSIFBE ٨$IFDLUIFGPMMPXJOHJUFNTBGUFSBMMJOTUBMMBUJPOXPSLDPNQMFUFE +PJOUGPS71MPDBMQSPDVSFNFOU 0UIFSXJTFUIFDPOTUSVDUJPOQPJOUNBLFTJUTBNFBTESBJOQJQFDPOTUSVDUJPO %SBJOUFTU $IFDLJG &YQFDUFEUSPVCMF 5IFJOEPPSBOEPVUEPPSVOJUTBSFmYFETFDVSFMZ 'BMMJOHWJCSBUJPOOPJTF *OTQFDUJPOGPSMFBLBHFJTEPOF *OTVGmDJFOUDBQBDJUZ *OTVMBUJPOXPSLJTQSPQFSMZEPOF 8BUFSMFBLBHF 8BUFSJTESBJOFEQSPQFSMZ 8BUFSMFBLBHF $POEVDUBESBJOUFTUBGUFSDPNQMFUJPOPGUIFFMFDUSJDBMXPSL %VSJOHUIFUSBJMNBLFTVSFUIBUESBJOnPXTQSPQFSMZUISPVHIUIFQJQJOHBOEUIBUOPXBUFS MFBLTGSPNDPOOFDUJPOT *ODBTFPGBOFXCVJMEJOHDPOEVDUUIFUFTUCFGPSFJUJTGVSOJTIFEXJUIUIFDFJMJOH #FTVSFUPDPOEVDUUIJTUFTUFWFOXIFOUIFVOJUJTJOTUBMMFEJOUIFIFBUJOHTFBTPO 4VQQMZWPMUBHFJTTBNFBTNFOUJPOFEJOUIFNPEFMOBNFQMBUF 1$#CVSOUPVUOPUXPSLJOHBUBMM 5IFSFJTNJTXJSJOHPSNJTDPOOFDUJPOPGQJQJOH 1$#CVSOUPVUOPUXPSLJOHBUBMM &BSUIXJSJOHJTDPOOFDUFEQSPQFSMZ &MFDUSJDTIPDL $BCMFTJ[FDPNQMZXJUITQFDJmFETJ[F 1$#CVSOUPVUOPUXPSLJOHBUBMM 1SPDFEVSFT "OZPCTUBDMFCMPDLTBJSnPXPOBJSJOMFUBOEPVUMFU *OTVGmDJFOUDBQBDJUZ 4VQQMZBCPVUDDPGXBUFSUPUIFVOJUUISPVHIUIFBJSPVUMFUCZVTJOHBGFFEXBUFSQVNQ $IFDLUIFESBJOXIJMFDPPMJOHPQFSBUJPO *OTFSUXBUFSTVQQMZIPTF GPSNNUP TVQQMZXBUFS *OTFSUIPTFGBDJOH UPXBSECPUUPN 3FNPWFHSPNNFU .BLFTVSFUP*OTUBMM JUCBDLBGUFSUFTU $IFDL ԡ5BQTFMFDUJPOPOCMPXFSVOJUXIFOUIFIJHIQFGPSNBODFmMUFSJTVTFE "UUBDIFEESBJOIPTFDMBNQ 1PVSXBUFSJOUPBDPOWFYKPJOU %SBJO .BJO QJQJOH VOJU %SBJOTJUVBUJPODBOCFDIFDLFEXJUIUSBOTQBSFOUTPDLFU *GUIFFMFDUSJDBMXPSLIBTOPUCFFODPNQMFUFEDPOOFDUBDPOWFY KPJOUJOUIFESBJOQJQFDPOOFDUJPOUPQSPWJEFBXBUFSJOMFU 5IFODIFDLJGXBUFSMFBLTGSPNUIFQJQJOHTZTUFNBOEUIBU ESBJOnPXTUISPVHIUIFESBJOQJQFOPSNBMMZ 0VUMJOFPGCPUUPNESBJOQJQJOHXPSL ٨*GUIFCPUUPNESBJOQJQJOHDBOCFEPOFXJUIB EFTDFOEJOHHSBEJFOU JUJTQPTTJCMFUP DPOOFDUUIFQJQFTBTTIPXOJOUIFESBXJOHCFMPX $POOFDUJOHQPSUPGUPQESBJOQJQF 4UBOEBSEIBSEQPMZWJOZM DIMPSJEFQJQFT *OTVMBUJOHNBUFSJBM 3VCCFSTUPQQFSUPCFSFNPWFE $"65*0/ *GUIFFYUFSOBMTUBUJDQSFTTVSFJT1BPSMFTTEPOPUTFUUIFGBOTQFFEUP)JHITQFFE *G)JHITQFFETFUUJOHJTEPOFBJSPVUMFUTQFFEGSPNJOEPPSVOJUXJMMJODSFBTFBOE XBUFSESPQNBZCFCMPXOPVUBOEXFUUIFDFJMJOHPSUIFGVSOJUVSF 1$CPBSE ٨6ODPVQMFUIFDPOOFDUPS$/3GPSUIFESBJONPUPS BTJMMVTUSBUFEJOUIFESBXJOHPOUIFSJHIU 'VODUJPOOVNCFS" 'VODUJPOBMDPOUFOU# 4FUUJOHDPOUFOU$ %FGBVMUTFUUJOH 4UBOEBSE ٤ 'BO4QFFE4FU )JHI4QFFE 4UBOEBSE5BQ 4UBUJD 1SFTTVSF )JHI4QFFE5BQ 6ODPVQMJOHUIFESBJONPUPSDPOOFDUPS /PUF*GUIFVOJUJTSVOXJUIUIFDPOOFDUPSDPVQMFE ESBJOXBUFSXJMMCFEJTDIBSHFEGSPNUIFVQQFSESBJO QJQFKPJOUDBVTJOHBXBUFSMFBL 5IFGBOUBQTGBDUPSZTFUUJOHJTi4UBOEBSEw*GZPVXBOUUPDIBOHFJUUPUIFIJHITUBUJDQSFTTVSFTFUUJOH ZPVDBOBWBJMZPVSTFMGPGUIFGPMMPXJOHUXPNFUIPET6TFPOFPGUIFUXPNFUIPETUPTFUUIFGBOUBQ .BLFTVSFUPQFSGPSNUIFGVODUJPOBMTFUUJOHXJUISFNPUFDPOUSPMMFS 4FMFDU<*6'6/$5*0/>JOUIFGVODUJPOBMTFUUJOHNPEFBOEDIBOHFUIFGVODUJPOOVNCFS<> <'"/41&&%4&5> 'PSPQFSBUJPONFUIPESFGFSUPUIFVTFSTNBOVBMPGUIFSFNPUFDPOUSPMMFS 6/*51B $POOFDUJOHQPSUPGCPUUPNESBJOQJQFT 1PXFSTPVSDFTJEF 4JHOBMTJEF UFSNJOBMCMPDL UFSNJOBMCMPDL $/" $/4 ٨5IFQPTJUJPOGPSESBJOQJQFPVUMFUDBOCFSBJTFEVQUPNNBCPWFUIFDFJMJOH6TFFMCPXTGPS JOTUBMMBUJPOUPBWPJEPCTUBDMFTJOTJEFDFJMJOH*GUIFIPSJ[POUBMESBJOQJQFJTUPPMPOHCFGPSFWFSUJDBMQJQF UIFCBDLnPXPGXBUFSXJMMJODSFBTFXIFOUIFVOJUJTTUPQQFEBOEJUNBZDBVTFPWFSnPXPGXBUFSGSPNUIF ESBJOQBOPOUIFJOEPPSVOJU*OPSEFSUPBWPJEPWFSnPXLFFQUIFIPSJ[POUBMQJQFMFOHUIBOEPGGTFUPGUIF QJQFXJUIJOUIFMJNJUTIPXOJOUIFmHVSFCFMPX %SBJOIPTF 4JHOBMTJEF UFSNJOBMCMPDL $/% $/, 1PXFSTPVSDFTJEF UFSNJOBMCMPDL $/% $/, $/, /PCVNQ "JSWFOU $/" N_N 4VQQPSUJOHNFUBM ٨&MFDUSJDBMJOTUBMMBUJPOXPSLNVTUCFQFSGPSNFEBDDPSEJOHUPUIFJOTUBMMBUJPONBOVBMCZBO FMFDUSJDBMJOTUBMMBUJPOTFSWJDFQSPWJEFSRVBMJmFECZBQPXFSQSPWJEFSPGUIFDPVOUSZBOECF FYFDVUFEBDDPSEJOHUPUIFUFDIOJDBMTUBOEBSETBOEPUIFSSFHVMBUJPOTBQQMJDBCMFUPFMFDUSJDBM JOTUBMMBUJPOJOUIFDPVOUSZ #FTVSFUPVTFBOFYDMVTJWFDJSDVJU ٨6TFTQFDJmFEDPSEGBTUFOUIFXJSJOHUPUIFUFSNJOBMTFDVSFMZBOEIPMEUIFDPSETFDVSFMZJO PSEFSOPUUPBQQMZVOFYQFDUFETUSFTTPOUIFUFSNJOBM ٨%POPUQVUCPUIQPXFSTPVSDFMJOFBOETJHOBMMJOFPOUIFTBNFSPVUF*UNBZDBVTFNJTDPNNV OJDBUJPOBOENBMGVODUJPO ٨#FTVSFUPEP%UZQFFBSUIXPSL ٨'PSUIFEFUBJMTPGFMFDUSJDBMXJSJOHXPSLTFFBUUBDIFEJOTUSVDUJPONBOVBMGPSFMFDUSJDBMXJSJOH XPSL 3FNPWFBMJEPGUIFDPOUSPMCPYTDSFXT )PMEFBDIXJSJOHJOTJEFUIFVOJUBOEGBTUFOUIFNUPUFSNJOBMCMPDLTFDVSFMZ 'JYUIFXJSJOHXJUIDMBNQT *OTUBMMUIFSFNPWFEQBSUTCBDLUPPSJHJOBMQMBDF TF 'V 'PSESBJONPUPS DPOOFDUPS$/3CMVF PJD012D052 " – 139 – SAFETY PRECAUTIONS This instruction manual illustrates the method of installing an indoor unit. For electrical wiring work, please see instructions set out on the backside. For outdoor unit installation and refrigerant piping, please refer to the installation manual that comes with your outdoor unit. A wired remote control unit is supplied separately as an optional part. – 140 – z Execute proper grounding. Do not connect the ground wire to a gas pipe, water pipe, lightning rod or a telephone ground wire. Improper placement of ground wires can result in electric shock. z Do not put the drain pipe directly into the ditch where toxic gas such as sulfur is generated. Toxic gas would flow into the room. Also, this may cause corrosion of indoor unit, and malfunction or refrigerant leakage. z Be sure to bring back the packing material, form polystyrene, band and vinyl back etc., of the indoor and/or outdoor units after complete the installation work, and then implement appropriate measures such as breaking them. z When setting up or moving the location of the air conditioner, do not mix air etc. or anything other than the designated refrigerant (R410A) within the refrigeration cycle. Rupture and injury caused by abnormal high pressure can result from such mixing. z Do not processing, splice the power cord, or share a socket with other power plugs. This may cause fire or electric shock due to defecting contact, defecting insulation and over-current etc. z Do not bundling, winding or processing for the power cord. Or, do not deforming the power plug due to tread it This may cause fire or heating. z Do not vent R410A into the atomosphere:R410A is a fluor inated greenhouse gas. covered by the Kyoto Protocol with a Groval Warming Potential (GWP) =1975 z To disconnect the appliance from the mains supply this appliance must be connected to the mains by means of a circuit breaker or a switch (use a recognized 16A) with a contact separation of at least 3mm. z The appliance shall be installed in accordance with national wiring regulations. z When a plug is connected to the power cord, a plug conforming to the IEC60884-1 standard must be used. z This system should be applied to places as households, residences and the like. Application to inferior environment such as engineering shop could cause equipment malfunction. z Please entrust installation to either the company which sold you the equipment or to a professional contractor. Defects from improper installations can be the cause of water leakage, electric shocks and fires. z Execute the installation accurately, based on following the installation manual. Again, improper installations can result in water leakage, electric shocks and fires. z For installation, confirm that the installation site can sufficiently support heavy weight. When strength is insufficient, injury can result from a falling of the unit. z For electrical work, please see that a licensed electrician executes the work while following the safety standards related to electrical equipment, and local regulations as well as the installation instructions, and that only exclusive use circuits are used. Insufficient power source circuit capacity and defective installment execution can be the cause of electric shocks and fires. z Accurately connect wiring using the proper cable, and insure that the external force of the cable is not conducted to the terminal connection part, through properly securing it. Improper connection or securing can result in heat generation or fire. z Take care that wiring does not rise upward, and accurately install the lid/service panel. It's improper installation can also result in heat generation or fire. z Always use accessory parts and authorized parts for installation construction. Using parts not authorized by this company can result in water leakage, electric shock, fire and refrigerant leakage. z Ventilate the work area when refrigerant leaks during the operation. Coming in contact with fire, refrigerant could generate toxic gas. z Confirm after the foundation construction work that refrigerant does not leak. If coming in contact with fire of a fan heater, a stove or a movable cooking stove, etc., refrigerant leaking in the room could generate toxic gas. z Turn off the power source during working on the inside of the unit such as servicing or installing work. This may cause electric shock. z Use only pipe, flare nut and tools that have been designed to operate with R410A. Using existing parts (R22) may cause the unit failure, even as due to serious accident such as explosion of the cooling cycle or injury etc. z For pump down work, stop the compressor before removing the refrigerant pipe. If the refrigerant pipe is removed when the compressor is in operation with the service valves open (liquid side and gas side), air would be mixed in the refrigerant circuit and this may cause explosion and injuries due to abnormal high pressure in the cooling cycle. z Connect the pipes for refrigerant circuit securely in installation work before compressor is operated If the compressor is operated when the service valve is open without connecting the pipe, this may cause frostbite and injuries due to refrigerant leakage rapidly. Also, the unit is absorbed the air etc., this may cause explosion and injuries due to abnormal high pressure in the cooling cycle. z Tighten the flare nut by torque wrench with specified method. If the flare nut were tightened with excess torque, this may cause burst and refrigerant leakage after a long period, and then, this may cause generate the harmful substance due to touch the flammable materials. z Make sure there is no dust or clogging on both plug and socket nor loose connection of the socket before plugging of the power plug. Then, the power plug must be inserted tightly. Accumulation of dust, clogging on the socket or plug, or loose installation of the socket may cause electric shock and fire. Replace the socket if it is loose. z Do not open the service valves (liquid side and gas side) until refrigerant piping construction, air-tightness test and evacuation are completed This may cause frostbite and injuries due to refrigerant leakage rapidly. Also, if the refrigerant gas leakage occurs during installing work, stop the work such as brazing work and then ventilation of the room. This may cause generate the toxic gas due to touch the flammable materials. WARNING Observe instructions with great care Provide proper earthing c The system should be applied to places as households, residences and the like. c The equipment shall be installed in accordance with national wiring regulations. c The connection to the fixed wiring of the mains supply must be made via a double pole isolating switch with a contact gap of at least 3mm in each pole. c When the outdoor unit has a possibility of being overturned or being displaced and fall from its original installation position, the outdoor unit should be fixed in its position by use of anchor bolts or wires. CAUTIONS FOR INSTALLATION Strictly prohibited z Symbols which appear frequently in the text have the following meaning z Do not install the unit where there is a concern about leakage of combustible gas. The rare event of leaked gas collecting around the unit could result in an outbreak of fire. z Do not touch the suction or aluminum fin on the outdoor unit This may cause injury. z Do not install the outdoor unit where is likely to be a nest for small animals Small animals may come into the electronic components and may cause breakdown and fire. Also,instruct the user to keep the surroundings clean. z Do not install the outdoor unit at the place where fan airflow falls on the garden tree etc. This may cause damage to the garden tree etc., due to the fan airflow. z Do not put anything on the outdoor unit and operating the unit. This may cause damage the objects or injury due to falling to the object. z Please avoid installing this unit in the locations where oil splashes and moisture are abundant (e.g., kitchens, mechanical workshops) or where the outside air is likely to flow in. These locations may cause corrosion and lower performance of the heat exchanger and cause damage to plastic parts. z Please avoid installing this unit in the locations with corrosive gases (such as sulfurous acid gas), inflammable gases (such as thinner, gasoline) and areas where there are possibilities of gas accumulation or where a volatile inflammable material is handled. These locations can cause corrosion to the heat exchanger and damage to plastic parts. Also, the inflammable gas could cause fire. z Please avoid installing this unit in the vicinity of equipment generating electromagnetic waves such as hospital equipment or equipment generating high-frequency waves. A failure to observe this instruction may result in controller performance errors due to noise generation. z Please avoid installing and using this unit in a place where it is subject to sea breezes (coastal area). Installation in such a place may result in the corrosion of exterior panels and the heat exchanger. z Do not place the remote control at locations that receives direct sunlight. This may cause malfunction and deformation. z Spatters from welding, etc., if hit the unit, can damage (pinhole) its drain pan and other components and cause a water leak. Care must be taken in performing a welding operation near this unit and take necessary precautions to prevent spatters from entering this unit. z For installation work, be careful not to get injured with the heat exchanger, piping flare portion or screws etc. z For the drain pipe, follow the installation manual to insure that it allows proper drainage and thermally insulate it to prevent condensation. Inadequate plumbing can result in water leakage and water damage to interior items. z The installation of an earth leakage breaker is necessary depending on the established location of the unit. Not installing an earth leakage breaker may result in electric shock. z When perform the air conditioner operation (cooling or drying operation) in which ventilator is installed in the room. In this case, using the air conditioner in parallel with the ventilator, there is the possibility that drain water may backflow in accordance with the room lapse into the negative pressure status. Therefore, set up the opening port such as incorporate the air into the room that may appropriate to ventilation (For example; Open the door a little). In addition, just as above, so set up the opening port if the room lapse into negative pressure status due to register of the wind for the high rise apartment etc. z Secure the regulated space for inspection and maintenance When it is not possible to keep enough space, this may cause injury due to falling from the installation place. z To prevent the falling, institute the everlasting ladder and handrail etc., to the aisle when installing the outdoor unit in the location with rooftop or altitude. Or, for surrounding of the outdoor unit, institute the fence and handrail etc., to the aisle to prevent the falling. z Performing the heat insulation and condensation of the refrigerant piping If the heat insulation and condensation of the refrigerant piping is not correctly, this may cause the water leakage, dew dropping and household wetting etc. z Be careful not to injury due to damage of the unit installing work when leaving of the packaging materials. CAUTION z Please read these "Safety Precautions" first then accurately execute the installation work. z For installing qualified personnel, take precautions in respect to themselves by using suitable protective clothing, groves, etc., and then perform the installation works. z Though the precautionary points indicated herein are divided under two headings, WARNING section. However, there is also a possibility of CAUTION , those points which are related to the strong possibility of an installation done in error resulting in death, serious injury or environmental pollution are listed in the WARNING and serious consequences in relationship to the points listed in the CAUTION section as well. In either case, important safety related information is indicated, so by all means, properly observe all that is mentioned. z Please pay attention not to fall down the tools, etc. when installing the unit at the high position. z After completing the installation, along with confirming that no abnormalities were seen from the operation tests. Please explain operating methods as well as maintenance methods to the user (customer) of this equipment, based on the user's manual. Moreover, ask the customer to keep this sheet together with the user's manual. z If unusual noise can be heard during operation, consult the dealer. RKY012A007 (6) Wall mounted type (SRK) '10 • PAC-SM-137 1 4 2 Remote control holder Tapping screws (for installation board 4dia. by 25mm) ③ ④ 2 1 Filter holders (Attached to the front panel of indoor unit) Insulation (#486 50 x 100 t3) ⑦ ⑧ ⑨ 1 Piping cover (for insulation of connection piping) Hammer Spanner wrench Torque wrench Hole core drill (65mm in diameter) Wrench key (Hexagon) [4m/m] 5 6 7 8 9 13 12 11 10 Tape measure 4 Pipe bender ( Gauge for projection adjustment Used when flare is made by using conventional flare tool Flaring tool set ) specifically ( Designed ) for R410A Designed specifically Gas leak detector ( ) for R410A ) Saw 3 ( Knife 2 14.0 ~ 61.0N•m (1.4 ~ 6.1kgf•m) Plus headed driver 1 Necessary tools for the installation work 1 Drain hose (extention hose) 1 Inclination plate 1 1 Putty 1 Sleeve Q'ty Sealing plate Option parts 2 Air-cleaning filters ⑥ 2 Wood screw (for remote control switch holder 3.5(mm). by 16mm) Battery [R03(AAA,Micro) 1.5V] ⑤ 1 Wireless remote control ② 1 Q'ty Installation board (Attached to the rear of the indoor unit) ① Standard accessories (Installation kit) Accessories for indoor unit Mounting board Max.10 Nut (M6) the standard hole as the center. cAdjust so the board will be level by turning the board with Standard hole direction is to be conducted with four screws in a temporary tightened state. cAdjustment of the installation board in the horizontal 5 cm m from inimum the w all 65 5 Outdoor side b Top c Hold the bottom of the piping and fix direction before stretching it and shaping it. Drain hose Pipings c Tape only the portion that goes through the wall. c Always tape the wiring with the piping. Taping of the exterior In case of piping in the right rear direction Shaping of pipings Thicknese of the wall + 1.5cm Indoor side b Turn to tighten Outdoor side a c Installed state c Remove the screw and drain hose, making it rotate. Right-hand-side piping 35 54 Space for service 100 120 220 Downward Left rear Left Left downward Rear Right Piping is possible in the rear, left, left rear, left downward, right or downward direction. Piping hole (ø65) Piping for Gas 491.1 Piping for Liquid 559.1 Drain hose (ø16) 520.8 35 Indoor unit Installation board 650 450 Piping hole (ø65) 4. Connect the drain hose. Piping in the right direction 58 220 Space for service Piping for Liquid (20 to 60 type) : ø6.35 Piping for Gas (20 to 35 type) : ø9.52 (50 to 60 type) : ø12.7 Piping in the right rear direction 3. Insert the drain cap. 50 120 INSTALLATION SPACE (INDOOR UNIT)(FRONT VIEW) Relation between setting plate and indoor unit Wood screws Remote control holder Wireless remote control Sleeve (sold separately) Installation board 1 0 cm m from inimum the w all 6.5 cm minimum from the ceiling c Remove it with hand or c Insert the drain cap which was removed c Insert the drain hose securely, pilers. at procedure “2” securely using a making rotate. And install the hexagonal wrench etc. screw. Note: Be careful that If it is not Inserted Note: Be careful that If it is not securely, water leakage may Inserted securely, water occur. leakage may occur. 1. Remove the drain hose. 2. Remove the drain cap. [Drain hose changing procedures] Piping in the left direction Piping in the left rear direction Left-hand-side piping z Matters of special notice when piping from left or central/rear of tha unit. [Top view] c In case of rear piping draw out, cut off the lower and the right side portions of the sleeve collar. Installing the support of piping c Drill a hole with whole core drill. Indoor side When drilling the wall that contains a metal lath, wire lath or metal plate, be sure to use pipe hole sleeve sold separately. Drilling of holes and fixture of sleeve (Option parts) Mounting board Bolt (M6 12) Fixing on concrete wall Use of nut anchor Use of bolt anchor Mating mark for level surface Level position (2 locations) 450 Look for the inside wall structures (Intersediats support or pillar and finally install the unit after level surface has been checked.) Installation of Installation board INSTALLATION OF INDOOR UNIT c A place where the air conditioner can be received the signal surely during operating the wireless remote control. c Places where there is no affected by the TV and radio etc. c Do not place where exposed to direct sunlight or near heat devices such as a stove. Wireless remote control c Where there is no obstructions to the air flow and where the cooled and heated air can be evenly distributed. c A solid place where the unit or the wall will not vibrate. c A place where there will be enough space for servicing. (Where space mentioned below can be secured) c Where wiring and the piping work will be easy to conduct. c The place where receiving part is not exposed to the direct rays of the sun or the strong rays of the street lighting. c A place where it can be easily drained. c A place separated at least 1m away from the television or the radio. (To prevent interference to images and sounds.) c Places where this unit is not affected by the high frequency equipment or electric equipment. c Avoid installing this unit in place where there is much oil mist. c Places where there is no electric equipment or household under the installing unit. Indoor unit (Install at location that meets the following conditions, after getting approval from the customer) 49 222.5 48 c Before installation check that the power supply matches the air conditioner. 65 Space for service SELECTION OF INSTALLATION LOCATION 7.7 48 295.7 5.6 – 141 – 15 Space for service BEFORE INSTALLATION '10 • PAC-SM-137 Wall Indoor unit Installation borad Latch (2 locations) Installation Steps 2 Gently push the lower part to secure the unit. 1 Pass the pipe through the hole in the wall, and hook the upper part of the indoor unit to the installation board. Press Remove – 142 – (Do not turn) Liquid side Gas side Dimension A Liquid side ø6.35 : 9.1 (mm) Gas side ø9.52 : 13.2 (mm) ø12.7 : 16.6 (mm) Position it so that the slit area faces upward. Use an attached insulation pad for heat insulation. Do not apply refrigerating machine oil to the flared surface. 0.0 - 0.5 0.0 - 0.5 0.0 - 0.5 Clutch type flare tool for R410A Clamp Wood screw Drain hose Outer tape Connection wiring, Earth wiring Refrigerant piping Finishing work and fixing c Fitting ① Do remove the air filter. ② Cover the body with the front panel. ③ Fit the 4 latches in the upper section. ④ Tighten the 5 set screws. ⑤ Fit the air filter. ⑥ Fit the air input panel. How to remove and fit the front panel Copper pipe Wavy The gap to the ground is 5 cm or less. The drain hose tip is in the gutter. 1.0 - 1.5 1.0 - 1.5 2.0 - 2.5 1.5 - 2.0 Conventional (R22) flare tool Clutch type Wing nut type 1.0 - 1.5 1.5 - 2.0 Set screws Cover the exterior portion with outer tape and shape the piping so it will match the contours of the route that the piping to take. Also fix the wiring and pipings to the wall with clamps. latch Do not apply excess torque to the flared nuts. Otherwise, the flared nuts may checkdepending. CAUTION When it is exposed indoor. Extended drain hose Measurement B (mm) Drain hose Use a flare tool designed for R410A or a conventional flare tool. Please note that measurement B (protrusion from the flaring block) will vary depending on the type of a flare tool in use. If a coventional flare tool is used, please use a copper pipe gauge or a similar instrument to check protrusion so that you can keep measurement B to a correct value. ø12.7 ø9.52 ø6.35 Copper pipe diameter c Removing ① Remove the air inlet panel. ② Remove the 5 set screws. ③ Remove the 4 latches in the upper section. ④ Move the lower part of the panel forward and push upwards to remove. Flaring block Measurement B z Flaring work Open/close and detachment/attachment of the air inlet panel z Cover the indoor unit’s flare-connected joints, after they are checked for a gas leak, with an indoor unit heat insulating material and then wrap them with a tape with an attached insulation pad placed over the heat insulating material’s slit area. Vinyl tape Cover the coupling with insulator and then cover it with tapes. Insulation of the connection portion then flared the pipes. c Install the removed flared nuts to the pipes to be connected, A CAUTION The drain hose tip is in water. Odor from the gutter drainage is all right. Otherwise water leak may occur. Wall CAUTION Go through all installation steps and check if the Pipe accommodating section Gutter c Pour water to the drain pan located under the heat exchanger, and ensure that the water is discharged outdoor. c When the extended drain hose is indoor, always use a shield pipe (to be arranged by the user) and ensure it is thermally insulated Shield pipe Higher than specified c Arrange the drain hose in a downward angle c Avoid the following drain piping. Drainage Since this air conditioner has been designed to collect dew drops on the rear surface to the drain pan, do not attach the power cord above the gutter. c To open, pull the panel at both ends of lower part and release latches, then pull up the panel until you feel resistance. (The panel stops at approx. 60 open position) c To close, hold the panel at both ends of lower part to lower downward and push it slightly until the latch works. c To remove, pull up the panel to the position shown in right illustration and pull it toward you. c To install, insert the panel arm into the slot on the front panel from the position shown in right illustration, hold the panel at both ends of lower part, lower it downward slowly, then push it slightly until the latch warks. Liquid side (ø6.35) : 14.0 - 18.0 N·m (1.4 - 1.8 kgf·m) Gas side (ø9.52) : 34.0 - 42.0 N·m (3.4 - 4.2 kgf·m) (ø12.7) : 49.0 - 61.0 N·m (4.9 - 6.1 kgf·m) c Connect the pipes on both liquid and gas sides. c Tighten the nuts to the following torque. Indoor Connection c Remove the flared nuts. (on both liquid and gas sides) (Do not turn) Indoor Keep the openings of the pipes covered with tapes etc. to prevent dust, sand, etc. from entering them. 90 ± 0.5° Preparation The marked portion of the indoor unit base lower latch. ① Push up at the marked portion of the indoor unit base lower latch, and slightly pull it toward you. (both right and left hand sides) (The indoor unit base lower latch can be removed from the installation board) ② Push up the indoor unit upward. So the indoor unit will be removed from the installation board. z How to remove the indoor unit from the installation board CONNECTION OF REFRIGERANT PIPINGS Indoor unit base lower latch Installation borad Fixing of indoor unit '10 • PAC-SM-137 CAUTION RNR4G1.5 (example) or 245IEC57 Harmonized cable type 300/500 volts Natural-and/or synth, rubber wire insulation Polychloroprene rubber conductors insulation Stranded core Number of conductors One conductor of the cable is the earth conductor (yellow/green) 1.5 Section of copper wire (mm2) H05 H 05 R N R 4or5 G Use cables for interconnection wiring to avoid loosening of the wires. CENELEC code for cables Required field cables. In case of faulty wiring connection, the indoor unit stops, and then the run lamp turns on and the timer lamp blinks. – 143 – ⑥ Battery Cover ⑤ Wood screw 3.5 16 ② Wireless remote control 䂾Conventionally, operate the remote control switch by holding in your hand. 䂾Avoid installing it on a clay wall etc. Fixing to pillar or wall Gas side : Fully open the gas valve Carry out cooling operation . (If indoor temperature is low, operate forced cooling operation.) ③ After low pressure gauge become 0.01MPa, stop cooling operation and close the gas valve. <How to pump down> ① Connect charge hose to service port of outdoor unit. ② Liquid side : Close the liquid valve with hexagon wrench key. outdoor unit when the pipes are removed from the unit. c In order to protect the environment, be sure to pump down (recovery of refrigerant). c Pump down is the method of recovering refrigerant from the indoor unit to the Unit ON/OFF button Forced cooling operation Turn on a power supply again after a while after turn off a power supply. Then press continually the ON/OFF button 5 seconds or more. HOW TO RELOCATE OR DISPOSE OF THE UNIT Do not use new and old batteries together. CAUTION Mounting method of battery INSTALLATION OF REMOTE CONTROL SWITCH ① ② ③ ④ Open the air inlet panel. Remove the service panel. Remove the wiring clamp Connect the connecting wire securely to the terminal block. 1 ) Connect the connection wire securely to the terminal block. If the wire is not affixed completely, contact will be poor, and it is dangerous as the terminal block may heat up and catch fire. 2 ) Take care not to confuse the terminal numbers for indoor and outdoor connections. 3 ) Fix the connection wire using the wiring clamp. ⑤ Fix the connecting wire by wiring clamp. ⑥ Attach the service panel. ⑦ Close the air inlet panel. Mounting of connecting wires Preparation of indoor unit ELECTRICAL WIRING WORK Air-cleaning filter Filter holder 1. Open the air inlet panel and remove the air filters. 2. Install the filter holders, with the air-cleaning filters installed in the holders. In the air conditioner. • Each air-cleaning filter can be installed in the left or right filter holder. 3. Install the air filters and close the inlet panel. Operation of the unit has been explained to the customer. (Three-minutes restart preventive timer) When the air conditioner is restarted or when changing the operation, the unit will not start operating for approximately 3 minutes. This is to protect the unit and it is not a malfunction. In connecting an interface, connect to the respective terminal securely with the connection harness supplied with an optional “Interface connection kit SC-BIKN-E” and fasten the connection harness onto the indoor control box with the clamp supplied with the kit. For more details, please refer to the user's manual of your “Interface connection kit SC-BIKN-E”. ① Remove the front panel and lid of control. ② There is a terminal (respectively marked with CNS) for the indoor control board. CONCERNING TERMINAL CONNECTION FOR AN INTERFACE Air conditioning operation is normal. No abnormal noise. Water drains smoothly. Protective functions are not working. The remote control is normal. Test run The power supply voltage is correct as the rating. No gas leaks from the joints of the operational valve. Power cables and crossover wires are securely fixed to the terminal board. Operational valve is fully open. The pipe joints for indoor and outdoor pipes have been insulated. After installation Check the following points again after completion of the installation, and before turning on the power. Conduct a test run again and ensure that the unit operates properly. At the same time, explain to the customer how to use the unit and how to take care of the unit following the user's manual. INSTALLATION TEST CHECK POINTS Clamp Terminal block Service panel Installing the air-cleaning filters '10 • PAC-SM-137 '10 • PAC-SM-137 PJA012D729A 5.2 Instullation of wired remote controller Read together with indoor unit's installation manual. WARNING Fasten the wiring to the terminal securely and hold the cable securely so as not to apply unexpected stress on the terminal. Loose connection or hold will cause abnormal heat generation or fire. Make sure the power supply is turned off when electric wiring work. Otherwise, electric shock, malfunction and improper running may occur. CAUTION DO NOT install the remote controller at the following places in order to avoid malfunction. (1) Places exposed to direct sunlight (2) Places near heat devices (3) High humidity places (4) Hot surface or cold surface enough to generate condensation (5) Places exposed to oil mist or steam directly (6) Uneven surface DO NOT leave the remote controller without the upper case. In case the upper cace needs to be detached, protect the remote controller with a packaging box or bag in order to keep it away from water and dust. Accessories Prepare on site Remote controller, wood screw (ø3.5 16) 2 pieces Remote controller cord (2 cores) the insulated thickness in 1mm or more. [In case of embedding cord] Erectrical box, M4 screw (2 pieces) [In case of exposing cord] Cord clamp (if needed) Installation procedure Open the cover of remote controller , and remove the screw under the buttons without fail. Remove the upper case of remote controller. Insert a flat-blade screwdriver into the dented part of the upper part of the remote controller, and wrench slightly. Screw [In case of embedding cord] Embed the erectrical box and remote controller cord beforehand. Controller cord Erectrical box (Prepare on site) Prepare two M4 screws (recommended length is 12-16mm) on site, and install the lower case to erectrical box. Choose either of the following two positions in fixing it with screws. Upper part Upper part Lower case Wiring oulet Lower part Lower case Tighten the screws after cutting off the thin part of screw mounting part. Lower part Wiring oulet Connect the remote controller cord to the terminal block. Connect the terminal of remote controller (X,Y) with the terminal of indoor unit (X,Y). (X and Y are no polarity) Install the upper case as before so as not to catch up the remote controller cord, and tighten with the screws. [In case of exposing cord] You can pull out the remote controller cord from left upper part or center upper part. Cut off the upper thin part of remote controller lower case with a nipper or knife, and grind burrs with a file etc. M4 screw 2 (Prepare on site) The thin part Upper Lower case Lower Upper Lower case Install the lower case to the flat wall with attached two wooden screws. Lower – 144 – A '10 • PAC-SM-137 Connect the remote controller cord to the terminal block. Connect the terminal of remote controller (X,Y) with the terminal of indoor unit (X,Y). (X and Y are no polarity) Wiring route is as shown in the right diagram depending on the pulling out direction. Sheath Upper Upper case Board Lower Sheath Upper Board Lower Wiring In case of pulling out from upper left Upper case Wiring In case of pulling out from upper center The wiring inside the remote controller case should be within 0.3mm2 (recommended) to 0.5mm2. The sheath should be peeled off inside the remote controller case. The peeling-off length of each wire is as below. Pulling out from upper left Pulling out from upper center X wiring : 215mm X wiring : 170mm Y wiring : 195mm Y wiring : 190mm The peeling-off length of sheath Install the upper case as before so as not to catch up the remote controller cord, and tighten with the screws. In case of exposing cord, fix the cord on the wall with cord clamp so as not to slack. Installation and wiring of remote controller Wiring of remote controller should use 0.3mm2 2 core wires or cables. (on-site configuration) Maximum prolongation of remote controller wiring is 600 m. If the prolongation is over 100m, change to the size below. But, wiring in the remote controller case should be under 0.5mm2 . Change the wire size outside of the case according to wire connecting. Waterproof treatment is necessary at the wire connecting section. Be careful about contact failure. 100 - 200m.........................0.5mm2 2 cores Under 300m .......................0.75mm2 2 cores Under 400m .......................1.25mm2 2 cores Under 600 500m .......................2.0mm2 2 cores Master/ slave setting when more than one remote controllers are used A maximum of two remote controllers can be connected to one indoor unit (or one group of indoor units.) Switch Indoor units SW1 Setting Contents M Master remote controller S Slave remote controller Remote controller cord (no polarity) Upper Master Remote controller SW1 "Master" Remote controller SW1 "Slave" Slave Board Lower Set SW1 to "Slave" for the slave remote controller. It was factory set to "Master" for shipment. Note: The setting "Remote controller thermistor enabled" is only selectable with the master remote controller in the position where you want to check room temperature. The air conditioner operation follows the last operation of the remote controller regardless of the master/ slave setting of it. The indication when power source is supplied When power source is turned on, the following is displayed on the remote controller until the communication between the remote controller and indoor unit settled. Master remote controller : " " Slave remote controller : " " At the same time, a mark or a number will be displayed for two seconds first. This is the software's administration number of the remote controller, not an error cord. The left mark is only an example. Other marks may appear. When remote controller cannot communicate with the indoor unit for half an hour, the below indication will appear. Check wiring of the indoor unit and the outdoor unit etc. – 145 – '10 • PAC-SM-137 The range of temperature setting When shipped, the range of set temperature differs depending on the operation mode as below. Heating : 16~30˚C (55~86˚F) Except heating (cooling, fan, dry, automatic) : 18~30˚C (62~86˚F) Upper limit and lower limit of set temperature can be changed with remote controller. Upper limit setting: valid during heating operation. Possible to set in the range of 20 to 30˚C (68 to 86˚F). Lower limit setting: valid except heating (automatic, cooling, fan, dry) Possible to set in the range of 18 to 26˚C (62 to 79˚F). When you set upper and lower limit by this function, control as below. 1. When TEMP RANGE SET, remote controller function of function setting mode is "INDN CHANGE" (factory setting), If upper limit value is set During heating, you cannot set the value exceeding the upper limit. If lower limit value is set During operation mode except heating, you cannot set the value below the lower limit. 2. When TEMP RANGE SET, remote controller function of function setting mode is "NO INDN CHANGE" If upper limit value is set During heating, even if the value exceeding the upper limit is set, upper limit value will be sent to the indoor unit. But, the indication is the same as the temperature set. If lower limit value is set During except heating, even if the value lower than the lower limit is set, lower limit value will be sent to the indoor unit. But, the indication is the same as the temperature set. How to set upper and lower limit value 1. Stop the air-conditioner, and press (SET) and (MODE) button at the same time for over three seconds . The indication changes to "FUNCTION SET ". 2. Press button once, and change to the "TEMP RANGE " indication. 3. Press (SET) button, and enter the temperature range setting mode. 4. Select "UPPER LIMIT " or "LOWER LIMIT " by using button. 5. Press (SET) button to fix. 6. When "UPPER LIMIT " is selected (valid during heating) Indication: " SET UP" "UPPER 30˚C " Select the upper limit value with temperature setting button . Indication example: "UPPER 26˚C " (blinking) Press (SET) button to fix. Indication example: "UPPER 26˚C" (Displayed for two seconds) After the fixed upper limit value displayed for two seconds, the indication will return to "UPPER LIMIT ". 7. When "LOWER LIMIT " is selected (valid during cooling, dry, fan, automatic) Indication: " SET UP" "LOWER 18˚C " Select the lower limit value with temperature setting button . Indication example: "LOWER 24˚C " (blinking) Press (SET) button to fix. Indication for example: "LOWER 24˚C" (Displayed for two seconds) After the fixed lower limit value displayed for two seconds, the indication will return to "LOWER LIMIT ". 8. Press ON/OFF button to finish. It is possible to finish by pressing ON/OFF button on the way, but unfinished change of setting is unavailable. During setting, if you press (RESET) button, you return to the previous screen. Previous button – 146 – '10 • PAC-SM-137 The functional setting The initial function setting for typical using is performed automatically by the indoor unit connected, when remote controller and indoor unit are connected. As long as they are used in a typical manner, there wiil be no need to change the initial settings. If you would like to change the initial setting marked “ ”, set your desired setting as for the selected item. The procedure of functional setting is shown as the following diagram. [Flow of function setting] Start : Stop air-conditioner and press “ ” (SET) and Record and keep the “ ” (MODE) buttons at the same time for over three seconds. setting Finalize : Press “ ” (SET) button. Reset : Press “ ” (RESET) button. Select : Press button. Consult the technical data etc. for each control details End : Press ON/OFF button. It is possible to finish above setting on the way, and unfinished change of setting is unavailable. Stop air-conditioner and press “ ” : Initial settings (SET) + (MODE) buttons “ ” : Automatic criterion at the same time for over three seconds. 01 (Remote controller function) Function setting When you use at 50Hz area When you use at 60Hz area 02 03 Automatical operation is impossible Temperature setting button is not working 04 Mode button is not working 05 On/Off button is not working 06 Fan speed button is not working 07 Louver button is not working 08 Timer button is not working 09 Remote thermistor is not working. Remote thermistor is working. Remote thermistor is working, and to be set for producing +3.0˚C increase in temperature. Remote thermistor is working, and to be set for producing +2.0˚C increase in temperature. Remote thermistor is working, and to be set for producing +1.0˚C increase in temperature. Remote thermistor is working, and to be set for producing -1.0˚C increase in temperature. Remote thermistor is working, and to be set for producing -2.0˚C increase in temperature. Remote thermistor is working, and to be set for producing -3.0˚C increase in temperature. 10 11 In case of Single split series, by connecting ventilation device to CNT of the indoor printed circuit board (in case of VRF series, by connecting it to CND of the indoor printed circuit board), the operation of ventilation device is linked with the operation of indoor unit. In case of Single split series, by connecting ventilation device to CNT of the indoor printed circuit board (in case of VRF series, by connecting it to CND of the indoor printed circuit board), you can operate /stop the ventilation device independently by (VENT) button. 12 13 If you change the range of set temperature, the indication of set temperature will vary following the control. If you change the range of set temperature, the indication of set temperature will not vary following the control, and keep the set temperature. Airflow of fan becomes the three speed of Airflow of fan becomes the two speed of Airflow of fan becomes the two speed of Airflow of fan is fixed at one speed. 14 - If you change the remote controller function "14 you must change the indoor function "04 You can select the louver stop position in the four. The louver can stop at any position. . . or - - - . ", " accordingly. 15 16 If you input signal into CNT of the indoor printed circuit board from external, the indoor unit will be operated independently according to the input from external. If you input into CNT of the indoor printed circuit board from external, all units which connect to the same remote controller are operated according to the input from external. 17 18 In normal working indication, indoor unit temperature is indicated instead of airflow. (Only the master remote controller can be indicated.) Heating preparation indication should not be indicated. 19 Temperature indication is by degree C Temperature indication is by degree F ON/OFF button (finished) – 147 – '10 • PAC-SM-137 Note 1: The initial setting marked “ Item Function No. Remote controller function02 Remote controller function06 Remote controller function07 Remote controller function13 ” is decided by connected indoor and outdoor unit, and is automatically defined as following table. Default Model "Auto-RUN" mode selectable indoor unit. Indoor unit without "Auto-RUN" mode Indoor unit with two or three step of air flow setting Indoor unit with only one of air flow setting Indoor unit with automatically swing louver Indoor unit without automatically swing louver Indoor unit with three step of air flow setting Indoor unit with two step of air flow setting Indoor unit with only one of air flow setting Heat pump unit Exclusive cooling unit Remote controller function15 Note 3: As for plural indoor unit, set indoor functions to each master and slave indoor unit. But only master indoor unit is received the setting change of indoor unit function “05 EXTERNAL INPUT” and “06 PERMISSION / PROHIBISHION”. (Indoor unit function) Indoor unit No. are indicated only when plural indoor units are connected. Function setting 02 Note2: Fan setting of "HIGH SPEED" Fan tap FAN SPEED SET 03 - - - Indoor unit air flow setting - - STANDARD UH - Hi - Me - Lo Hi - Me - Lo Hi - Lo Hi - Me HIGH SPEED1, 2 UH - UH - Hi - Me UH - Hi - Me UH - Me UH - Hi Initial function setting of some indoor unit is "HIGH SPEED". The filter sign is indicated after running for 180 hours. The filter sign is indicated after running for 600 hours. The filter sign is indicated after running for 1000 hours. The filter sign is indicated after running for 1000 hours, then the indoor unit will be stopped by compulsion after 24 hours. To set other indoor unit, press AIRCON NO. button, which allows you to go back to the indoor 04 unit selection screen (for example: I/U 000 ). If you change the indoor function "04 you must change the remote controller function "14 You can select the louver stop position in the four. The louver can stop at any position. ", " accordingly. 05 06 Permission/prohibition control of operation will be valid. 07 With the VRF series, it is used to stop all indoor units connected with the same outdoor unit immediately. When stop signal is inputed from remote on-off terminal "CNT-6", all indoor units are stopped immediately. 08 To be reset for producing +3.0˚C increase in temperature during heating. To be reset for producing +2.0˚C increase in temperature during heating. To be reset for producing +1.0˚C increase in temperature during heating. 09 To be reset producing +2.0˚C increase in return air temperature of indoor unit. To be reset producing +1.5˚C increase in return air temperature of indoor unit. To be reset producing +1.0˚C increase in return air temperature of indoor unit. To be reset producing -1.0˚C increase in return air temperature of indoor unit. To be reset producing -1.5˚C increase in return air temperature of indoor unit. To be reset producing -2.0˚C increase in return air temperature of indoor unit. 10 When heating thermostat is OFF, fan speed is low speed. When heating thermostat is OFF, fan speed is set speed. When heating thermostat is OFF, fan speed is operated intermittently. When heating thermostat is OFF, the fan is stopped. When the remote thermistor is working, "FAN OFF" is set automatically. Do not set "FAN OFF" when the indoor unit's thermistor is working. 11 Change of indoor heat exchanger temperature to start frost prevention control. 12 Working only with the Single split series. To control frost prevention, the indoor fan tap is raised. 13 Drain pump is run during cooling and dry. Drain pump is run during cooling, dry and heating. Drain pump is run during cooling, dry, heating and fan. Drain pump is run during cooling, dry and fan. 14 After cooling is stopped or cooling thermostat is OFF, the fan does not perform extra operation. After cooling is stopped or cooling thermostat is OFF, the fan perform extra operation for half an hour. After cooling is stopped or cooling thermostat is OFF, the fan perform extra operation for an hour. After cooling is stopped or cooling thermostat is OFF, the fan perform extra operation for six hours. 15 After heating is stopped or heating thermostat is OFF, the fan does not perform extra operation. After heating is stopped or heating thermostat is OFF,the fan perform extra operation for half an hour. After heating is stopped or heating thermostat is OFF,the fan perform extra operation for two hours. After heating is stopped or heating thermostat is OFF, the fan perform extra operation for six hours. 16 During heating is stopped or heating thermostat is OFF, the fan perform intermittent operation for five minutes with low fan speed after twenty minutes' OFF. During heating is stopped or heating thermostat is OFF, the fan perform intermittent operation for five minutes with low fan speed after five minutes' OFF. 17 Connected “OA Processing” type indoor unit, and is automatically defined. – 148 – '10 • PAC-SM-137 Operation message Function description: setting description: How to set function 1. Stop air-conditioner and press (SET) (MODE) buttons at the same time for over three seconds, and the "FUNCTION SET " will be displayed. , Function No. Fixing button 2. Press (SET) button. 7 Finishing button 2 Starting button 3. Make sure which do you want to set, " FUNCTION " (remote controller function) or "I/U FUNCTION " (indoor unit function). 4. Press or button. Selecct " FUNCTION " (remote controller function) or "I/U FUNCTION " (indoor unit function). 1 6 5. Press 6. Indoor unit selection button Previous screen button (SET) button. On the occasion of remote controller function selection On the occasion of indoor unit function selection "DATA LOADING" (Indication with blinking) "DATA LOADING" (Blinking for 2 to 23 seconds to read the data) Display is changed to "01 GRILLE Indication is changed to "02 FAN SPEED SET". Go to . SET". Press or button. "No. and function"are indicated by turns on the remote controller function table, then you can select from them. (For example) [Note] (1) If plural indoor units are connected to a remote controller, the indication is "I/U 000" (blinking) The lowest number of the indoor unit connected is indicated. Function No. Function Press (SET) button. The current setting of selected function is indicated. (for example) "AUTO RUN ON" If "02 AUTO RUN SET" is selected Setting or button. (2) Press Select the number of the indoor unit you are to set If you select "ALL UNIT ", you can set the same setting with all unites. (3) Press (SET) button. Press or button. "No. and function" are indicated by turns on the indoor unit function table, then you can select from them. (For example) Press or button. Select the setting. Function No. Function Press (SET) button. The current setting of selected function is indicated. (For example) "STANDARD" If "02 FAN SPEED SET" is selected. Press (SET) "SET COMPLETE" will be indicated, and the setting will be completed. Then after "No. and function" indication returns, Set as the same procedure if you want to set continuously ,and if to finish, go to 7. Setting Press or button. Select the setting. Press (SET) button. "SET COMPLETE" will be indicated, and the setting will be completed. Then after "No. and function" indication returns, set as the same procedure if you want to set continuously , and if to finish, go to 7. 7. Press ON/OFF button. Setting is finished. When plural indoor units are connected to a remote controller, press the AIRCON NO. button, which allows you to go back to the indoor unit selection screen. (example "I/U 000 ") It is possible to finish by pressing ON/OFF button on the way, but unfinished change of setting is unavailable. During setting, if you press (RESET) button, you return to the previous screen. Setting is memorized in the controller and it is saved independently of power failure. How to check the current setting When you select from "No. and funcion" and press set button by the previous operation, the "Setting" displayed first is the current setting. (But, if you select "ALL UNIT ", the setting of the lowest number indoor unit is displayed.) – 149 – "MXBZT EP JU BDDPSEJOH UP UIF JOTUSVDUJPO – 150 – ● "SSBOHFUIFXJSJOHJOUIFDPOUSPMCPYTPUIBUJUDBOOPUCFQVTIFEVQGVSUIFSJOUPUIFCPY*OTUBMMUIFTFSWJDFQBOFMDPSSFDUMZ *ODPSSFDUJOTUBMMBUJPONBZSFTVMUJOPWFSIFBUJOHBOEmSF ● 6TFUIFQSFTDSJCFEDBCMFTGPSFMFDUSJDBMDPOOFDUJPOUJHIUFOUIFDBCMFTTFDVSFMZJOUFSNJOBMCMPDLBOESFMJFWFUIFDBCMFTDPSSFDUMZUPQSFWFOU PWFSMPBEJOHUIFUFSNJOBMCMPDLT -PPTFDPOOFDUJPOTPSDBCMFNPVOUJOHTDBODBVTFBOPNBMPVTIFBUQSPEVDUJPOPSmSF ● #FTVSFUPTIVUPGGUIFQPXFSCFGPSFTUBSUJOHFMFDUSJDBMXPSL 'BJMVSFUPTIVUPGGUIFQPXFSDBODBVTFFMFDUSJDTIPDLTVOJUGBJMVSFPSJODPSSFDUGVODUJPOPGFRVJQNFOU ● #FTVSFUPVTFUIFDBCMFTDPOGPSNFEUPTBGFUZTUBOEBSEBOEDBCMFBNQBDJUZGPSQPXFSEJTUSJCVUJPOXPSL 6ODPOGPSNBCMFDBCMFTDBODBVTFFMFDUSJDMFBLBOPNBMPVTIFBUQSPEVDUJPOPSmSF ● 5IFFMFDUSJDBMJOTUBMMBUJPONVTUCFDBSSJFEPVUCZUIFRVBMJmFEFMFDUSJDJBOJOBDDPSEBODFXJUIiUIFOPSNGPSFMFDUSJDBMXPSLwBOEiOBUJPOBM XJSJOHSFHVMBUJPOwBOEUIFTZTUFNNVTUCFDPOOFDUFEUPUIFEFEJDBUFEDJSDVJU 1PXFSTVQQMZXJUIJOTVGmDJFOUDBQBDJUZBOEJODPSSFDUGVODUJPOEPOFCZJNQSPQFSXPSLDBODBVTFFMFDUSJDTIPDLTBOEmSF ● &OTVSFUIFVOJUJTTUBCMFXIFOJOTUBMMFETPUIBUJUDBOXJUITUBOEFBSUIRVBLFTBOETUSPOHXJOET 6OTVJUBCMFJOTUBMMBUJPOMPDBUJPOTDBODBVTFUIFVOJUUPGBMMBOEDBVTFNBUFSJBMEBNBHFBOEQFSTPOBMJOKVSZ ● *OTUBMMUIFVOJUJOBMPDBUJPOXJUIHPPETVQQPSU 6OTVJUBCMFJOTUBMMBUJPOMPDBUJPOTDBODBVTFUIFVOJUUPGBMMBOEDBVTFNBUFSJBMEBNBHFBOEQFSTPOBMJOKVSZ ● )BOHVQUIFVOJUBUUIFTQFDJmFEQPJOUTXJUISPQFTXIJDIDBOTVQQPSUUIFXFJHIUJOMJGUJOHGPSQPSUBHF"OEUPBWPJEKPMUJOHPVUPGBMJHONFOU CFTVSFUPIBOHVQUIFVOJUBUQPJOUTVQQPSU "OJNQSPQFSNBOOFSPGQPSUBHFTVDIBTQPJOUTVQQPSUDBODBVTFEFBUIPSTFSJPVTQFSTPOBMJOKVSZEVFUPGBMMJOHPGUIFVOJU ● "GUFSDPNQMFUFEJOTUBMMBUJPODIFDLUIBUOPSFGSJHFSBOUMFBLTGSPNUIFTZTUFN *GSFGSJHFSBOUMFBLTJOUPUIFSPPNBOEDPNFTJOUPDPOUBDUXJUIBOPWFOPSPUIFSIPUTVSGBDFQPJTPOPVTHBTJTQSPEVDFE ● 7FOUJMBUFUIFXPSLJOHBSFBXFMMJOUIFFWFOUPGSFGSJHFSBOUMFBLBHFEVSJOHJOTUBMMBUJPO *GUIFSFGSJHFSBOUDPNFTJOUPDPOUBDUXJUIOBLFEnBNFTQPJTPOPVTHBTJTQSPEVDFE ● 8IFOJOTUBMMJOHJOTNBMMSPPNTUBLFQSFWFOUJPONFBTVSFTOPUUPFYDFFEUIFEFOTJUZMJNJUPGSFGSJHFSBOUJOUIFFWFOUPGMFBLBHFBDDPSEBODF XJUI*40 $POTVMUUIFFYQFSUBCPVUQSFWFOUJPONFBTVSFT*GUIFEFOTJUZPGSFGSJHFSBOUFYDFFETUIFMJNJUJOUIFFWFOUPGMFBLBHFMBDLPGPYZHFODBOPDDVSXIJDI DBODBVTFTFSJPVTBDDJEFOUT ● 6TFUIFPSJHJOBMBDDFTTPSJFTBOEUIFTQFDJmFEDPNQPOFOUTGPSJOTUBMMBUJPO *G QBSUT PUIFS UIBO UIPTF QSFTDSJCFE CZ VT BSF VTFE *U NBZ DBVTF GBMM PG UIF VOJU XBUFS MFBLT FMFDUSJD TIPDLT mSF SFGSJHFSBOU MFBL TVCTUBOEBSE QFSGPSNBODFDPOUSPMGBJMVSFBOEQFSTPOBMJOKVSZ ● *OTUBMMUIFTZTUFNJOGVMMBDDPSEBODFXJUIUIFJOTUSVDUJPONBOVBM *ODPSSFDUJOTUBMMBUJPONBZDBVTFCVSTUTQFSTPOBMJOKVSZXBUFSMFBLTFMFDUSJDTIPDLTBOEmSF ● *OTUBMMBUJPONVTUCFDBSSJFEPVUCZUIFRVBMJmFEJOTUBMMFS *GZPVJOTUBMMUIFTZTUFNCZZPVSTFMGJUNBZDBVTFTFSJPVTUSPVCMFTVDIBTXBUFSMFBLTFMFDUSJDTIPDLTmSFBOEQFSTPOBMJOKVSZBTBSFTVMUPGBTZTUFN NBMGVODUJPO ● ● ● ● .PEFMOBNFBOEQPXFSTPVSDF 3FGSJHFSBOUQJQJOHMFOHUI 1JQJOHXJSJOHBOENJTDFMMBOFPVTTNBMMQBSUT *OEPPSVOJUJOTUBMMBUJPONBOVBM $IFDLCFGPSFJOTUBMMBUJPOXPSL *OWFSUFSESJWFOTJOHMFTQMJU1"$ 7 %FTJHOFEGPS3"SFGSJHFSBOU PSB012D909G K ● %POPUQFSGPSNBOZSFQBJSTPSNPEJmDBUJPOTCZZPVSTFMG$POTVMUUIFEFBMFSJGUIFVOJUSFRVJSFTSFQBJS *GZPVSFQBJSPSNPEJGZUIFVOJUJUDBODBVTFXBUFSMFBLTFMFDUSJDTIPDLTPSmSF ● #FTVSFUPmYVQUIFTFSWJDFQBOFMT *ODPSSFDUmYJOHDBODBVTFFMFDUSJDTIPDLTPSmSFEVFUPJOUSVTJPOPGEVTUPSXBUFS ● %POPUSVOUIFVOJUXJUISFNPWFEQBOFMTPSQSPUFDUJPOT 5PVDIJOHSPUBUJOHFRVJQNFOUTIPUTVSGBDFTPSIJHIWPMUBHFQBSUTDBODBVTFQFSTPOBMJOKVSZEVFUPFOUSBQNFOUCVSOPSFMFDUSJD TIPDLT ● &OTVSFUIBUOPBJSFOUFSTJOUIFSFGSJHFSBOUDJSDVJUXIFOUIFVOJUJTJOTUBMMFEBOESFNPWFE *G BJS FOUFST JO UIF SFGSJHFSBOU DJSDVJU UIF QSFTTVSF JO UIF SFGSJHFSBOU DJSDVJU CFDPNFT UPP IJHI XIJDI DBO DBVTF CVSTU BOE QFSTPOBMJOKVSZ ● 4UPQUIFDPNQSFTTPSCFGPSFDMPTJOHWBMWFBOEEJTDPOOFDUJOHSFGSJHFSBOUQJQFTJODBTFPGQVNQEPXOPQFSBUJPO *G EJTDPOOFDUJOH SFGSJHFSBOU QJQFT JO TUBUF PG PQFOJOH TFSWJDF WBMWFT CFGPSF DPNQSFTTPS TUPQQJOH ZPV NBZ JODVS GSPTU CJUF PS JOKVSZGSPNBOBCSVQUSFGSJHFSBOUPVUnPXBOEBJSDBOCFTVDLFEXIJDIDBODBVTFCVSTUPSQFSTPOBMJOKVSZEVFUPBOPNBMPVTMZ IJHIQSFTTVSFJOUIFSFGSJHFSBOUDJSDVJU ● $POTVMUUIFEFBMFSPSBOFYQFSUSFHBSEJOHSFNPWBMPGUIFVOJU *ODPSSFDUJOTUBMMBUJPODBODBVTFXBUFSMFBLTFMFDUSJDTIPDLTPSmSF ● #FTVSFUPTXJUDIPGGUIFQPXFSTVQQMZJOUIFFWFOUPGJOTUBMMBUJPOJOTQFDUJPOPSTFSWJDJOH *GUIFQPXFSTVQQMZJTOPUTIVUPGGUIFSFJTBSJTLPGFMFDUSJDTIPDLTVOJUGBJMVSFPSQFSTPOBMJOKVSZEVFUPUIFVOFYQFDUFETUBSUPGGBO ● %POPUQFSGPSNBOZDIBOHFPGQSPUFDUJWFEFWJDFJUTFMGPSJUTTFUVQDPOEJUJPO 5IF GPSDFE PQFSBUJPO CZ TIPSUDJSDVJUJOH QSPUFDUJWF EFWJDF PG QSFTTVSF TXJUDI BOE UFNQFSBUVSF DPOUSPMMFS PS UIF VTF PG OPO TQFDJmFEDPNQPOFOUDBODBVTFmSFPSCVSTU ● 0OMZVTFQSFTDSJCFEPQUJPOBMQBSUT5IFJOTUBMMBUJPONVTUCFDBSSJFEPVUCZUIFRVBMJmFEJOTUBMMFS *GZPVJOTUBMMUIFTZTUFNCZZPVSTFMGJUDBODBVTFTFSJPVTUSPVCMFTVDIBTXBUFSMFBLTFMFDUSJDTIPDLTmSF ● %POPUPQFOUIFTFSWJDFWBMWFTGPSMJRVJEMJOFBOEHBTMJOFVOUJMDPNQMFUFESFGSJHFSBOUQJQJOHXPSLBJSUJHIUOFTTUFTU BOEFWBDVBUJPO *GUIFDPNQSFTTPSJTPQFSBUFEJOTUBUFPGPQFOJOH TFSWJDFWBMWFTCFGPSFDPNQMFUFEDPOOFDUJPOPGSFGSJHFSBOU QJQJOH XPSLZPV NBZJODVSGSPTUCJUFPSJOKVSZGSPNBOBCSVQUSFGSJHFSBOUPVUnPXBOEBJSDBOCFTVDLFEJOUPSFGSJHFSBOUDJSDVJUXIJDIDBODBVTF CVSTUPSQFSTPOBMJOKVSZEVFUPBOPNBMPVTMZIJHIQSFTTVSFJOUIFSFGSJHFSBOU ● 5JHIUFO UIF nBSF OVU CZ VTJOH EPVCMF TQBOOFST BOE UPSRVF XSFODI BDDPSEJOH UP QSFTDSJCFE NFUIPE #F TVSF OPU UP UJHIUFOUIFnBSFOVUUPPNVDI -PPTFnBSFDPOOFDUJPOPSEBNBHFPOUIFnBSFQBSUCZUJHIUFOJOHXJUIFYDFTTUPSRVFDBODBVTFCVSTUPSSFGSJHFSBOUMFBLTXIJDI NBZSFTVMUJOMBDLPGPYZHFO ● 6TFUIFQSFTDSJCFEQJQFTnBSFOVUTBOEUPPMTGPS3" 6TJOHFYJTUJOHQBSUTGPS3PS3$ DBODBVTFUIFVOJUGBJMVSFBOETFSJPVTBDDJEFOUTEVFUPCVSTUPGUIFSFGSJHFSBOUDJSDVJU ● %POPUQFSGPSNCSB[JOHXPSLJOUIFBJSUJHIUSPPN *UDBODBVTFMBDLPGPYZHFO 8"3/*/( ●,FFQ UIF JOTUBMMBUJPO NBOVBM UPHFUIFS XJUI PXOFShT NBOVBM BU B QMBDF XIFSF BOZ VTFS DBO SFBE BU BOZ UJNF .PSFPWFS JG OFDFTTBSZ BTL UP IBOE UIFN UP B OFX VTFS UP UIF VTFS BDDPSEJOH UP UIF PXOFShT NBOVBM ●#F TVSF UP DPOmSN OP BOPNBMZ PO UIF FRVJQNFOU CZ DPNNJTTJPOJOH BGUFS DPNQMFUFE JOTUBMMBUJPO BOE FYQMBJO UIF PQFSBUJOH NFUIPET BT XFMM BT UIF NBJOUFOBODF NFUIPET PG UIJT FRVJQNFOU /FWFS EP JU VOEFS BOZ DJSDVNTUBODF JOKVSZ EVF UP FSSPOFPVT IBOEMJOH BSF MJTUFE JO UIF 8"3/*/( BOE UIF NBUUFST XJUI QPTTJCJMJUJFT MFBEJOH UP QFSTPOBM JOKVSZ PS EBNBHF PG UIF VOJU EVF UP FSSPOFPVT IBOEMJOH JODMVEJOH QSPCBCJMJUZ MFBEJOH UP TFSJPVT DPOTFRVFODFT JO TPNF DBTFT BSF MJTUFE JO $"65*0/ 5IFTF BSF WFSZ JNQPSUBOU QSFDBVUJPOT GPS TBGFUZ #F TVSF UP PCTFSWF BMM PG UIFN XJUIPVU GBJM ●5IF NFBOJOH PG .BSLT VTFE IFSF BSF BT TIPXO CFMPX ●5IF QSFDBVUJPOT EFTDSJCFE CFMPX BSF EJWJEFE JOUP 8"3/*/( BOE $"65*0/ 5IF NBUUFST XJUI QPTTJCJMJUJFT MFBEJOH UP TFSJPVT DPOTFRVFODFT TVDI BT EFBUI PS TFSJPVT QFSTPOBM NJTIBOEMJOH ●8F SFDPNNFOE ZPV UP SFBE UIJTi4"'&5: 13&$"65*0/4w DBSFGVMMZ CFGPSF UIF JOTUBMMBUJPO XPSL JO PSEFS UP HBJO GVMM BEWBOUBHF PG UIF GVODUJPOT PG UIF VOJU BOE UP BWPJE NBMGVODUJPO EVF UP 4"'&5: 13&$"65*0/4 ◎5IJT JOTUBMMBUJPO NBOVBM EFBMT XJUI PVUEPPS VOJUT BOE HFOFSBM JOTUBMMBUJPO TQFDJmDBUJPOT POMZ 'PS JOEPPS VOJUT SFGFS UP UIF SFTQFDUJWF JOTUBMMBUJPO NBOVBMT TVQQMJFE XJUI UIF VOJUT ◎8IFO JOTUBMM UIF VOJU CF TVSF UP DIFDL XIFUIFS UIF TFMFDUJPO PG JOTUBMMBUJPO QMBDF QPXFS TVQQMZ TQFDJmDBUJPOT VTBHF MJNJUBUJPO QJQJOH MFOHUI IFJHIU EJGGFSFODFT CFUXFFO JOEPPS BOE PVUEPPS VOJUT QPXFS TVQQMZ WPMUBHF BOE FUD BOE JOTUBMMBUJPO TQBDFT */45"--"5*0/."/6"-'03065%0036/*5 (1) Model FDC71VNX 5.3 Instuallation of outdoor unut '10 • PAC-SM-137 – 151 – B) C) D) E) F) G) H) I) OZMPO TMJOHT PS QSPUFDUJWF XPPE QJFDFT TP BT OPU UP EBNBHF UIF VOJU CZ SPQFT MJGUJOH JU 8PPEFO QBMMFU DBSSZJOH UIF SJHIU IBOE TJEF NVTU UBLF IFFE PG UIJT GBDU " QFSTPO DBSSZJOH UIF MFGU IBOE TJEF NVTU IPME XJUI IJT SJHIU IBOE UIF IBOEMF QSPWJEFE PO UIF GSPOU QBOFM PG UIF VOJU BOE XJUI IJT MFGU IBOE UIF DPSOFS DPMVNO TFDUJPO 1PSUBHF ● 5IF SJHIU IBOE TJEF PG UIF VOJU BT WJFXFE GSPN UIF GSPOU EJGGVTFS TJEF JT IFBWJFS " QFSTPO 1BE ● 8IFO TPNF DPNQFMMJOH SFBTPO OFDFTTJUBUFT UIF VOQBDLJOH PG UIF VOJU CFGPSF JU JT DBSSJFE JO VTF 8IFO B VOJU JT IPJTUFE XJUI TMJOHT GPS IBVMBHF UBLF JOUP DPOTJEFSBUJPO UIF PGGTFU PG JUT HSBWJUZ DFOUFS QPTJUJPO *G OPU QSPQFSMZ CBMBODFE UIF VOJU DBO CF UISPXO PGGCBMBODF BOE GBMM ● %FMJWFS UIF VOJU BT DMPTF BT QPTTJCMF UP UIF JOTUBMMBUJPO TJUF CFGPSF SFNPWJOH JU GSPN UIF QBDLBHJOH %FMJWFSZ $"65*0/ )FBWZ %FEJDBUFE 3" UPPMT (BVHF NBOJGPME $IBSHF IPTF &MFDUSPOJD TDBMF GPS SFGSJHFSBOU DIBSHJOH 5PSRVF XSFODI 'MBSF UPPM 1SPUSVTJPO DPOUSPM DPQQFS QJQF HBVHF 7BDVVN QVNQ BEBQUFS (BT MFBL EFUFDUPS )"6-"(&"/%*/45"--"5*0/5BLFQBSUJDVMBSDBSFJODBSSZJOHJOPSNPWJOHUIFVOJUBOEBMXBZTQFSGPSNTVDIBOPQFSBUJPOXJUIUXPPSNPSFQFSTPOT ● " DZMJOEFS DPOUBJOJOH 3" IBT B QJOL JOEJDBUJPO NBSL PO UIF UPQ " VOJU EFTJHOFE GPS 3" IBT BEPQUFE B EJGGFSFOU TJ[F JOEPPS VOJU PQFSBUJPO WBMWF DIBSHF QPSU BOE B EJGGFSFOU TJ[F DIFDL KPJOU QSPWJEFE JO UIF VOJU UP QSFWFOU UIF DIBSHJOH PG B XSPOH SFGSJHFSBOU CZ NJTUBLF 5IF QSPDFTTFE EJNFOTJPO PG UIF nBSFE QBSU PG B SFGSJHFSBOU QJQF BOE B nBSF OVUhT QBSBMMFM TJEF NFBTVSFNFOU IBWF BMTP CFFO BMUFSFE UP SBJTF TUSFOHUI BHBJOTU QSFTTVSF "DDPSEJOHMZ ZPV BSF SFRVJSFE UP BSSBOHF EFEJDBUFE 3" UPPMT MJTUFE JO UIF UBCMF PO UIF SJHIU CFGPSF JOTUBMMJOH PS TFSWJDJOH UIJT VOJU ● %P OPU VTF B DIBSHF DZMJOEFS 5IF VTF PG B DIBSHF DZMJOEFS XJMM DBVTF UIF SFGSJHFSBOU DPNQPTJUJPO UP DIBOHF XIJDI SFTVMUT JO QFSGPSNBODF EFHSBEBUJPO ● *O DIBSHJOH SFGSJHFSBOU BMXBZT UBLF JU PVU GSPN B DZMJOEFS JO UIF MJRVJE QIBTF ● "MM JOEPPS VOJUT NVTU CF NPEFMT EFTJHOFE FYDMVTJWFMZ GPS 3" $IFDL DPOOFDUBCMF JOEPPS VOJU NPEFMT JO B DBUBMPH FUD " XSPOH JOEPPS VOJU JG DPOOFDUFE JOUP UIF TZTUFN XJMM JNQBJS QSPQFS TZTUFN PQFSBUJPO ● %POPUTUFQPOUPUIFPVUEPPSVOJU :PVNBZJODVSJOKVSZGSPNBESPQPSGBMM ● %POPUPQFSBUFUIFPVUEPPSVOJUXJUIBOZBSUJDMFQMBDFEPOJU :PVNBZJODVSQSPQFSUZEBNBHFPSQFSTPOBMJOKVSFGSPNBGBMMPGUIFBSUJDMF ● %POPUDMFBOVQUIFVOJUXJUIXBUFS *UDBODBVTFFMFDUSJDTIPDLT ● %POPUUPVDIBOZSFGSJHFSBOUQJQFTXJUIZPVSIBOETXIFOUIFTZTUFNJTJOPQFSBUJPO %VSJOHPQFSBUJPOUIFSFGSJHFSBOUQJQFTCFDPNFFYUSFNFMZIPUPSFYUSFNFMZDPMEEFQFOEJOHUIFPQFSBUJOHDPOEJUJPOBOEJUDBODBVTFCVSOJOKVSZPSGSPTUJOKVSZ ● %POPUUPVDIBOZCVUUPOTXJUIXFUIBOET *UDBODBVTFFMFDUSJDTIPDLT ● %POPUVTFUIFVOJUGPSTQFDJBMQVSQPTFTTVDIBTTUPSJOHGPPETDPPMJOHQSFDJTJPOJOTUSVNFOUTBOEQSFTFSWBUJPOPGBOJNBMTQMBOUTPSBSU *UDBODBVTFUIFEBNBHFPGUIFJUFNT ● %POPUJOTUBMMUIFPVUEPPSVOJUJOUIFMPDBUJPOTMJTUFECFMPX -PDBUJPOTXIFSFEJTDIBSHFEIPUBJSPSPQFSBUJOHTPVOEPGUIFPVUEPPSVOJUDBOCPUIFSOFJHICPSIPPE -PDBUJPOTXIFSFPVUMFUBJSPGUIFPVUEPPSVOJUCMPXTEJSFDUMZUPBOBOJNBMPSQMBOUT5IFPVUMFUBJSDBOBGGFDUBEWFSTFMZUPUIFQMBOUFUD -PDBUJPOTXIFSFWJCSBUJPODBOCFBNQMJmFEBOEUSBOTNJUUFEEVFUPJOTVGmDJFOUTUSFOHUIPGTUSVDUVSF -PDBUJPOTXIFSFWJCSBUJPOBOEPQFSBUJPOTPVOEHFOFSBUFECZUIFPVUEPPSVOJUDBOBGGFDUTFSJPVTMZPOUIFXBMMPSBUUIFQMBDFOFBSCFESPPN -PDBUJPOTXIFSFBOFRVJQNFOUBGGFDUFECZIJHIIBSNPOJDTJTQMBDFE57TFUPSSBEJPSFDFJWFSJTQMBDFEXJUIJON -PDBUJPOTXIFSFESBJOBHFDBOOPUSVOPGGTBGFMZ *UDBOBGGFDUTVSSPVOEJOHFOWJSPONFOUBOEDBVTFBDMBJN ● %POPUJOTUBMMUIFVOJUJOUIFMPDBUJPOTMJTUFECFMPX -PDBUJPOTXIFSFDBSCPOmCFSNFUBMQPXEFSPSBOZQPXEFSJTnPBUJOH -PDBUJPOTXIFSFBOZTVCTUBODFTUIBUDBOBGGFDUUIFVOJUTVDIBTTVMQIJEFHBTDIMPSJEFHBTBDJEBOEBMLBMJOFDBOPDDVS 7FIJDMFTBOETIJQT -PDBUJPOTXIFSFDPTNFUJDPSTQFDJBMTQSBZTBSFPGUFOVTFE -PDBUJPOTXJUIEJSFDUFYQPTVSFPGPJMNJTUBOETUFBNTVDIBTLJUDIFOBOENBDIJOFQMBOU -PDBUJPOTXIFSFBOZNBDIJOFTXIJDIHFOFSBUFIJHIGSFRVFODZIBSNPOJDTBSFVTFE -PDBUJPOTXJUITBMUZBUNPTQIFSFTTVDIBTDPBTUMJOFT -PDBUJPOTXJUIIFBWZTOPX*GJOTUBMMFECFTVSFUPQSPWJEFCBTFnBNFBOETOPXIPPENFOUJPOFEJOUIFNBOVBM -PDBUJPOTXIFSFUIFVOJUJTFYQPTFEUPDIJNOFZTNPLF -PDBUJPOTBUIJHIBMUJUVEFNPSFUIBONIJHI -PDBUJPOTXJUIBNNPOJDBUNPTQIFSFT -PDBUJPOTXIFSFIFBUSBEJBUJPOGSPNPUIFSIFBUTPVSDFDBOBGGFDUUIFVOJU -PDBUJPOTXJUIPVUHPPEBJSDJSDVMBUJPO -PDBUJPOTXJUIBOZPCTUBDMFTXIJDIDBOQSFWFOUJOMFUBOEPVUMFUBJSPGUIFVOJU -PDBUJPOTXIFSFTIPSUDJSDVJUPGBJSDBOPDDVSJODBTFPGNVMUJQMFVOJUTJOTUBMMBUJPO -PDBUJPOTXIFSFTUSPOHBJSCMPXTBHBJOTUUIFBJSPVUMFUPGPVUEPPSVOJU *UDBODBVTFSFNBSLBCMFEFDSFBTFJOQFSGPSNBODFDPSSPTJPOBOEEBNBHFPGDPNQPOFOUTNBMGVODUJPOBOEmSF ● %POPUVTFUIFCBTFnBNFGPSPVUEPPSVOJUXIJDIJTDPSSPEFEPSEBNBHFEEVFUPMPOHQFSJPETPGPQFSBUJPO 6TJOHBOPMEBOEEBNBHFCBTFnBNFDBODBVTFUIFVOJUGBMMJOHEPXOBOEDBVTFQFSTPOBMJOKVSZ $"65*0/ ● %P OPU VTF BOZ SFGSJHFSBOU PUIFS UIBO 3" 3" XJMM SJTF UP QSFTTVSF BCPVU UJNFT IJHIFS UIBO UIBU PG B DPOWFOUJPOBM SFGSJHFSBOU /PUBCJMJBBTBVOJUEFTJHOFEGPS3" ● $BSSZPVUUIFFMFDUSJDBMXPSLGPSHSPVOEMFBEXJUIDBSF %POPUDPOOFDUUIFHSPVOEMFBEUPUIFHBTMJOFXBUFSMJOFMJHIUOJOHDPOEVDUPSPSUFMFQIPOFMJOFhTHSPVOEMFBE*ODPSSFDUHSPVOEJOHDBODBVTFVOJUGBVMUTTVDIBT FMFDUSJDTIPDLTEVFUPTIPSUDJSDVJUJOH/FWFSDPOOFDUUIFHSPVOEJOHXJSFUPBHBTQJQFCFDBVTFJGHBTMFBLTJUDPVMEDBVTFFYQMPTJPOPSJHOJUJPO ● 6TFUIFDJSDVJUCSFBLFSGPSBMMQPMFXJUIDPSSFDUDBQBDJUZ 6TJOHUIFJODPSSFDUDJSDVJUCSFBLFSJUDBODBVTFUIFVOJUNBMGVODUJPOBOEmSF ● *OTUBMMJTPMBUPSPSEJTDPOOFDUTXJUDIPOUIFQPXFSTVQQMZXJSJOHJOBDDPSEBODFXJUIUIFMPDBMDPEFTBOESFHVMBUJPOT 5IFJTPMBUPSTIPVMECFMPDLFEJOBDDPSEBODFEXJUI&/. ● 5BLFDBSFXIFODBSSZJOHUIFVOJUCZIBOE *GUIFVOJUXFJHIUTNPSFUIBOLHJUNVTUCFDBSSJFECZUXPPSNPSFQFSTPOT%POPUDBSSZCZUIFQMBTUJDTUSBQTBMXBZTVTFUIFDBSSZIBOEMFXIFODBSSZJOHUIF VOJUCZIBOE6TFHMPWFTUPNJOJNJ[FUIFSJTLPGDVUTCZUIFBMVNJOVNmOT ● %JTQPTFPGBOZQBDLJOHNBUFSJBMTDPSSFDUMZ "OZSFNBJOJOHQBDLJOHNBUFSJBMTDBODBVTFQFSTPOBMJOKVSZBTJUDPOUBJOTOBJMTBOEXPPE"OEUPBWPJEEBOHFSPGTVGGPDBUJPOCFTVSFUPLFFQUIFQMBTUJD XSBQQFSBXBZGSPNDIJMESFOBOEUPEJTQPTFBGUFSUFBSJUVQ ● 1BZBUUFOUJPOOPUUPEBNBHFUIFESBJOQBOCZXFMETQBUUFSXIFOXFMEJOHXPSLJTEPOFOFBSUIFJOEPPSVOJU *GXFMETQBUUFSFOUFSFEJOUPUIFJOEPPSVOJUEVSJOHXFMEJOHXPSLJUDBODBVTFQJOIPMFJOESBJOQBOBOESFTVMUJOXBUFSMFBLBHF5PQSFWFOUTVDIEBNBHFLFFQUIFJOEPPSVOJUJOJUTQBDLJOHPSDPWFSJU ● #FTVSFUPJOTVMBUFUIFSFGSJHFSBOUQJQFTTPBTOPUUPDPOEFOTFUIFBNCJFOUBJSNPJTUVSFPOUIFN *OTVGmDJFOUJOTVMBUJPODBODBVTFDPOEFOTBUJPOXIJDIDBOMFBEUPNPJTUVSFEBNBHFPOUIFDFJMJOHnPPSGVSOJUVSFBOEBOZPUIFSWBMVBCMFT ● #FTVSFUPQFSGPSNBJSUJHIUOFTTUFTUCZQSFTTVSJ[JOHXJUIOJUSPHFOHBTBGUFSDPNQMFUFESFGSJHFSBOUQJQJOHXPSL *GUIFEFOTJUZPGSFGSJHFSBOUFYDFFETUIFMJNJUJOUIFFWFOUPGSFGSJHFSBOUMFBLBHFJOUIFTNBMMSPPNMBDLPGPYZHFODBOPDDVSXIJDIDBODBVTFTFSJPVTBDDJEFOUT ● 1FSGPSNJOTUBMMBUJPOXPSLQSPQFSMZBDDPSEJOHUPUIJTJOTUBMMBUJPONBOVBM *NQSPQFSJOTUBMMBUJPODBODBVTFBCOPSNBMWJCSBUJPOTPSJODSFBTFEOPJTFHFOFSBUJPO ● &BSUIMFBLBHFCSFBLFSNVTUCFJOTUBMMFE *GUIFFBSUIMFBLBHFCSFBLFSJTOPUJOTUBMMFEJUDBODBVTFmSFPSFMFDUSJDTIPDLT ● %POPUVTFBOZNBUFSJBMTPUIFSUIBOBGVTFXJUIUIFDPSSFDUSBUJOHJOUIFMPDBUJPOXIFSFGVTFTBSFUPCFVTFE $POOFDUJOHUIFDJSDVJUXJUIDPQQFSXJSFPSPUIFSNFUBMUISFBEDBODBVTFVOJUGBJMVSFBOEmSF ● %POPUJOTUBMMUIFVOJUOFBSUIFMPDBUJPOXIFSFMFBLBHFPGDPNCVTUJCMFHBTFTDBOPDDVS *GMFBLFEHBTFTBDDVNVMBUFBSPVOEUIFVOJUJUDBODBVTFmSF ● %P OPU JOTUBMM UIF VOJU XIFSF DPSSPTJWF HBT TVDI BT TVMGVSPVT BDJE HBT FUD PS DPNCVTUJCMF HBT TVDI BT UIJOOFS BOE QFUSPMFVN HBTFT DBO BDDVNVMBUFPSDPMMFDUPSXIFSFWPMBUJMFDPNCVTUJCMFTVCTUBODFTBSFIBOEMFE $PSSPTJWFHBTDBODBVTFDPSSPTJPOPGIFBUFYDIBOHFSCSFBLBHFPGQMBTUJDQBSUTBOEFUD"OEDPNCVTUJCMFHBTDBODBVTFmSF ● 4FDVSFBTQBDFGPSJOTUBMMBUJPOJOTQFDUJPOBOENBJOUFOBODFTQFDJmFEJOUIFNBOVBM *OTVGmDJFOUTQBDFDBOSFTVMUJOBDDJEFOUTVDIBTQFSTPOBMJOKVSZEVFUPGBMMJOHGSPNUIFJOTUBMMBUJPOQMBDF ● 8IFOUIFPVUEPPSVOJUJTJOTUBMMFEPOBSPPGPSBIJHIQMBDFQSPWJEFQFSNBOFOUMBEEFSTBOEIBOESBJMTBMPOHUIFBDDFTTSPVUFBOEGFODFTBOEIBOESBJMTBSPVOEUIFPVUEPPSVOJU *GTBGFUZGBDJMJUJFTBSFOPUQSPWJEFEJUDBODBVTFQFSTPOBMJOKVSZEVFUPGBMMJOHGSPNUIFJOTUBMMBUJPOQMBDF ● %POPUJOTUBMMOPSVTFUIFTZTUFNDMPTFUPUIFFRVJQNFOUUIBUHFOFSBUFTFMFDUSPNBHOFUJDmFMETPSIJHIGSFRVFODZIBSNPOJDT &RVJQNFOUTVDIBTJOWFSUFSTTUBOECZHFOFSBUPSTNFEJDBMIJHIGSFRVFODZFRVJQNFOUTBOEUFMFDPNNVOJDBUJPOFRVJQNFOUTDBOBGGFDUUIFTZTUFNBOEDBVTF NBMGVODUJPOTBOECSFBLEPXOT5IFTZTUFNDBOBMTPBGGFDUNFEJDBMFRVJQNFOUBOEUFMFDPNNVOJDBUJPOFRVJQNFOUBOEPCTUSVDUJUTGVODUJPOPSDBVTFKBNNJOH ● %POPUJOTUBMMUIFPVUEPPSVOJUJOBMPDBUJPOXIFSFJOTFDUTBOETNBMMBOJNBMTDBOJOIBCJU *OTFDUTBOETNBMMBOJNBMTDBOFOUFSUIFFMFDUSJDQBSUTBOEDBVTFEBNBHFPSmSF*OTUSVDUUIFVTFSUPLFFQUIFTVSSPVOEJOHTDMFBO '10 • PAC-SM-137 1SPWJEF B TOPX IPPE UP UIF PVUEPPS VOJU PO TJUF 3FHBSEJOH PVUMJOF PG B TOPX IPPE SFGFS UP PVS UFDIOJDBM NBOVBM *OTUBMM UIF VOJU VOEFS FBWFT PS QSPWJEF UIF SPPG PO TJUF – 152 – 8JOE EJSFDUJPO 5IF VOJU TIPVME CF JOTUBMMFE PO UIF TUBCMF BOE MFWFM GPVOEBUJPO *G UIF GPVOEBUJPO JT OPU MFWFM UJF EPXO UIF VOJU XJUI XJSFT 3FTUSJDUJPOT ● %FUFSNJOF I EJGGFSFOUPOFXBZQJQFMFOHUISFTUSJDUJPOTTIPVMEBQQMZEFQFOEJOHPOJUTQJQFTJ[F'PSNPSFJOGPSNBUJPOQMFBTFTFFi65*-*;"5*0/0'&9*45*/(1*1*/(w ● 5IFVTFSFTUSJDUJPOTBQQFBSJOHJOUIFUBCMFBCPWFBSFBQQMJDBCMFUPUIFTUBOEBSEQJQFTJ[FDPNCJOBUJPOTTIPXOJOUIFUBCMFCFMPX8IFSFBOFYJTUJOHQJQFTZTUFNJTVUJMJ[FE SFGSJHFSBOU QJQF TJ[F QVSTVBOU UP UIF GPMMPXJOH HVJEFMJOFT CBTFE PO UIF JOEPPS VOJU TQFDJmDBUJPOT %FUFSNJOBUJPO PG QJQF TJ[F $"65*0/ − NPSMFTT ) ) ) -−- -+-+- − ) 6TFBMPOHCMPDLUP FYUFOEUIFXJEUI - - 6TFBUIJDLFSCMPDLUP BODIPSEFFQFS 'BTUFOXJUICPMUT . TFSWJDF TQBDF - ) ) - *OEPPSVOJU 0VUEPPSVOJU - -SJTFS - *OEPPSVOJU *OEPPSVOJU5IFVOJUPGXIJDIFMFWBUJPOEJGGFSFODFGSPNUIFPVUEPPSVOJUJTUIFMBSHFTU 5XJOUZQF 0VUEPPSVOJU 4JOHMFUZQF XJMM OPU CMPX BHBJOTU UIF PVUEPPS IFBU FYDIBOHFS EJSFDUMZ 3FHBSEJOH PVUMJOF PG B TOPX IPPE SFGFS UP PVS UFDIOJDBM NBOVBM - NPSMFTT 0VUMFU *OUBLF ② /PUBCJMJBGPSJOTUBMMBUJPO *OUBLF - ● 8IFO UIF PVUEPPS BJS UFNQFSBUVSF JT ¡$ PS MPXFS QSPWJEF B TOPX IPPE UP UIF PVUEPPS VOJU PO TJUF 4P UIBU TUSPOH XJOE -,- NPSMFTT Ⅲ 0QFO I 5P SVO UIF VOJU GPS B DPPMJOH PQFSBUJPO XIFO UIF PVUEPPS UFNQFSBUVSF JT o¡$ PS MPXFS - 8IFOUIFPVUEPPSVOJUJTQPTJUJPOFEMPXFS 0VUMFU *OUBLF Ⅱ 0QFO *NQSPQFSJOTUBMMBUJPODBOSFTVMUJOBDPNQSFTTPSGBJMVSFCSPLFOQJQJOHXJUIJOUIFVOJUBOEBCOPSNBMOPJTFHFOFSBUJPO − - "ODIPSCPMUQPTJUJPO Ⅰ 0QFO NN ● *OJOTUBMMJOHUIFVOJUmYUIFVOJUTMFHTXJUICPMUTTQFDJmFEPOUIFBCPWF ● 5IFQSPUSVTJPOPGBOBODIPSCPMUPOUIFGSPOUTJEFNVTUCFLFQUXJUIJONN ● 4FDVSFMZJOTUBMMUIFVOJUTPUIBUJUEPFTOPUGBMMPWFSEVSJOHFBSUIRVBLFTPSTUSPOHXJOETFUD ● 3FGFSUPUIFBCPWFJMMVTUSBUJPOTGPSJOGPSNBUJPOSFHBSEJOHDPODSFUFGPVOEBUJPOT ● *OTUBMMUIFVOJUJOBMFWFMBSFB8JUIBHSBEJFOUPGNNPSMFTT .BSLTBQQFBSJOHJOUIFESBXJOHPOUIFSJHIU 4JOHMFUZQF 5XJOUZQF 8IFOUIFPVUEPPSVOJUJTQPTJUJPOFEIJHIFS &MFWBUJPOEJGGFSFODFCFUXFFOJOEPPSVOJUT &MFWBUJPOEJGGFSFODFCFUXFFO JOEPPSBOEPVUEPPSVOJUT NPSMFTT %JGGFSFODFPGQJQFMFOHUIBGUFSUIFmSTUCSBODIJOHQPJOU NPSMFTT NPSMFTT .PEFM7 0OFXBZQJQFMFOHUIBGUFSUIFmSTUCSBODIJOHQPJOU .BJOQJQFMFOHUI 0OFXBZQJQFMFOHUIPGSFGSJHFSBOUQJQJOH %JNFOTJPOBM SFTUSJDUJPOT - - - - &YBNQMFJOTUBMMBUJPO ① "ODIPSCPMUmYFEQPTJUJPO *OTUBMMBUJPO 4J[F 7 ● 8IFSFBEBOHFSPGTIPSUDJSDVJUJOHFYJTUTJOTUBMMHVJEFMPVWFST ● 8IFONPSFUIBOPOFVOJUBSFJOTUBMMFEQSPWJEFTVGmDJFOUJOUBLFTQBDFDPOTDJPVTMZTPUIBUTIPSUDJSDVJUJOHNBZOPUPDDVS ● 8IFSF QJMJOH TOPX DBO CVSZ UIF PVUEPPS VOJU QSPWJEF QSPQFS TOPX HVBSET PSEFSUPGBDJMJUBUFTFSWJDJOHPGDPOUSPMMFSTQMFBTFQSPWJEFBTVGmDJFOUTQBDFCFUXFFOVOJUTTPUIBUUIFJSUPQQMBUFTDBOCF SFNPWFEFBTJMZ ● 8BMMTTVSSPVOEJOHUIFVOJUJOUIFGPVSTJEFTBSFOPUBDDFQUBCMF ● 5IFSFNVTUCFBNFUFSPSMBSHFSTQBDFJOUIFBCPWF ● 8IFONPSFUIBOPOFVOJUBSFJOTUBMMFETJEFCZTJEFQSPWJEFBNNPSXJEFSJOUFSWBMCFUXFFOUIFNBTBTFSWJDFTQBDF*O *OTUBMMBUJPO TQBDF ● $IFDL UIF GPMMPXJOH QPJOUT JO MJHIU PG UIF JOEPPS VOJU TQFDJmDBUJPOT BOE UIF JOTUBMMBUJPO TJUF ● 0CTFSWF UIF GPMMPXJOH SFTUSJDUJPOT PO VOJU JOTUBMMBUJPO BOE VTF *NQSPQFS JOTUBMMBUJPO DBO SFTVMU JO B DPNQSFTTPS GBJMVSF PS QFSGPSNBODF EFHSBEBUJPO 3FTUSJDUJPOT PO VOJU JOTUBMMBUJPO BOE VTF 8JOE EJSFDUJPO *OTUBMM UIF PVUMFU BJS CMPX TJEF PG UIF VOJU JO B QPTJUJPO QFSQFOEJDVMBS UP UIF EJSFDUJPO PG XJOE 3&'3*(&3"/51*1*/(803, 0WFS NN *OTUBMM UIF PVUMFU BJS CMPX TJEF PG UIF VOJU UP GBDF B XBMM PG CVJMEJOH PS QSPWJEF B GFODF PS B XJOECSFBL TDSFFO *G UIF VOJU DBO CF BGGFDUFE CZ TUSPOH XJOE GPMMPXJOH NFBTVSFT BSF SFRVJSFE 4USPOH XJOE DBO DBVTF EBNBHF PG GBO GBO NPUPS PS DBO DBVTF QFSGPSNBODF EFHSBEBUJPO PS DBO USJHHFS BOPNBMPVT TUPQ PG UIF VOJU EVF UP SJTJOH PG IJHI QSFTTVSF 4JODF ESBJO XBUFS HFOFSBUFE CZ EFGSPTU DPOUSPM NBZ GSFF[F GPMMPXJOH NFBTVSFT BSF SFRVJSFE ● %POUFYFDVUFESBJOQJQJOHXPSLCZVTJOHBESBJOFMCPXBOEESBJOHSPNNFUTPQUJPOBMQBSUT <3FGFSUP%SBJOQJQJOHXPSL> ● 3FDPNNFOETFUUJOH%FGSPTU$POUSPM48 BOE4OPX(VBSE'BO$POUSPM48 <3FGFSUP4FUUJOH4848> *OTUBMM UIF VOJU PO UIF CBTF TP UIBU UIF CPUUPN JT IJHIFS UIBO TOPX DPWFS TVSGBDF *G UIF VOJU JT JOTUBMMFE JO UIF BSFB XIFSF UIF TOPX XJMM BDDVNVMBUF GPMMPXJOH NFBTVSFT BSF SFRVJSFE 5IF CPUUPN QMBUF PG VOJU BOE JOUBLF PVUMFU NBZ CF CMPDLFE CZ TOPX $BVUJPO BCPVU TFMFDUJPO PG JOTUBMMBUJPO MPDBUJPO #F TVSF UP TFMFDU B TVJUBCMF JOTUBMMBUJPO QMBDF JO DPOTJEFSBUJPO PG GPMMPXJOH DPOEJUJPOT 〇" QMBDF XIFSF JU JT IPSJ[POUBM TUBCMF BOE DBO FOEVSF UIF VOJU XFJHIU BOE XJMM OPU BMMPX WJCSBUJPO USBOTNJUUBODF PG UIF VOJU 〇" QMBDF XIFSF JU DBO CF GSFF GSPN QPTTJCJMJUZ PG CPUIFSJOH OFJHICPST EVF UP OPJTF PS FYIBVTU BJS GSPN UIF VOJU 〇" QMBDF XIFSF UIF VOJU JT OPU FYQPTFE UP PJM TQMBTIFT 〇" QMBDF XIFSF JU DBO CF GSFF GSPN EBOHFS PG nBNNBCMF HBT MFBLBHF 〇" QMBDF XIFSF ESBJO XBUFS DBO CF EJTQPTFE XJUIPVU BOZ USPVCMF 〇" QMBDF XIFSF UIF VOJU XJMM OPU CF BGGFDUFE CZ IFBU SBEJBUJPO GSPN PUIFS IFBU TPVSDF 〇" QMBDF XIFSF TOPX XJMM OPU BDDVNVMBUF 〇 " QMBDF XIFSF UIF VOJU DBO CF LFQU BXBZ N PS NPSF GSPN57 TFU BOEPS SBEJP SFDFJWFS JO PSEFS UP BWPJE BOZ SBEJP PS57 JOUFSGFSFODF 〇 " QMBDF XIFSF HPPE BJS DJSDVMBUJPO DBO CF TFDVSFE BOE FOPVHI TFSWJDF TQBDF DBO CF TFDVSFE GPS NBJOUFOBODF BOE TFSWJDF PG UIF VOJU TBGFMZ 〇 " QMBDF XIFSF UIF VOJU XJMM OPU CF BGGFDUFE CZ FMFDUSPNBHOFUJD XBWFT BOEPS IJHIIBSNPOJD XBWFT HFOFSBUFE CZ PUIFS FRVJQNFOU 〇" QMBDF XIFSF DIFNJDBM TVCTUBODFT MJLF TVMGVSJD HBT DIMPSJD HBT BDJE BOE BMLBMJ JODMVEJOH BNNPOJB XIJDI DBO IBSN UIF VOJU XJMM OPU CF HFOFSBUFE BOE OPU SFNBJO 〇" QMBDF XIFSF TUSPOH XJOE XJMM OPU CMPX BHBJOTU UIF PVUMFU BJS CMPX PG UIF VOJU 4FMFDUJPO PG JOTUBMMBUJPO MPDBUJPO GPS UIF PVUEPPS VOJU '10 • PAC-SM-137 '10 • PAC-SM-137 – 153 – 1JQFMFOHUIGPS TUBOEBSESFGSJHFSBOU DIBSHFWPMVNFN "EEJUJPOBMDIBSHFWPMVNFLH QFSNFUFSPGSFGSJHFSBOUQJQJOH MJRVJEQJQFφ 3FGSJHFSBOUWPMVNFDIBSHFE GPSTIJQNFOUBUUIFGBDUPSZLH – 154 – 8IFO BO BEEJUJPOBM DIBSHF WPMVNF DBMDVMBUJPO SFTVMU JT OFHBUJWF JU JT OPU OFDFTTBSZ UP DIBSHF SFGSJHFSBOU BEEJUJPOBMMZ 1VU EPXO UIF SFGSJHFSBOU WPMVNF DBMDVMBUFE GSPN UIF QJQF MFOHUI POUP UIF DBVUJPO MBCFM BUUBDIFE PO UIF CBDL TJEF PG UIF TFSWJDF QBOFM "MM HBT QJQFT NVTU CF TFDVSFMZ IFBU JOTVMBUFE JO PSEFS UP QSFWFOU EBNBHF GSPN ESJQQJOH XBUFS UIBU DPNFT GSPN UIF DPOEFOTBUJPO GPSNFE PO UIFN EVSJOH B DPPMJOH PQFSBUJPO PS QFSTPOBM JOKVSZ GSPN CVSOT CFDBVTF UIFJS TVSGBDF DBO SFBDI RVJUF B IJHI UFNQFSBUVSF EVF UP EJTDIBSHFE HBT nPXJOH JOTJEF EVSJOH B IFBUJOH PQFSBUJPO 8SBQ JOEPPS VOJUT nBSF KPJOUT XJUI IFBU JOTVMBUJOH QBSUT QJQF DPWFS GPS IFBU JOTVMBUJPO CPUI HBT BOE MJRVJE QJQFT (JWF IFBU JOTVMBUJPO UP CPUI HBT BOE MJRVJE TJEF QJQFT #VOEMF B IFBU JOTVMBUJOH NBUFSJBM BOE B QJQF UJHIUMZ UPHFUIFS TP UIBU OP HBQT NBZ CF MFGU CFUXFFO UIFN BOE XSBQ UIFN UPHFUIFS XJUI B DPOOFDUJOH DBCMF CZ B ESFTTJOH UBQF "MUIPVHI JU JT WFSJmFE JO B UFTU UIBU UIJT BJS DPOEJUJPOJOH VOJU TIPXT TBUJTGBDUPSZ QFSGPSNBODF VOEFS +*4 DPOEFOTBUJPO UFTU DPOEJUJPOT CPUI HBT BOE MJRVJE QJQFT OFFE UP CF ESFTTFE XJUI NN PS UIJDLFS IFBU JOTVMBUJPO NBUFSJBMT BCPWF UIF DFJMJOH XIFSF SFMBUJWF IVNJEJUZ FYDFFET 6TFBIFBUJOTVMBUJOHNBUFSJBMUIBUDBOXJUITUBOE℃PSBIJHIFSUFNQFSBUVSF1PPSIFBUJOTVMBUJOHDBQBDJUZDBODBVTFIFBUJOTVMBUJPOQSPCMFNTPSDBCMFEFUFSJPSBUJPO *NQSPQFS IFBU JOTVMBUJPOBOUJEFX ESFTTJOH DBO SFTVMU JO B XBUFS MFBL PS ESJQQJOH DBVTJOH EBNBHF UP IPVTFIPME FGGFDUT FUD %SFTTSFGSJHFSBOUQJQFTCPUIHBTBOEMJRVJEQJQFT GPSIFBUJOTVMBUJPOBOEQSFWFOUJPOPGEFXDPOEFOTBUJPO )FBUJOHBOEDPOEFOTBUJPOQSFWFOUJPO /05& -JRVJEQJQJOH 8JSFTGPSDPOOFDUJOHJOEPPS BOEPVUEPPSVOJUT #BOEBDDFTTPSZ ● *O DIBSHJOH SFGSJHFSBOU BMXBZT DIBSHF B DBMDVMBUFE WPMVNF CZ VTJOH B TDBMF UP NFBTVSF UIF DIBSHF WPMVNF ● 8IFO SFGSJHFSBOU JT DIBSHFE XJUI UIF VOJU CFJOH SVO DPNQMFUF B DIBSHF PQFSBUJPO XJUIJO NJOVUFT 3VOOJOH UIF VOJU XJUI BO JOTVGmDJFOU RVBOUJUZ PG SFGSJHFSBOU GPS B MPOH UJNF DBO DBVTF B DPNQSFTTPS GBJMVSF JOTVMBUJPO (BTQJQJOH &YUFSJPSUBQF 1JQFDPWFSBDDFTTPSZ UIF HBT TVDUJPO TJEF TFSWJDF QPSU XIJMF SVOOJOH UIF VOJU JO UIF DPPMJOH NPEF *O EPJOH TP DBSF NVTU CF UBLFO TP UIBU SFGSJHFSBOU NBZ CF EJTDIBSHFE GSPN UIF DZMJOEFS JO UIF MJRVJE QIBTF BMM UIF UJNF 8IFO UIF DZMJOEFS WBMWF JT UISPUUMFE EPXO PS B EFEJDBUFE DPOWFSTJPO UPPM UP DIBOHF MJRVJEQIBTF SFGSJHFSBOU JOUP NJTU JT VTFE UP QSPUFDU UIF DPNQSFTTPS IPXFWFS BEKVTU DIBSHF DPOEJUJPOT TP UIBU SFGSJHFSBOU XJMM HBTJGZ VQPO FOUFSJOH UIF VOJU ● 4JODF 3" SFGSJHFSBOU NVTU CF DIBSHFE JO UIF MJRVJE QIBTF ZPV TIPVME DIBSHF JU LFFQJOH UIF DPOUBJOFS DZMJOEFS VQTJEF EPXO PS VTJOH B SFGSJHFSBOU DZMJOEFS FRVJQQFE XJUI B TJQIPO UVCF ● $IBSHF SFGSJHFSBOU BMXBZT GSPN UIF MJRVJE TJEF TFSWJDF QPSU XJUI UIF PQFSBUJPO WBMWF TIVU 8IFO ZPV mOE JU EJGmDVMU UP DIBSHF B SFRVJSFE BNPVOU GVMMZ PQFO UIF PVUEPPS VOJU WBMWFT PO CPUI MJRVJE BOE HBT TJEFT BOE DIBSHF SFGSJHFSBOU GSPN $IBSHJOHSFGSJHFSBOU &Y 'PSBNJOTUBMMBUJPODIBSHFLHPGSFGSJHFSBOU 'PSBNJOTUBMMBUJPODIBSHFi YLHw ● 'PSBOJOTUBMMBUJPONFBTVSJOHNPSMPOHFSCVUOPUNPSFUIBONJOQJQFMFOHUIQMFBTFDIBSHFUIFTUBOEBSESFGSJHFSBOUDIBSHFWPMVNFXIFOZPVSFDIBSHFSFGSJHFSBOUBGUFSTFSWJDJOHFUD ● 8IFOSFGSJHFSBOUQJQJOHJTTIPSUFSUIBONSFDIBSHFLHPGSFGSJHFSBOU "EEJUJPOBMDIBSHFWPMVNFLH \.BJOQJQFMFOHUIN o-FOHUIDPWFSFEXJUIPVUBEEJUJPOBMDIBSHFN ^YLHN 5PUBMMFOHUIPGCSBODIQJQFTN YLHN 'PSNVMBUPDBMDVMBUFUIFWPMVNFPGBEEJUJPOBMSFGSJHFSBOUSFRVJSFE *OEPPSVOJU ○5P QSFWFOU B EJGGFSFOU PJM GSPN FOUFSJOH BTTJHO EFEJDBUFE UPPMT FUD UP FBDI SFGSJHFSBOU UZQF 6OEFS OP DJSDVNTUBODFT NVTU B HBVHF NBOJGPME BOE B DIBSHF IPTF JO QBSUJDVMBS CF TIBSFE XJUI PUIFS SFGSJHFSBOU UZQFT 3 3$ FUD ○6TF B DPVOUFSnPX QSFWFOUJPO BEBQUFS UP QSFWFOU WBDVVN QVNQ PJM GSPN FOUFSJOH UIF SFGSJHFSBOU TZTUFN ● 8IFO SFGSJHFSBOU QJQJOH JT TIPSUFS UIBO N SFEVDF SFGSJHFSBOU CZ LH GSPN UIF GBDUPSZ DIBSHFE WPMVNF BOE BEKVTU UP LH ● *G BO FYJTUJOH QJQF TZTUFN JT VTFE B SFRVJSFE SFGSJHFSBOU DIBSHF WPMVNF XJMM WBSZ EFQFOEJOH PO UIF MJRVJE QJQF TJ[F 'PS GVSUIFS JOGPSNBUJPO QMFBTF TFFi 65*-*;"5*0/ 0' &9*45*/( 1*1*/(w 8IFO SFGSJHFSBOU QJQJOH FYDFFET N BEEJUJPOBMMZ DIBSHF BO BNPVOU DBMDVMBUFE GSPN UIF QJQF MFOHUI BOE UIF BCPWF UBCMF GPS UIF QPSUJPO JO FYDFTT PG N SJ[F TTV 1SF (BTTJEF PQFSBUJPOWBMWF $IFDLKPJOU 1BZ BUUFOUJPO UP UIF GPMMPXJOH QPJOUT JO BEEJUJPO UP UIF BCPWFGPSUIF3"BOEDPNQBUJCMFNBDIJOFT *OTUBMMBUJPOTQJQFMFOHUIN DPWFSFEXJUIPVUBEEJUJPOBM SFGSJHFSBOUDIBSHF 'JMMSFGSJHFSBOU 7BDVVNHBVHFDIFDL 7BDVVNJOHDPNQMFUFE 7BDVVNJOHCFHJOT "JSUJHIUFOFTTUFTUDPNQMFUFE 0VUEPPSVOJU ● 5IJT VOJU DPOUBJOT GBDUPSZ DIBSHFE SFGSJHFSBOU DPWFSJOH N PG SFGSJHFSBOU QJQJOH BOE BEEJUJPOBM SFGSJHFSBOU DIBSHF PO UIF JOTUBMMBUJPO TJUF JT OPU SFRVJSFE GPS BO JOTUBMMBUJPO XJUI VQ UP N SFGSJHFSBOU QJQJOH .PEFM7 4UBOEBSESFGSJHFSBOU DIBSHFWPMVNFLH $BMDVMBUF B SFRVJSFE SFGSJHFSBOU DIBSHF WPMVNF GSPN UIF GPMMPXJOH UBCMF "EEJUJPOBM SFGSJHFSBOU DIBSHF 3VO UIF WBDVVN QVNQ GPS BU MFBTU POF IPVS BGUFS UIF WBDVVN HBVHF TIPXT L1B PS MPXFS NN)H PS MPXFS 8IFO UIF TZTUFN IBT SFNBJOJOH NPJTUVSF JOTJEF PS B MFBLZ QPJOU UIF WBDVVN HBVHF $POmSNUIBUUIFWBDVVNHBVHFJOEJDBUPSEPFTOPUSJTFFWFOJGUIFTZTUFNJTMFGUGPSPOFIPVSPSNPSF JOEJDBUPS XJMM SJTF $IFDL UIF TZTUFN GPS B MFBLZ QPJOU BOE UIFO ESBX BJS UP DSFBUF B WBDVVN BHBJO <8PSLnPX> &WBDVBUJPO ①"MUIPVHIPVUEPPSBOEJOEPPSVOJUTUIFNTFMWFTIBWFCFFOUFTUFEGPSBJSUJHIUOFTTBUUIFGBDUPSZDIFDLUIFDPOOFDUJOHQJQFTBGUFSUIFJOTUBMMBUJPOXPSLGPSBJSUJHIUOFTTGSPNUIFPQFSBUJPO WBMWFTDIFDLKPJOUFRVJQQFEPOUIFPVUEPPSVOJUTJEF8IJMFDPOEVDUJOHBUFTULFFQUIFPQFSBUJPOWBMWFTIVUBMMUIFUJNF B 3BJTFUIFQSFTTVSFUP.1BBOEUIFOTUPQ-FBWFJUGPSmWFNJOVUFTUPTFFJGUIFQSFTTVSFESPQT C 5IFOSBJTFUIFQSFTTVSFUP.1BBOETUPQ-FBWFJUGPSmWFNPSFNJOVUFTUPTFFJGUIFQSFTTVSFESPQT D 5IFOSBJTFUIFQSFTTVSFUPUIFTQFDJmFEMFWFM.1B BOESFDPSEUIFBNCJFOUUFNQFSBUVSFBOEUIFQSFTTVSF E *GOP QSFTTVSFESPQJT PCTFSWFEXJUIBOJOTUBMMBUJPOQSFTTVSJ[FEUPUIFTQFDJmFEMFWFMBOEMFGUGPSBCPVUPOFEBZJUJTBDDFQUBCMF8IFOUIF BNCJFOU5FNQFSBUVSFGBMM¡$UIFQSFTTVSF BMTPGBMMBQQSPYJNBUFMZ.1B5IFQSFTTVSFJGDIBOHFETIPVMECFDPNQFOTBUFEGPS F *GBQSFTTVSFESPQJTPCTFSWFEJODIFDLJOHF BOEB oE BMFBLFYJTUTTPNFXIFSF'JOEBMFBLCZBQQMZJOHCVCCMFUFTUMJRVJEUPXFMEFEQBSUTBOEnBSFKPJOUTBOESFQBJSJU"GUFSSFQBJS DPOEVDUBOBJSUJHIUOFTTUFTUBHBJO ② *O DPOEVDUJOH BO BJSUJHIUOFTT UFTU VTF OJUSPHFO HBT BOE QSFTTVSJ[F UIF TZTUFN XJUI OJUSPHFO HBT GSPN UIF HBT TJEF %P OPU VTF B NFEJVN PUIFS UIBO OJUSPHFO HBT VOEFS BOZ DJSDVNTUBODFT $MPTF "JSUJHIUOFTTUFTU '10 • PAC-SM-137 %SBJOFMCPXQF )BSEWJOZMDIMPSJEFQJQFGPSHFOFSBMQVSQPTF71 &YFDVUFESBJOQJQJOHCZVTJOHBESBJOFMCPXBOEESBJOHSPNNFUTTVQQMJFETFQBSBUFMZBT PQUJPOBMQBSUTXIFSFXBUFSESBJOFEGSPNUIFPVUEPPSVOJUJTBQSPCMFN %SBJOHSPNNFU QFT – 155 – / / : : 9 9 / - ; ; 3FNPUFDPOUSPMMFS *OEPPSVOJU 0VUEPPSVOJU 4XJUDIHFBSPS$JSDVJUCSFBLFS 1PXFSTPVSDF 4JOHMFQIBTFXJSF 7 )[ ."9PWFS DVSSFOU " $BCMFMFOHUI N φNN (SPVOEJOHXJSF UIJDLOFTT φNNY *OEPPSPVUEPPS XJSFUIJDLOFTT Y OVNCFS 77'nBUDBCMF 4IJFMEDBCMF WPMUBHFESPQJT'PSBOJOTUBMMBUJPOGBMMJOHPVUTJEFPGUIFTFDPOEJUJPOTGPMMPXUIFJOUFSOBMDBCMJOHSFHVMBUJPOT"EBQUJUUPUIFSFHVMBUJPOJOFGGFDUJOFBDI DPVOUSZ %POPUDPOOFDUUPUIFHSPVOEJOHXJSFGSPNBOPUIFSVOJU CVUJOTUBMMBEFEJDBUFEXJSFVQUPUIFHSPVOEJOHXJSFGSPN UIFEJTUSJCVUJPOCPBSE 'BTUFODBCMFTBOEQSPUFDUUIFUFSNJOBMDPOOFDUJPOTGSPN FYUFSOBMGPSDF ○ *UJTBUUBDIFEPOUIFCBDLTJEFPGUIFTFSWJDFQBOFM 8JSJOHEJBHSBN ○ 8JSJOHDMBNQ ○ (SPVOEJOHUFSNJOBM 1PXFSTPVSDFTJHOBMMJOFBOEHSPVOEUFSNJOBMCMPDL ● (SPVOEJOHUFSNJOBMTBSFQSPWJEFEJOUIFDPOUSPMCPY UFSNJOBMDPOOFDUJPOT ● *ODBCMJOHGBTUFODBCMFTTFDVSFMZXJUIDBCMFDMBNQTTPUIBUOPFYUFSOBMGPSDFNBZXPSLPO ●4XJUDIHFBSPS$JSDVJUCSFBLFSDBQBDJUZXIJDIJTDBMDVMBUFEGSPN."9PWFSDVSSFOUTIPVMECFDIPTFOBMPOHUIFSFHVMBUJPOTJOFBDIDPVOUSZ ●5IFDBCMFTQFDJmDBUJPOTBSFCBTFEPOUIFBTTVNQUJPOUIBUBNFUBMPSQMBTUJDDPOEVJUJTVTFEXJUIOPNPSFUIBOUISFFDBCMFTDPOUBJOFEJOBDPOEVJUBOEB JOTUSVDUJPOTPGUIFJOEPPSVOJU DPSFDBCMF × ● $POOFDUBQBJSCFBSJOHBDPNNPOUFSNJOBMOVNCFSXJUIBOJOEPPSPVUEPPSDPOOFDUJOHXJSF 7$5DBCUZSFDBCMF ●5IFTQFDJmDBUJPOTTIPXOJOUIFBCPWFUBCMFBSFGPSVOJUTXJUIPVUIFBUFST'PSVOJUTXJUIIFBUFSTSFGFSUPUIFJOTUBMMBUJPOJOTUSVDUJPOTPSUIFDPOTUSVDUJPO 7 .PEFM 1PXFSDBCMF UIJDLOFTT NN "MXBZTVTFBOFBSUIMFBLBHFDJSDVJUCSFBLFSEFTJHOFEGPSJOWFSUFSDJSDVJUTUPQSFWFOUBGBVMUZPQFSBUJPO &BSUIMFBLBHFCSFBLFS )BSNPOJDSFTJTUBOUUZQF $"65*0/ ● "MXBZTQFSGPSNHSPVOEJOHTZTUFNJOTUBMMBUJPOXPSLXJUIUIFQPXFSDPSEVOQMVHHFE 1PXFSDBCMFJOEPPSPVUEPPSDPOOFDUJOHXJSFT ● ● ● ● ● ● ● ● ● ● ● &MFDUSJDBMJOTUBMMBUJPOXPSLNVTUCFQFSGPSNFECZBOFMFDUSJDBMJOTUBMMBUJPOTFSWJDFQSPWJEFSRVBMJmFECZBQPXFSQSPWJEFSPGUIFDPVOUSZ &MFDUSJDBMJOTUBMMBUJPOXPSLNVTUCFFYFDVUFEBDDPSEJOHUPUIFUFDIOJDBMTUBOEBSETBOEPUIFSSFHVMBUJPOTBQQMJDBCMFUPFMFDUSJDBMJOTUBMMBUJPOTJOUIFDPVOUSZ %POPUVTFBOZTVQQMZDPSEMJHIUFSUIBOPOFTQFDJmFEJOQBSFOUIFTFTGPSFBDIUZQFCFMPX CSBJEFEDPSEDPEFEFTJHOBUJPO*&$ PSEJOBSZUPVHISVCCFSTIFBUIFEDPSEDPEFEFTJHOBUJPO*&$ nBUUXJOUJOTFMDPSEDPEFEFTJHOBUJPO*&$ %POPUVTFBOZUIJOHMJHIUFSUIBOQPMZDIMPSPQSFOFTIFBUIFEnFYJCMFDPSEDPEFEFTJHOBUJPO*&$ GPSTVQQMZDPSETPGQBSUTPGBQQMJBODFTGPSPVUEPPSVTF (SPVOEUIFVOJU%POPUDPOOFDUUIFHSPVOEJOHXJSFUPBHBTQJQFXBUFSQJQFMJHIUOJOHSPEPSUFMFQIPOFHSPVOEJOHXJSF *GJNQSPQFSZHSPVOEFEBOFMFDUSJDTIPDLPSNBMGVODUJPONBZSFTVMU "HSPVOEJOHXJSFNVTUCFDPOOFDUFECFGPSFDPOOFDUJOHUIFQPXFSDBCMF1SPWJEFBHSPVOEJOHXJSFMPOHFSUIBOUIFQPXFSDBCMF 5IFJOTUBMMBUJPOPGBOJNQVMTFXJUITUBOEJOHUZQFFBSUIMFBLBHFCSFBLFSJTOFDFTTBSZ"GBJMVSFUPJOTUBMMBOFBSUIMFBLBHFCSFBLFSDBOSFTVMUJOBOBDDDJEFOUTVDIBT BOFMFDUSJDTIPDLPSBmSF %POPUUVSOPOUIFQPXFSVOUJMUIFFMFDUSJDBMXPSLJTDPNQMFUFUFE %POPUVTFBDPOEFOTJWFDBQBDJUPSGPSQPXFSGBDUPSJNQSPWFNFOUVOEFSBOZDJSDVNTUBODFT*UEPTFOPUJNQSPWFQPXFSGBDUPSXIJMFJUDBODBVTFBOBCOPSNBM PWFSIFBUBDDJEFOU 'PSQPXFSTVQQMZDBCMFTVTFDPOEVJUT %P OPU MBZ FMFDUSPOJD DPOUSPM DBCMFT SFNPUF DPOUSPM BOE TJHOBMJOH XJSFT BOE PUIFS DBCMFT UPHFUIFS PVUTJEF UIF VOJU -BZJOH UIFN UPHFUIFS DBO SFTVMU JO UIF NBMGVODUJPOJOHPSBGBJMVSFPGUIFVOJUEVFUPFMFDUSJDOPJTFT 'BTUFODBCMFTTPUIBUNBZOPUUPVDIUIFQJQJOHFUD 8IFO DBCMFT BSF DPOOFDUFE NBLF TVSF UIBU BMM FMFDUSJDBM DPNQPOFOUT XJUIJO UIF FMFDUSJDBM DPNQPOFOU CPY BSF GSFF PG MPPTF DPOOFDUPS DPVQMJOH PS UFSNJOBM DPOOFDUJPOBOEUIFOBUUBDIUIFDPWFSTFDVSFMZ*NQSPQFSDPWFSBUUBDINFOUDBOSFTVMUJONBMGVODUJPOJOHPSBGBJMVSFPGUIFVOJUJGXBUFSQFOFUSBUFTJOUPUIFCPY "MXBZTVTFBUISFFDPSFDBCMFGPSBOJOEPPSPVUEPPSDPOOFDUJOHDBCMF/FWFSVTFBTIJFMEDBCMF ○ 5IFSF BSF ESBJO IPMFT QSPWJEFE PO UIF CPUUPN QMBUF PG BO PVUEPPS VOJU UP EJTDIBSHF DPOEFOTFEXBUFS ○ 8IFO DPOEFOTFE XBUFS OFFET UP CF MFE UP B ESBJO FUD JOTUBMM UIF VOJU PO B nBU CBTF TVQQMJFETFQBSBUFMZBTBOPQUJPOBMQBSU PSDPODSFUFCMPDLT ○ $POOFDUBESBJOFMCPXBTTIPXOJOUIFJMMVTUSBUJPOBOEDMPTFUIFPUIFSUXPESBJOIPMFTXJUI HSPNNFUT ○ &-&$53*$"-8*3*/(803, 'PSEFUBJMTPGFMFDUSJDBMDBCMJOHSFGFSUPUIFJOEPPSVOJUJOTUBMMBUJPONBOVBM ● %3"*/1*1*/(803, '10 • PAC-SM-137 ● ● ● ● 8IFO ZPV PQFSBUF TXJUDIFT GPS POTJUF TFUUJOH CF DBSFGVM OPU UP UPVDI B MJWF QBSU :PV DBOOPU DIFDL EJTDIBSHF QSFTTVSF GSPN UIF MJRVJE PQFSBUJPO WBMWF DIBSHF QPSU 5IF XBZ WBMWF 4 JT FOFSHJ[FE EVSJOH B IFBUJOH PQFSBUJPO 8IFO QPXFS TVQQMZ JT DVU PGG UP SFTFU UIF VOJU HJWF PS NPSF NJOVUFT CFGPSF ZPV UVSO PO QPXFS BHBJO BGUFS QPXFS JT DVU PGG *G UIJT QSPDFEVSF JT OPU PCTFSWFE JO UVSOJOH PO QPXFS BHBJOi&w $PNNVOJDBUJPO FSSPS NBZ PDDVS 5BLF VUNPTU DBSF OPU UP JODVS BO FMFDUSJD TIPDL PS CVSOT %P OPU MFBWF UIF VOJU XJUI UIF TFSWJDF QBOFM PQFO ● #FGPSF DPOEVDU B UFTU SVO EP OPU GBJM UP NBLF TVSF UIBU UIF PQFSBUJPO WBMWFT BSF DMPTFE ● 5VSO PO QPXFS IPVST QSJPS UP B UFTU SVO UP FOFSHJ[F UIF DSBOL DBTF IFBUFS ● *O DBTF PG UIF mSTU PQFSBUJPO BGUFS UVSOJOH PO QPXFS FWFO JG UIF VOJU EPFT OPU NPWF GPS NJOVUFT JU JT OPU B CSFBLEPXO ● "MXBZT HJWF B NJOVUF PS MPOHFS JOUFSWBM CFGPSF ZPV TUBSU UIF VOJU BHBJO XIFOFWFS JU JT TUPQQFE ● 3FNPWJOH UIF TFSWJDF QBOFM XJMM FYQPTF IJHIWPMUBHF MJWF QBSUT BOE IJHIUFNQFSBUVSF QBSUT XIJDI BSF RVJUF EBOHFSPVT " GBJMVSF UP PCTFSWF UIFTF JOTUSVDUJPOT DBO SFTVMU JO B DPNQSFTTPS CSFBLEPXO 14#%( 0'' 48 48 $PPMJOH EVSJOH B UFTU SVO /PSNBM PS"GUFS UIF UFTU PQFSBUJPO )FBUJOH EVSJOH B UFTU SVO – 156 – 4VDUJPOQSFTTVSF -PXQSFTTVSF %JTDIBSHFQSFTTVSF )JHIQSFTTVSF $IFDLKPJOUPGUIFQJQF %JTDIBSHFQSFTTVSF )JHIQSFTTVSF 4VDUJPOQSFTTVSF -PXQSFTTVSF $PPMJOHPQFSBUJPO )FBUJOHPQFSBUJPO #MJOLJOHDPOUJOVPVTMZ #MJOLJOHPODF & $IFDLQPXFSDBCMFTGPSMPPTFDPOUBDUPSEJTDPOOFDUJPO $IFDLXIFUIFSUIFPQFSBUJPOWBMWFTBSFPQFO *GBOFSSPSIBTCFFODBODFMFEXIFONJOVUFTIBWFFMBQTFETJODF BDPNQSFTTPSTUPQZPVDBOSFTUBSUUIFVOJUCZFGGFDUJOH$IFDL 3FTFUGSPNUIFSFNPUFDPOUSPMVOJU )BDUVBUJPOPSPQFSBUJPOXJUIPQFSBUJPOWBMWFTTIVU PDDVSTNBJOMZEVSJOHBIFBUJOHPQFSBUJPO -PXQSFTTVSFFSSPSPSPQFSBUJPOXJUIPQFSBUJPOWBMWFTTIVU PDDVSTNBJOMZEVSJOHBDPPMJOHPQFSBUJPO 'VMMPQFOQPTJUJPO $PNQMFUFTIVUQPTJUJPO $PNQMFUFTIVUQPTJUJPO 'VMMPQFOQPTJUJPO %VSJOHBIFBUJOHPQFSBUJPO 'VMMPQFOQPTJUJPO 'VMMPQFOQPTJUJPO %VSJOHBDPPMJOHPQFSBUJPO 'VMMPQFOQPTJUJPO 'VMMPQFOQPTJUJPO 8IFOUIFVOJUDPNFTUPBOBCOPSNBMTUPQ 8IFSFBGBDFDPWFSTIPVMECFBUUBDIFEPOUPBOJOEPPSVOJUJTUIFGBDFDPWFSBUUBDIFEUPUIFJOEPPSVOJU *TJOEPPSVOJUJOTUBMMBUJPOXPSLDPNQMFUFE "SFDBCMFTIFMEEPXOXJUIDBCMFDMBNQTTPUIBUOPFYUFSOBMGPSDFXPSLTPOUPUFSNJOBMDPOOFDUJPOT "SFDBCMFTGSFFPGMPPTFTDSFXTBUUIFJSDPOOFDUJPOQPJOUT *TUIFVOJUHSPVOEFEXJUIBEFEJDBUFEHSPVOEJOHXJSFOPUDPOOFDUFEUPBOPUIFSVOJUTHSPVOEJOHXJSF %PFTHSPVOEJOHTBUJTGZUIF%UZQFHSPVOEJOHUZQF***HSPVOEJOH SFRVJSFNFOUT "SFFJUIFS7$5DBCUZSFDBCMFTPS8'GMBUDBCMFTVTFEGPSJOEPPSPVUEPPSDPOOFDUJOHDBCMFT %PJOEPPSPVUEPPSDPOOFDUJOHDBCMFTDPOOFDUCFUXFFOUIFTBNFUFSNJOBMOVNCFST "SFOUJOEPPSPVUEPPSTJHOBMXJSFTDPOOFDUFEUPSFNPUFDPOUSPMXJSFT %PFTOUDBCMJOHDSPTTDPOOFDUCFUXFFOVOJUTXIFSFNPSFUIBOPOFVOJUBSFJOTUBMMFE "SFQSPQFSMZSBUFEFMFDUSJDBMFRVJQNFOUTVTFEGPSDJSDVJUCSFBLFSTBOEDBCMFT *TUIFVOJUGSFFPGDBCMJOHFSSPSTTVDIBTVODPNQMFUFEDPOOFDUJPOBOBCTFOUPSSFWFSTFEQIBTF )BWFZPVSFDPSEFEUIFBEEJUJPOBMSFGSJHFSBOUDIBSHFWPMVNFBOESFGSJHFSBOUQJQFMFOHUIPOUIFQBOFMTMBCFM "SFPQFSBUJPOWBMWFTTVSFMZPQFOFEGPSCPUIMJRVJEBOEHBTTZTUFNT "SFIFBUJOTVMBUJPONBUFSJBMTJOTUBMMFEPOCPUIMJRVJEBOEHBTQJQFT 8FSFBJSUJHIUOFTTUFTUBOEWBDVVNFYUSBDUJPOTVSFMZQFSGPSNFE 0/ 48 $IFDL $IFDL 0/ "MMTFUUP0''GPSTIJQNFOU 48 48 48 4XJUDIFT GPS POTJUF TFUUJOH 1PXFS TPVSDF TJHOBM MJOF BOE HSPVOE UFSNJOBM CMPDL ※ %P OPU PQFSBUF 48 48 48 48 ※ 3FGFS UP 5&$)/*$"- ."/6"- BCPVU 48 1VNQ EPXO 48 "MMTFUUP0''GPSTIJQNFOU 48 4XJUDIFT GPS POTJUF TFUUJOH 8IFSFPQUJPOTBSFVTFEDIFDLUIFJSPQFSBUJPOBDDPSEJOHUPUIFSFTQFDUJWFJOTUSVDUJPONBOVBMT 8IFOZPVDPNQMFUFUIFUFTUSVOQMFBTFUVSOPO48GPSTFDPOEBOECFTVSFUPFOEBUFTUSVO .BLFTVSFUIBUBSFE-&%JTOPUCMJOLJOH 1MBDFZPVSIBOECFGPSFUIFJOEPPSVOJUTEJGGVTFSUPDIFDLXIFUIFSDPMEXBSN XJOETDPNFPVUJOBDPPMJOHIFBUJOH PQFSBUJPO 8IFOUIFVOJUTUBSUTPQFSBUJPOQSFTTUIFXJOEEJSFDUJPOCVUUPOQSPWJEFEPOUIFSFNPUFDPOUSPMVOJUUPDIFDLJUTPQFSBUJPO 48480/UIFVOJUXJMMTUBSUBIFBUJOHPQFSBUJPO 48480''UIFVOJUXJMMTUBSUBDPPMJOHPQFSBUJPO 8IFSFBSFNPUFDPOUSPMVOJUJTVTFEGPSVOJUTFUVQPOUIFJOTUBMMBUJPOTJUFGPMMPXJOTUSVDUJPOTGPSVOJUTFUVQPOUIFJOTUBMMBUJPOTJUFXJUIBSFNPUFDPOUSPMVOJU $MPTFUIFQBOFM 0QFOUIFMJRVJETJEFPQFSBUJPOWBMWFGVMMZ 5IF DPOUFOUT PG PQFSBUJPO ● "MXBZTDBSSZPVUBUFTUSVOBOEDIFDLUIFGPMMPXJOHJOPSEFSBTMJTUFE *OEPPS VOJU &MFDUSJD XJSJOH $IFDL JUFN ● 8IFOZPVMFBWFUIFPVUEPPSVOJUXJUIQPXFSTVQQMJFEUPJU CFTVSFUPDMPTFUIFQBOFM *GCSB[FEXBTJUCSB[FEVOEFSBOJUSPHFOHBTGMPX 0QFOUIFHBTTJEFPQFSBUJPOWBMWFGVMMZ 5IJTPVUEPPSVOJUNBZTUBSUJOUIFTUBOECZNPEFXBJUJOHGPSBDPNQSFTTPSTUBSUVQ XIJDIDBODPOUJOVFVQUPNJOVUFTUPQSFWFOUUIFPJMMFWFMJOUIF DPNQSFTTPSGSPNMPXFSJOHPOUIFmSTUPQFSBUJPOBGUFSUVSOJOHPOUIFDJSDVJUCSFBLFS*GUIBUJTUIFDBTFEPOPUTVTQFDUBVOJUGBJMVSF )FFEUIFGPMMPXJOHPOUIFmSTUPQFSBUJPOBGUFSUVSOJOHPOUIFDJSDVJUCSFBLFS 7BMWFGPSBDPPMJOHPQFSBUJPO 7BMWFGPSBIFBUJOHPQFSBUJPO %VSJOHBIFBUJOHPQFSBUJPO 'VMMPQFOQPTJUJPO %VSJOHBDPPMJOHPQFSBUJPO $PNQMFUFTIVUQPTJUJPO 8IFOUIFVOJUDPNFTUPBOPSNBMTUPQ 5IF GPMMPXJOH UBCMF JMMVTUSBUFT UIF TUFBEZ TUBUFT PG UIF FMFDUSPOJD FYQBOTJPO WBMWF 8IFOQPXFSJTUVSOFEPO ⑥ ⑦ ⑧ ⑨ ⑩ ⑤ ① ② ③ ④ 5VSO *UFN 3FGSJHFSBOU QMVNCJOH 5FTU SVO QSPDFEVSF ー *UFN/PVTFEJOUIF JOTUBMMBUJPONBOVBM *UFNT UP DIFDLCFGPSF B UFTU SVO 0QFOQIBTF "DUJPO *GBOFSSPSDPEFPUIFSUIBOUIPTFMJTUFEBCPWFJTJOEJDBUFESFGFSUPUIFXJSJOHEJBHSBNPGUIFPVUEPPSVOJUBOEUIFJOEPPSVOJU #MJOLJOHDPOUJOVPVTMZ #MJOLJOHPODF 'BJMVSFFWFOU 5IFTUBUFPGUIFFMFDUSPOJDFYQBOTJPOWBMWF ● #MJOLJOHDPOUJOVPVTMZ #MJOLJOHPODF & 1SJOUFEDJSDVJUCPBSE-&%5IFDZDMFTPGTFDPOET 3FE-&% (SFFO-&% & &SSPSJOEJDBUFEPOUIF SFNPUFDPOUSPMVOJU 'BJMVSF EJBHOPTJT JO B UFTU SVO %FGSPTU DPOUSPM TXJUDIJOH 48 ・8IFO UIJT TXJUDI JT UVSOFE 0/ UIF VOJU XJMM SVO JO UIF EFGSPTU NPEF NPSF GSFRVFOUMZ ・4FU UIJT TXJUDI UP 0/ XIFO JOTUBMMFE JO B SFHJPO XIFSF PVUEPPS UFNQFSBUVSF GBMMT CFMPX [FSP EVSJOH UIF TFBTPO UIF VOJU JT SVO GPS B IFBUJOH PQFSBUJPO 4OPX HVBSE GBO DPOUSPM 48 ・8IFO UIJT TXJUDI JT UVSOFE PO UIF PVUEPPS VOJU GBO XJMM SVO GPS TFDPOET JO FWFSZ NJOVUFT XIFO PVUEPPS UFNQFSBUVSF GBMMT UP ℃ PS MPXFS BOE UIF DPNQSFTTPS JT OPU SVOOJOH ・8IFO UIF VOJU JT VTFE JO B WFSZ TOPXZ DPVOUSZ TFU UIJT TXJUDI UP 0/ 1MFBTFSFNPWFBTFSWJDFQBOFM 4FUUJOH 48 48 6TF DIFDL KPJOUT QSPWJEFE PO UIF QJQJOH CFGPSF BOE BGUFS UIF GPVSXBZ WBMWF JOTUBMMFE JOTJEF UIF PVUEPPS VOJU GPS DIFDLJOH EJTDIBSHF QSFTTVSF BOE TVDUJPO QSFTTVSF "TJOEJDBUFEJOUIFUBCMFTIPXOPOUIFSJHIUQSFTTVSFEFUFDUFE BUFBDIQPJOUXJMMWBSZEFQFOEJOHPOXIFUIFSBDPPMJOHPS IFBUJOHPQFSBUJPOIBTCFFOTFMFDUFE 1MFBTFSFNPWFBTFSWJDFQBOFM $IBSHFQPSUPGUIF HBTPQFSBUJPOWBMWF *ODBTFPGUIFmSTUPQFSBUJPOBGUFSUVSOJOHPOUIFQPXFSTVQQMZXIFOUIFVOJUSVOTJOUIFDPPMJOHNPEFBUPVUTJEFUFNQFSBUVSF ¡$PSMPXFSJUBVUPNBUJDBMMZDIBOHFTJOUPUIFDPPMJOHNPEFBGUFSJUSVOTJOUIFIFBUJOHNPEFGPSNJOVUFT $IFDLJOHUIFTUBUFPGUIFVOJUJOPQFSBUJPO ※ 0/ " UFTU SVO DBO CF JOJUJBUFE GSPN BO PVUEPPS VOJU CZ VTJOH 0/ 48 BOE 48 GPS POTJUF TFUUJOH 0'' 4XJUDIJOH 48 UP 0/ XJMM TUBSU UIF DPNQSFTTPS 5IF VOJU XJMM TUBSU B DPPMJOH PQFSBUJPO XIFO 48 JT 0'' PS B IFBUJOH PQFSBUJPO XIFO 48 JT 0/ %P OPU GBJM UP TXJUDI 48 UP 0'' XIFO B UFTU SVO JT DPNQMFUFE 1MFBTFSFNPWFBTJEFDPWFS 5FTU SVO NFUIPE SFTJTUBODFQMFBTFDIFDLUIFGPMMPXJOH $IFDLXIFUIFSBOPSNBMJOTVMBUJPOSFTJTUBODFWBMVFJTSFTUPSFEBCPVUIPVSTBGUFSQPXFSJTUVSOFE5VSOJOHPOQPXFSXJMMFOFSHJ[FUIFDPNQSFTTPSBOEIFBUJUUPFWBQPSBUFSFGSJHFSBOUHBUIFSFEJOJU $IFDLXIFUIFSUIFFBSUIMFBLBHFCSFBLFSJTBIBSNPOJDSFTJTUBOUUZQF 5IJTVOJUJTFRVJQQFEXJUIBOJOWFSUFSBOEUIFSFGPSFUIFVTFPGBIBSNPOJDSFTJTUBOUUZQFFBSUIMFBLBHFCSFBLFSJTOFDFTTBSZUPQSFWFOUBGBMTFBDUVBUJPO ● "OJOTVMBUJPOSFTJTUBODFWBMVFNBZESPQUPTFWFSBM.PINTJNNFEJBUFMZBGUFSJOTUBMMBUJPOPSXIFOUIFVOJUJTMFGUGPSBMPOHUJNFXJUIPVUQPXFSCFDBVTFSFGSJHFSBOUJTHBUIFSFEJOUIFDPNQSFTTPS8IFOUIFFBSUIMFBLBHFCSFBLFSJTBDUVBUFEEVFUPMPXJOTVMBUJPO "CPVUJOTVMBUJPOSFTJTUBODF $"65*0/ 8"3/*/( 5&4536/ K '10 • PAC-SM-137 – 157 – 8"3/*/( 8IJDIPGUIFGPMMPXJOHSFGSJHFSBUJPOPJMT EPFTUIFFYJTUJOHVOJUVTF 4VOJTP.4#BSSFM'SFF[F)"#'SFPM FUIFSPJMFTUFSPJM /0 $BO6TF .BLFBOJORVJSZ GPSSFVTBCJMJUZ $BOAU 6TF :&4 3FQBJSJTJNQPTTJCMF 3FNPWFJT JNQPTTJCMF "JSUJHIUOFTTJT JNQPTTJCMF 3FQBJSJTJNQPTTJCMF 3VO UIF VOJU GPS NJOVUFT GPS B DPPMJOH PQFSBUJPO 4UPQ UIF JOEPPS GBO BOE SVO UIF VOJU GPS NJOVUFT GPS B DPPMJOH PQFSBUJPO SFUVSOJOH MJRVJE $MPTF UIF MJRVJE TJEF PQFSBUJPO WBMWF PG UIF PVUEPPS VOJU BOE QVNQ EPXO SFGSJHFSBOU SFDPWFSZ #MPX XJUI OJUSPHFO HBT ※ *G EJTDPMPSFE SFGSJHFSBUJPO PJM PS BOZ GPSFJHO NBUUFST JT EJTDIBSHFE CZ UIF CMPX XBTI UIF QJQF TZTUFN PS JOTUBMM B OFX QJQF TZTUFN ● 'PS UIF GMBSF OVU EP OPU VTF UIF PME POF CVU VTF UIF POF TVQQMJFE XJUI UIF PVUEPPS VOJU 1SPDFTT B GMBSF UP UIF EJNFOTJPOT TQFDJGJFE GPS 3" ● 5VSO POTJUF TFUUJOH TXJUDI 48 UP UIF 0/ QPTJUJPO 8IFSF UIF HBT QJQF TJ[F JT φ $BSSZ PVU UIF GPMMPXJOH TUFQT XJUI UIF FYDJTJOH VOJU JO UIF PSEFS PG BOE 8IFSF UIF FYJTUJOH VOJU DBO CF SVO GPS B DPPMJOH PQFSBUJPO 5IFFYJTUJOHQJQFTZTUFNJTOPUSFVTBCMF *OTUBMMBOFXQJQFTZTUFN 3FQBJS 3FQBJSUIFEBNBHFEQBSUT 3FQBJS 3FQBJSUIFEBNBHFEQBSUT 3FNPWF 3FNPWFUIPTFCSBODIFT "JSUJHIUOFTTJT0, $IFDLUIFQJQFTZTUFNGPSBJSUJHIUOFTTPOUIFTJUF 3FQBJS 3FQBJSUIFEBNBHFEQBSUT $IBOHF ※$IFDLXJUIUIFGMPXDIBSUEFWFMPQFEGPSBDBTFXIFSF BOFYJTUJOHQJQFTZTUFNJTSFVTFEGPSB UXJOUSJQMFEPVCMFUXJONPEFMQVCMJTIFEBTBUFDIOJDBM EBUBTIFFU :&4 $IBOHFJTJNQPTTJCMF $IBOHFUIFCSBODIJOHQJQFUPBTQFDJGJFEUZQF /0 :&4 /0 /0 4PNFMPPTFQJQFTVQQPSUT 5IFFYJTUJOHQJQFTZTUFNJTSFVTBCMF /PMPPTFQJQFTVQQPSUT "SFOUUIFSFBOZMPPTFQJQFTVQQPSUT /0 "SFIFBUJOTVMBUJPONBUFSJBMTPGUIFFYJTUJOHQJQFTZTUFNUPSFVTF GSFFPGQFFMPGGTPSEFUFSJPSBUJPO )FBUJOTVMBUJPOJTOFDFTTBSZGPSCPUIHBTBOEMJRVJEQJQFT /0 "SFUIFSFBOZCSBODIQJQFTXJUIOPJOEPPSVOJUDPOOFDUFE /0 *TUIFFYJTUJOHQJQFTZTUFNUPSFVTFGSFFPGHBTMFBLT $IFDLXIFUIFSSFGSJHFSBOUDIBSHFXBTSFRVJSFEGSFRVFOUMZGPSUIF TZTUFNCFGPSF /0 *TUIFFYJTUJOHQJQFTZTUFNUPSFVTFGSFFPGDPSSPTJPOnBXTPSEFOUT /0 *TUIFVOJUUPJOTUBMMJOUIFFYJTUJOHQJQFTZTUFNB UXJOUSJQMFEPVCMFUXJONPEFM :&4 %PFTUIFFYJTUJOHQJQFTZTUFNUPSFVTFTBUJTGZBMMPGUIFGPMMPXJOH 5IFQJQFMFOHUIJTNPSMFTT 5IFQJQFTJ[FDPOGPSNTUPUIFUBCMFPGQJQFTJ[FSFTUSJDUJPOT 5IFFMFWBUJPOEJGGFSFODFCFUXFFOUIFJOEPPSBOEPVUEPPSVOJUT DPOGPSNTUPUIFGPMMPXJOHSFTUSJDUJPOT 8IFSFUIFPVUEPPSVOJUJTBCPWFNPSMFTT 8IFSFUIFPVUEPPSVOJUJTCFMPXNPSMFTT :&4 "SFUIFFYJTUJOHVOJUTPVSQSPEVDUT :&4 "SFBOPVUEPPSVOJUBOEBOJOEPPSVOJUDPOOFDUFEUPUIF FYJTUJOHQJQFTZTUFNUPSFVTF 45"35 $IFDLXIFUIFSBOFYJTUJOHQJQFTZTUFNJTSFVTBCMFPSOPUCZVTJOHUIFGPMMPXJOHnPXDIBSU 65*-*;"5*0/0'&9*45*/(1*1*/( 5BCMF PG QJQF TJ[F SFTUSJDUJPOT 6TBCJMJUZ .BYJNVNPOFXBZQJQFMFOHUI -FOHUIDPWFSFEXJUIPVUBEEJUJPOBMDIBSHF (BTQJQF -JRVJEQJQF $PPM↓ φ ◎ φ φ LHN φ △ φ φ LHN ◎ φ ○ φ LHN φ UIF UBCMFBSF OPU VTBCMF ● "OZ DPNCJOBUJPOT PG QJQF TJ[FT OPU MJTUFE JO 8BTI UIF QJQF TZTUFN PS JOTUBMM B OFX QJQF TZTUFN ● *G ZPV DIPPTF UP XBTI UIF QJQF TZTUFN DPOUBDU PVS EJTUSJCVUPS JO UIF BSFB 8IFSF UIF FYJTUJOH VOJU DBOOPU CF SVO GPS B DPPMJOH PQFSBUJPO ※ *G ZPV PCUBJO B OFHBUJWF GJHVSF BT B SFTVMU PG DBMDVMBUJPO OP BEEJUJPOBM SFGSJHFSBOU OFFET UP CF DIBSHFE &YBNQMF 8IFO BO 7 TJOHMF JOTUBMMBUJPO JT JOTUBMMFE JO B N MPOH FYJTUJOH QJQF TZTUFN MJRVJE φ HBT φ UIF RVBOUJUZ PG SFGSJHFSBOU UP DIBSHF BEEJUJPOBMMZ TIPVME CF NN Y LHN LH &YBNQMF 8IFO BO 7 UXJO JOTUBMMBUJPO JT JOTUBMMFE JO B N MPOH FYJTUJOH QJQF TZTUFN NBJO QJQF MFOHUI N MJRVJE φ HBT φ QJQF MFOHUI BGUFS CSBODIJOH QJQF N Y MJRVJE φ HBT φ UIF RVBOUJUZ PG SFGSJHFSBOU UP DIBSHF BEEJUJPOBMMZ TIPVME CF NN Y LHN N Y Y LHN LH "EEJUJPOBM DIBSHF WPMVNF LH \.BJO QJQF MFOHUI N o -FOHUI DPWFSFE XJUIPVU BEEJUJPOBM DIBSHF TIPXO JO UIF UBCMF N ^ × "EEJUJPOBM DIBSHF WPMVNF QFS NFUFS PG QJQF TIPXO JO UIF UBCMF LHN + 5PUBM MFOHUI PG CSBODI QJQFT N ×"EEJUJPOBM DIBSHF WPMVNF QFS NFUFS PG QJQF TIPXO JO UIF UBCMF LHN 'PSNVMB UP DBMDVMBUF BEEJUJPOBM DIBSHF WPMVNF 5IF CSBODIJOH QJQFT VTFE XJUI NPEFMT PUIFS UIBO UIPTF MJTUFE BCPWF BSF OPU SFVTBCMF 6TF PVS HFOVJOF CSBODIJOH QJQFT GPS 3" 5IF NPEFM UZQFT PG FYJTUJOH VOJUT PG XIJDI CSBODIJOH QJQFT BSF SFVTBCMF "EEJUJPOBMDIBSHJOHBNPVOUPGSFGSJHFSBOUQFSN -JRVJEQJQF 1JQF TJ[F (BTQJQF .PEFM $PNCJOBUJPOUZQF $PNCJOBUJPOPGDBQBDJUZ '%$ 5XJO ◎:4UBOEBSE QJQF TJ[F ○:6TBCMF 1JQF TZTUFN BGUFS UIF CSBODIJOH QJQF ● "OZ DPNCJOBUJPOT PG QJQF TJ[FT OPU MJTUFE JO UIF UBCMF BSF OPU VTBCMF SFEVDFE 1MFBTF DPOTVMU XJUI PVS EJTUSJCVUPS JO UIF BSFB JG ZPV OFFE UP SFDPWFS SFGSJHFSBOU BOE DIBSHF JU BHBJO ● 5IF QJQF MFOHUI TIPVME CF BU MFBTU N *G UIF QJQF MFOHUI JT TIPSUFS UIBO N UIF RVBOUJUZ PG SFGSJHFSBOU OFFET UP CF 7 1JQF TJ[F "EEJUJPOBMDIBSHFWPMVNFQFSNFUFSPGQJQF ◎:4UBOEBSE QJQF TJ[F ○:6TBCMF △:3FTUSJDUFE UP TIPSUFS QJQF MFOHUI MJNJUT $PPM↓ $PPMJOH DBQBDJUZ ESPQ '10 • PAC-SM-137 (2) Models FDC100∼140VNX, 100∼140VSX '10 • PAC-SM-137 – 158 – '10 • PAC-SM-137 – 159 – '10 • PAC-SM-137 – 160 – '10 • PAC-SM-137 – 161 – '10 • PAC-SM-137 – 162 – '10 • PAC-SM-137 – 163 – '10 • PAC-SM-137 – 164 – '10 • PAC-SM-137 – 165 – '10 • PAC-SM-137 5.4 Electric wiring work installation – 166 – '10 • PAC-SM-137 – 167 – '10 • PAC-SM-137 – 168 – '10 • PAC-SM-137 – 169 – '10 • PAC-SM-137 – 170 – HYPER INVERTER PACKAGED AIR-CONDITIONERS Air-Conditioning & Refrigeration Systems Headquarters 16-5, 2-chome, Kounan, Minato-ku, Tokyo, 108-8215, Japan Fax : (03) 6716-5926 Because of our policy of continuous improvement, we reserve the right to make changes in all specifications without notice. © Copyright MITSUBISHI HEAVY INDUSTRIES, LTD. © Copyright MITSUBISHI HEAVY INDUSTRIES, LTD.