Download Sanyo PLC-XR251 User's Manual
Transcript
Multimedia Projector MODEL PLC-XR201 PLC-XR251 Owner’s Manual Network Supported Ƒ :LUHG/$1 %DVH7;%DVH7 5HIHUWRWKH2ZQHU V0DQXDOVEHORZIRU GHWDLOVDERXWQHWZRUNIXQFWLRQ Ƒ 1HWZRUN6HWXSDQG2SHUDWLRQ Ƒ 3-1HWZRUN0DQDJHU Features and Design 7KLV0XOWLPHGLD3URMHFWRULVGHVLJQHGZLWKWKHPRVWDGYDQFHGWHFKQRORJ\IRUSRUWDELOLW\GXUDELOLW\DQGHDVHRIXVH 7KLVSURMHFWRUXWLOL]HVEXLOWLQPXOWLPHGLDIHDWXUHVDSDOHWWHRIPLOOLRQFRORUVDQGPDWUL[OLTXLGFU\VWDOGLVSOD\ /&'WHFKQRORJ\ Ƈ Ƈ Compact Design 7KLVSURMHFWRULVGHVLJQHGFRPSDFWLQVL]HDQGZHLJKW ,W LV HDV\ WR FDUU\ DQG LQVWDOOHG DQ\ZKHUH \RX ZLVK WR XVH Ƈ Simple Computer System Setting 7KHSURMHFWRUKDVWKH0XOWLVFDQV\VWHPWRFRQIRUPWR Ƈ Helpful Maintenance Functions DOPRVWDOOFRPSXWHURXWSXWVLJQDOVTXLFNO\S8SWR /DPSDQGILOWHUPDLQWHQDQFHIXQFWLRQVSURYLGHIRU :8;*$UHVROXWLRQFDQEHDFFHSWHG EHWWHUDQGSURSHUPDLQWHQDQFHRIWKHSURMHFWRU Ƈ Useful Functions for Presentations 7KH GLJLWDO ]RRP IXQFWLRQ DOORZV \RX WR IRFXV RQ WKH FUXFLDOLQIRUPDWLRQGXULQJDSUHVHQWDWLRQS %ODFNERDUGV FDQ EH XVHG DV D SURMHFWLRQ VFUHHQ 7KHERDUGFRORULVOLPLWHGWR*UHHQSS Ƈ Lamp Control %ULJKWQHVV RI WKH SURMHFWLRQ ODPS FDQ EH VHOHFWHG SS Ƈ Security Function 7KH 6HFXULW\ IXQFWLRQ KHOSV \RX WR HQVXUH VHFXULW\ RI WKH SURMHFWRU :LWK WKH .H\ ORFN IXQFWLRQ \RX FDQ ORFNWKHRSHUDWLRQRQWKHWRSFRQWURORUUHPRWHFRQWURO S 3,1 FRGH ORFN IXQFWLRQ SUHYHQWV XQDXWKRUL]HG XVHRIWKHSURMHFWRUSS± LAN Network Function 7KLV SURMHFWRU LV ORDGHG ZLWK WKH :LUHG /$1 QHWZRUN IXQFWLRQ <RX FDQ RSHUDWH DQG PDQDJH WKH SURMHFWRU YLDQHWZRUN)RUGHWDLOVUHIHUWRWKHRZQHU¶VPDQXDORI ³1HWZRUN6HWXSDQG2SHUDWLRQ´ Ƈ Auto Setup Function 7KLVIXQFWLRQHQDEOHV,QSXWVHDUFK$XWR.H\VWRQH FRUUHFWLRQDQG$XWR3&DGMXVWPHQWE\VLPSOHSUHVVLQJ WKH$8726(783EXWWRQRQWKHWRSFRQWUROS Ƈ Colorboard Function Ƈ Quick Termination 7KH$& SRZHU FRUG FDQ EH XQSOXJJHG LPPHGLDWHO\ DIWHU WXUQLQJ RII WKH SURMHFWRU ZLWKRXW ZDLWLQJ IRU WKH WHUPLQDWLRQRIWKHFRROLQJIDQURWDWLRQS WWKHWLPHRIVLPSOHSURMHFWLRQRQWKHFRORUHGZDOO $ \RXFDQJHWWKHFORVHFRORULPDJHWRWKHFRORULPDJH SURMHFWHGRQDZKLWHVFUHHQE\VHOHFWLQJWKHVLPLODU FRORUWRWKHZDOOFRORUIURPWKHSUHVHWIRXUFRORUV Ƈ Logo Function 7KH/RJRIXQFWLRQDOORZV\RXWRFXVWRPL]HWKHVFUHHQ ORJR SS <RX FDQ FDSWXUH DQ LPDJH IRU WKH VFUHHQ ORJR DQG XVH LW IRU WKH VWDUWLQJXS GLVSOD\ RU EHWZHHQSUHVHQWDWLRQV Ƈ Ƈ Multilanguage Menu Display Ƈ Power Management 2SHUDWLRQPHQXLVDYDLODEOHLQODQJXDJHV(QJOLVK *HUPDQ)UHQFK,WDOLDQ6SDQLVK3RUWXJXHVH'XWFK 6ZHGLVK)LQQLVK3ROLVK+XQJDULDQ5RPDQLDQ 5XVVLDQ&KLQHVH.RUHDQ-DSDQHVH7KDLDQG 7XUNLVKS 7KH 3RZHU PDQDJHPHQW IXQFWLRQ UHGXFHV SRZHU FRQVXPSWLRQDQGPDLQWDLQVWKHODPSOLIHS Ƈ Closed Caption KLVLVDSULQWHGYHUVLRQRIWKHSURJUDPVRXQGRURWKHU 7 LQIRUPDWLRQGLVSOD\HGRQWKHVFUHHQ<RXFDQWXUQRQ WKHIHDWXUHDQGVZLWFKWKHFKDQQHOVS Switchable Interface Terminal 7KHSURMHFWRUSURYLGHVDVZLWFKDEOHLQWHUIDFHWHUPLQDO <RXFDQXVHWKHWHUPLQDODVFRPSXWHULQSXWRUPRQLWRU RXWSXWFRQYHQLHQWO\S 3Note: 7KH2Q6FUHHQ0HQXDQGILJXUHVLQWKLVPDQXDOPD\GLIIHUVOLJKWO\IURPWKHSURGXFW 7KHFRQWHQWVRIWKLVPDQXDODUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH 2 Table of Contents Features and Design . . . . . . . . . . . . . . . . . . .2 Table of Contents . . . . . . . . . . . . . . . . . . . . . .3 To the Owner. . . . . . . . . . . . . . . . . . . . . . . . . .4 Safety Instructions . . . . . . . . . . . . . . . . . . . . .5 $LU&LUFXODWLRQ ,QVWDOOLQJWKH3URMHFWRULQ3URSHU3RVLWLRQ 0RYLQJWKH3URMHFWRU Compliance . . . . . . . . . . . . . . . . . . . . . . . . . . .7 Part Names and Functions . . . . . . . . . . . . . .8 )URQW %DFN %RWWRP 5HDU7HUPLQDO 7RS&RQWURO 5HPRWH&RQWURO 5HPRWH&RQWURO%DWWHU\,QVWDOODWLRQ 5HPRWH&RQWURO2SHUDWLQJ5DQJH 5HPRWH&RQWURO&RGH Installation. . . . . . . . . . . . . . . . . . . . . . . . . . .13 3RVLWLRQLQJWKH3URMHFWRU $GMXVWDEOH)RRW &RQQHFWLQJWRD&RPSXWHU &RQQHFWLQJWR9LGHR(TXLSPHQW &RQQHFWLQJWR&RPSRQHQW9LGHRDQG5*% 6FDUW(TXLSPHQW &RQQHFWLQJWKH$&3RZHU&RUG Basic Operation . . . . . . . . . . . . . . . . . . . . . .18 7XUQLQJ2QWKH3URMHFWRU 7XUQLQJ2IIWKH3URMHFWRU +RZWR2SHUDWHWKH2Q6FUHHQ0HQX 0HQX%DU =RRPDQG)RFXV$GMXVWPHQW $XWR6HWXS)XQFWLRQ .H\VWRQH&RUUHFWLRQ 6RXQG$GMXVWPHQW 5HPRWH&RQWURO2SHUDWLRQ 0DQXDO3&$GMXVWPHQW ,PDJH0RGH6HOHFWLRQ ,PDJH$GMXVWPHQW 6FUHHQ6L]H$GMXVWPHQW Video Input . . . . . . . . . . . . . . . . . . . . . . . . . .36 ,QSXW6RXUFH6HOHFWLRQ9LGHR6YLGHR ,QSXW6RXUFH6HOHFWLRQ &RPSRQHQW5*%6FDUWSLQ 9LGHR6\VWHP6HOHFWLRQ ,PDJH0RGH6HOHFWLRQ ,PDJH$GMXVWPHQW 6FUHHQ6L]H$GMXVWPHQW Setting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .43 6HWWLQJ Information . . . . . . . . . . . . . . . . . . . . . . . . . 57 ,QSXW6RXUFH,QIRUPDWLRQ'LVSOD\ Maintenance and Cleaning . . . . . . . . . . . . .58 :$51,1*LQGLFDWRU &OHDQLQJWKH)LOWHUV 5HVHWWLQJWKH)LOWHU&RXQWHU $WWDFKLQJWKH/HQV&DS &OHDQLQJWKH3URMHFWLRQ/HQV &OHDQLQJWKH3URMHFWRU&DELQHW /DPS5HSODFHPHQW Appendix . . . . . . . . . . . . . . . . . . . . . . . . . . . .63 7URXEOHVKRRWLQJ 0HQX7UHH ,QGLFDWRUVDQG3URMHFWRU&RQGLWLRQ &RPSDWLEOH&RPSXWHU6SHFLILFDWLRQV 7HFKQLFDO6SHFLILFDWLRQV 2SWLRQDO3DUWV 3-/LQN1RWLFH &RQILJXUDWLRQVRI7HUPLQDOV 3,1&RGH1XPEHU0HPR 'LPHQVLRQV Computer Input . . . . . . . . . . . . . . . . . . . . .27 ,QSXW6RXUFH6HOHFWLRQ 5*%&RPSXWHU&RPSXWHU &RPSXWHU6\VWHP6HOHFWLRQ $XWR3&$GMXVWPHQW Trademarks (DFK QDPH RI FRUSRUDWLRQV RU SURGXFWV LQ WKLV ERRN LV HLWKHU D UHJLVWHUHG WUDGHPDUN RU D WUDGHPDUN RI LWV UHVSHFWLYH FRUSRUDWLRQ 3 To the Owner %HIRUHLQVWDOOLQJDQGRSHUDWLQJWKLVSURMHFWRUUHDGWKLV PDQXDOWKRURXJKO\ 7KLVSURMHFWRUSURYLGHVPDQ\FRQYHQLHQWIHDWXUHVDQG IXQFWLRQV2SHUDWLQJWKHSURMHFWRUSURSHUO\HQDEOHV \RXWRPDQDJHWKRVHIHDWXUHVDQGPDLQWDLQVLWLQJRRG FRQGLWLRQIRUPDQ\\HDUVWRFRPH ,PSURSHURSHUDWLRQPD\UHVXOWLQQRWRQO\VKRUWHQLQJWKH SURGXFWOLIHEXWDOVRPDOIXQFWLRQVILUHKD]DUGRURWKHU DFFLGHQWV ,I\RXUSURMHFWRUVHHPVWRRSHUDWHLPSURSHUO\UHDGWKLV PDQXDODJDLQFKHFNRSHUDWLRQVDQGFDEOHFRQQHFWLRQV DQGWU\WKHVROXWLRQVLQWKH³7URXEOHVKRRWLQJ´VHFWLRQRQ SDJHVRIWKLVERRNOHW,IWKHSUREOHPVWLOOSHUVLVWV FRQWDFWWKHGHDOHUZKHUH\RXSXUFKDVHGWKHSURMHFWRURU WKHVHUYLFHFHQWHU CAUTION RISK OF ELECTRIC SHOCK DO NOT OPEN CAUTION: TO REDUCE THE RISK OF ELECTRIC SHOCK, DO NOT REMOVE COVER (OR BACK). NO USER-SERVICEABLE PARTS INSIDE EXCEPT LAMP REPLACEMENT. REFER SERVICING TO QUALIFIED SERVICE PERSONNEL. Safety Precaution WARNING: Ɣ THIS APPARATUS MUST BE EARTHED. Ɣ TO REDUCE THE RISK OF FIRE OR ELECTRIC SHOCK, DO NOT EXPOSE THIS APPLIANCE TO RAIN OR MOISTURE. ±7KLVSURMHFWRUSURGXFHVLQWHQVHOLJKWIURPWKHSURMHFWLRQ OHQV'RQRWVWDUHGLUHFWO\LQWRWKHOHQVRWKHUZLVHH\H GDPDJHFRXOGUHVXOW%HHVSHFLDOO\FDUHIXOWKDWFKLOGUHQ GRQRWVWDUHGLUHFWO\LQWRWKHEHDP ±,QVWDOOWKHSURMHFWRULQDSURSHUSRVLWLRQ2WKHUZLVHLWPD\ UHVXOWLQILUHKD]DUG ±$OORZLQJWKHSURSHUDPRXQWRIVSDFHRQWKHWRSVLGHV DQGUHDURIWKHSURMHFWRUFDELQHWLVFULWLFDOIRUSURSHU DLUFLUFXODWLRQDQGFRROLQJRIWKHXQLW7KHGLPHQVLRQ VKRZQKHUHLQGLFDWHWKHPLQLPXPVSDFHUHTXLUHG ,IWKHSURMHFWRULVWREHEXLOWLQWRDFRPSDUWPHQWRU VLPLODUO\HQFORVHGWKHVHPLQLPXPGLVWDQFHVPXVWEH PDLQWDLQHG ±'RQRWFRYHUWKHYHQWLODWLRQVORWRQWKHSURMHFWRU+HDW EXLOGXSFDQUHGXFHWKHVHUYLFHOLIHRI\RXUSURMHFWRUDQG FDQDOVREHGDQJHURXV 6,'(DQG723 5($5 0.7’(20cm) 7+,66<0%2/,1',&$7(67+$7'$1*(5286 92/7$*(&2167,787,1*$5,6.2)(/(&75,& 6+2&.,635(6(17:,7+,17+,681,7 1.5’(50cm) 7+,66<0%2/,1',&$7(67+$77+(5($5( ,03257$1723(5$7,1*$1'0$,17(1$1&( ,16758&7,216,17+(2:1(5 60$18$/ :,7+7+,681,7 7KH V\PERO PDUN DQG UHF\FOLQJ V\VWHPV GHVFULEHG EHORZ DSSO\WR(8FRXQWULHVDQGGRQRWDSSO\WRFRXQWULHVLQRWKHU DUHDVRIWKHZRUOG <RXUSURGXFWLVGHVLJQHGDQGPDQXIDFWXUHGZLWKKLJKTXDOLW\ PDWHULDOV DQG FRPSRQHQWV ZKLFK FDQ EH UHF\FOHG DQGRU UHXVHG 7KHV\PEROPDUNPHDQVWKDWHOHFWULFDODQGHOHFWURQLF HTXLSPHQWEDWWHULHVDQGDFFXPXODWRUVDWWKHLUHQGRIOLIH VKRXOGEHGLVSRVHGRIVHSDUDWHO\IURP\RXUKRXVHKROG ZDVWH 1RWH ,I D FKHPLFDO V\PERO LV SULQWHG EHQHDWK WKH V\PERO PDUN WKLVFKHPLFDOV\PEROPHDQVWKDWWKHEDWWHU\RUDFFXPXODWRU FRQWDLQV D KHDY\ PHWDO DW D FHUWDLQ FRQFHQWUDWLRQ 7KLV ZLOO EHLQGLFDWHGDVIROORZV+JPHUFXU\&GFDGPLXP3EOHDG ,QWKH(XURSHDQ8QLRQWKHUHDUHVHSDUDWHFROOHFWLRQV\VWHPV IRUXVHGHOHFWULFDODQGHOHFWURQLFHTXLSPHQW EDWWHULHVDQGDFFXPXODWRUV 3OHDVHGLVSRVHRIWKHPFRUUHFWO\DW\RXUORFDO FRPPXQLW\ZDVWHFROOHFWLRQUHF\FOLQJFHQWUH 3OHDVHKHOSXVWRFRQVHUYHWKHHQYLURQPHQW ZHOLYHLQ 4 3’(1m) 3’(1m) ±,IWKHSURMHFWRULVXQXVHGIRUDQH[WHQGHGWLPHXQSOXJ WKHSURMHFWRUIURPWKHSRZHURXWOHW ±'RQRWSURMHFWWKHVDPHLPDJHIRUDORQJWLPH7KH DIWHULPDJHPD\UHPDLQRQWKH/&'SDQHOVE\WKH FKDUDFWHULVWLFRISDQHO CAUTION DO NOT SET THE PROJECTOR IN GREASY, WET, OR SMOKY CONDITIONS SUCH AS IN A KITCHEN TO PREVENT A BREAKDOWN OR A DISASTER. IF THE PROJECTOR COMES IN CONTACT WITH OIL OR CHEMICALS, IT MAY BECOME DETERIORATED. CAUTION 1RWIRUXVHLQDFRPSXWHUURRPDVGHILQHGLQWKH6WDQGDUG IRUWKH3URWHFWLRQRI(OHFWURQLF&RPSXWHU'DWD3URFHVVLQJ (TXLSPHQW$16,1)3$ 1HSHXWrWUHXWLOLVpGDQVXQHVDOOHG¶RUGLQDWHXUVWHOOH TXHGpILQLHGDQVODQRUPH$16,1)3$6WDQGDUG IRU3URWHFWLRQRI(OHFWURQLF&RPSXWHU'DWD3URFHVVLQJ (TXLSPHQW READ AND KEEP THIS OWNER'S MANUAL FOR LATER USE. Safety Instructions $OO WKH VDIHW\ DQG RSHUDWLQJ LQVWUXFWLRQV VKRXOG EH UHDG EHIRUHWKHSURGXFWLVRSHUDWHG 'R QRW LQVWDOO WKH SURMHFWRU QHDU WKH YHQWLODWLRQ GXFW RI DLUFRQGLWLRQLQJHTXLSPHQW 5HDG DOO RI WKH LQVWUXFWLRQV JLYHQ KHUH DQG UHWDLQ WKHP IRUODWHUXVH8QSOXJWKLVSURMHFWRUIURP$&SRZHUVXSSO\ EHIRUH FOHDQLQJ 'R QRW XVH OLTXLG RU DHURVRO FOHDQHUV 8VHDGDPSFORWKIRUFOHDQLQJ 7KLV SURMHFWRU VKRXOG EH RSHUDWHG RQO\ IURP WKH W\SH RI SRZHU VRXUFH LQGLFDWHG RQ WKH PDUNLQJ ODEHO ,I \RX DUHQRWVXUHRIWKHW\SHRISRZHUVXSSOLHGFRQVXOW\RXU DXWKRUL]HGGHDOHURUORFDOSRZHUFRPSDQ\ )ROORZ DOO ZDUQLQJV DQG LQVWUXFWLRQV PDUNHG RQ WKH SURMHFWRU 'RQRWRYHUORDGZDOORXWOHWVDQGH[WHQVLRQFRUGVDVWKLV FDQUHVXOWLQILUHRUHOHFWULFVKRFN'RQRWDOORZDQ\WKLQJ WR UHVW RQ WKH SRZHU FRUG 'R QRW ORFDWH WKLV SURMHFWRU ZKHUHWKHFRUGPD\EHGDPDJHGE\SHUVRQVZDONLQJRQ LW )RU DGGHG SURWHFWLRQ WR WKH SURMHFWRU GXULQJ D OLJKWQLQJ VWRUP RU ZKHQ LW LV OHIW XQDWWHQGHG DQG XQXVHG IRU ORQJ SHULRGV RI WLPH XQSOXJ LW IURP WKH ZDOO RXWOHW 7KLV ZLOO SUHYHQWGDPDJHGXHWROLJKWQLQJDQGSRZHUOLQHVXUJHV 'R QRW H[SRVH WKLV XQLW WR UDLQ RU XVH QHDU ZDWHU IRU H[DPSOHLQDZHWEDVHPHQWQHDUDVZLPPLQJSRROHWF 'R QRW XVH DWWDFKPHQWV QRW UHFRPPHQGHG E\ WKH PDQXIDFWXUHUDVWKH\PD\FDXVHKD]DUGV 'R QRW SODFH WKLV SURMHFWRU RQ DQ XQVWDEOH FDUW VWDQG RU WDEOH 7KH SURMHFWRU PD\ IDOO FDXVLQJ VHULRXV LQMXU\ WR D FKLOG RU DGXOW DQG VHULRXV GDPDJH WR WKH SURMHFWRU 8VH RQO\ ZLWK D FDUW RU VWDQG UHFRPPHQGHG E\ WKH PDQXIDFWXUHU RU VROG ZLWK WKH SURMHFWRU :DOO RU VKHOI PRXQWLQJ VKRXOG IROORZ WKH PDQXIDFWXUHU¶V LQVWUXFWLRQV D Q G V K R X O G X V H D P R X Q W L Q J N L W D S S U R Y H G E \ W K H PDQXIDFWXUHUV $Q DSSOLDQFH DQG FDUW FRPELQDWLRQ VKRXOG EH PRYHG ZLWK FDUH 4XLFN VWRSV H[FHVVLYH IRUFH DQG XQHYHQ VXUIDFHV PD\ FDXVH WKH DSSOLDQFH DQGFDUWFRPELQDWLRQWRRYHUWXUQ 6ORWVDQGRSHQLQJVLQWKHEDFNDQGERWWRPRIWKHFDELQHW DUHSURYLGHGIRUYHQWLODWLRQWRHQVXUHUHOLDEOHRSHUDWLRQRI WKHHTXLSPHQWDQGWRSURWHFWLWIURPRYHUKHDWLQJ 'R QRW DWWHPSW WR VHUYLFH WKLV SURMHFWRU \RXUVHOI DV RSHQLQJ RU UHPRYLQJ &RYHUV PD\ H[SRVH \RX WR GDQJHURXV YROWDJH RU RWKHU KD]DUGV 5HIHU DOO VHUYLFLQJ WRTXDOLILHGVHUYLFHSHUVRQQHO 8QSOXJWKLVSURMHFWRUIURPZDOORXWOHWDQGUHIHUVHUYLFLQJ WR TXDOLILHG VHUYLFH SHUVRQQHO XQGHU WKH IROORZLQJ FRQGLWLRQV D:KHQWKHSRZHUFRUGRUSOXJLVGDPDJHGRUIUD\HG E,IOLTXLGKDVEHHQVSLOOHGLQWRWKHSURMHFWRU F,IWKHSURMHFWRUKDVEHHQH[SRVHGWRUDLQRUZDWHU G,IWKHSURMHFWRUGRHVQRWRSHUDWHQRUPDOO\E\IROORZLQJ WKH RSHUDWLQJ LQVWUXFWLRQV$GMXVW RQO\ WKRVH FRQWUROV WKDW DUH FRYHUHG E\ WKH RSHUDWLQJ LQVWUXFWLRQV DV LPSURSHU DGMXVWPHQW RI RWKHU FRQWUROV PD\ UHVXOW LQ GDPDJH DQG ZLOO RIWHQ UHTXLUH H[WHQVLYH ZRUN E\ D TXDOLILHGWHFKQLFLDQWRUHVWRUHWKHSURMHFWRUWRQRUPDO RSHUDWLRQ H,IWKH SURMHFWRUKDV EHHQ GURSSHG RU WKH FDELQHW KDV EHHQGDPDJHG I :KHQ WKH SURMHFWRU H[KLELWV D GLVWLQFW FKDQJH LQ SHUIRUPDQFHWKLVLQGLFDWHVDQHHGIRUVHUYLFH :KHQ UHSODFHPHQW SDUWV DUH UHTXLUHG EH VXUH WKH VHUYLFHWHFKQLFLDQKDVXVHGUHSODFHPHQWSDUWVVSHFLILHG E\WKHPDQXIDFWXUHUWKDWKDYHWKHVDPHFKDUDFWHULVWLFV DV WKH RULJLQDO SDUW 8QDXWKRUL]HG VXEVWLWXWLRQV PD\ UHVXOWLQILUHHOHFWULFVKRFNRULQMXU\WRSHUVRQV 7KHRSHQLQJVVKRXOGQHYHUEHFRYHUHGZLWKFORWKRURWKHU PDWHULDOVDQGWKHERWWRPRSHQLQJVKRXOGQRWEHEORFNHG E\ SODFLQJ WKH SURMHFWRU RQ D EHG VRID UXJ RU RWKHU VLPLODU VXUIDFH 7KLV SURMHFWRU VKRXOG QHYHU EH SODFHG QHDURURYHUDUDGLDWRURUKHDWUHJLVWHU 8SRQ FRPSOHWLRQ RI DQ\ VHUYLFH RU UHSDLUV WR WKLV SURMHFWRU DVN WKH VHUYLFH WHFKQLFLDQ WR SHUIRUP URXWLQH VDIHW\ FKHFNV WR GHWHUPLQH WKDW WKH SURMHFWRU LV LQ VDIH RSHUDWLQJFRQGLWLRQ 7KLVSURMHFWRUVKRXOGQRWEHSODFHGLQDEXLOWLQLQVWDOODWLRQ VXFKDVDERRNFDVHXQOHVVSURSHUYHQWLODWLRQLVSURYLGHG NOTE FOR CUSTOMERS IN THE US +J/$036,16,'(7+,6352'8&7&217$,1 0(5&85<$1'0867%(5(&<&/('25',6326(' 2)$&&25',1*72/2&$/67$7(25)('(5$/ /$:6 1HYHUSXVKREMHFWVRIDQ\NLQGLQWRWKLVSURMHFWRUWKURXJK FDELQHWVORWVDVWKH\PD\WRXFKGDQJHURXVYROWDJHSRLQWV RU VKRUW RXW SDUWV WKDW FRXOG UHVXOW LQ D ILUH RU HOHFWULF VKRFN1HYHUVSLOOOLTXLGRIDQ\NLQGRQWKHSURMHFWRU 5 Safety Instructions Air Circulation Installing the Projector in Proper Position 2SHQLQJV LQ WKH FDELQHW DUH SURYLGHG IRU YHQWLODWLRQ7R HQVXUHUHOLDEOHRSHUDWLRQRIWKHSURGXFWDQGWRSURWHFWLW IURP RYHUKHDWLQJ WKHVH RSHQLQJV PXVW QRW EH EORFNHG RUFRYHUHG ,QVWDOO WKH SURMHFWRU SURSHUO\ ,PSURSHU ,QVWDOODWLRQ PD\ UHGXFHWKHODPSOLIHDQGFDXVHDILUHKD]DUG CAUTION +RWDLULVH[KDXVWHGIURPWKHH[KDXVWYHQW:KHQXVLQJ RU LQVWDOOLQJ WKH SURMHFWRU WKH IROORZLQJ SUHFDXWLRQV VKRXOGEHWDNHQ ±'RQRWSXWDQ\IODPPDEOHREMHFWRUVSUD\FDQQHDUWKH SURMHFWRUKRWDLULVH[KDXVWHGIURPWKHDLUYHQWV ±.HHSWKHH[KDXVWYHQWDWOHDVW¶PDZD\IURPDQ\ REMHFWV ±'R QRW WRXFK D SHULSKHUDO SDUW RI WKH H[KDXVW YHQW HVSHFLDOO\VFUHZVDQGPHWDOOLFSDUWV7KHVHDUHDVZLOO EHFRPHKRWZKLOHWKHSURMHFWRULVEHLQJXVHG ±'RQRWSXWDQ\WKLQJRQWKHFDELQHW2EMHFWVSXWRQWKH FDELQHWZLOOQRWRQO\JHWGDPDJHGEXWDOVRPD\FDXVH ILUHKD]DUGE\KHDW 20° &RROLQJ IDQV DUH SURYLGHG WR FRRO GRZQ WKH SURMHFWRU 7KH IDQV¶ UXQQLQJ VSHHG LV FKDQJHG DFFRUGLQJ WR WKH WHPSHUDWXUHLQVLGHWKHSURMHFWRU $LU,QWDNH9HQW ([KDXVW9HQW +RWDLUH[KDXVW 6 $LU,QWDNH9HQW 20° 30° 'RQRWWLOWWKHSURMHFWRUPRUHWKDQ GHJUHHVIURPVLGHWRVLGH 'RQRWWLOWWKHSURMHFWRUPRUHWKDQ GHJUHHVIURPDERYHDQGEHORZ 30° 'RQRWSRLQWWKHSURMHFWRUXSWRSURMHFWDQ LPDJH 'RQRWSRLQWWKHSURMHFWRUGRZQWRSURMHFW DQLPDJH 'RQRWSXWWKHSURMHFWRURQHLWKHUVLGHWR SURMHFWDQLPDJH Moving the Projector :KHQPRYLQJWKHSURMHFWRUUHSODFHWKHOHQVFDSDQG UHWUDFWDGMXVWDEOHIRRWWRSUHYHQWGDPDJHWRWKHOHQVDQG FDELQHW :KHQWKHSURMHFWRULVQRWLQXVHIRUDQH[WHQGHGSHULRG SXWLWLQWRDVXLWDEOHFDVH CAUTION IN CARRYING OR TRANSPORTING THE PROJECTOR ±'RQRWGURSRUEXPSWKHSURMHFWRURWKHUZLVHGDPDJHV RUPDOIXQFWLRQVPD\UHVXOW ±:KHQFDUU\LQJWKHSURMHFWRUXVHDVXLWDEOHFDUU\LQJFDVH ±'RQRWWUDQVSRUWWKHSURMHFWRUE\FRXULHURUDQ\RWKHU WUDQVSRUWVHUYLFHLQDQXQVXLWDEOHWUDQVSRUWFDVH7KLV PD\FDXVHGDPDJHWRWKHSURMHFWRU)RULQIRUPDWLRQ DERXWWUDQVSRUWLQJWKHSURMHFWRUE\FRXULHURUDQ\RWKHU WUDQVSRUWVHUYLFHFRQVXOW\RXUGHDOHU ±'RQRWSXWWKHSURMHFWRULQDFDVHEHIRUHWKHSURMHFWRULV FRROHGHQRXJK Compliance Federal Communications Commission Notice 1RWH7KLVHTXLSPHQWKDVEHHQWHVWHGDQGIRXQGWRFRPSO\ZLWKWKHOLPLWVIRUD&ODVV%GLJLWDOGHYLFHSXUVXDQW WR 3DUW RI WKH )&& 5XOHV 7KHVH OLPLWV DUH GHVLJQHG WR SURYLGH UHDVRQDEOH SURWHFWLRQ DJDLQVW KDUPIXO LQWHUIHUHQFH LQ D UHVLGHQWLDO LQVWDOODWLRQ 7KLV HTXLSPHQW JHQHUDWHV XVHV DQG FDQ UDGLDWH UDGLR IUHTXHQF\ HQHUJ\ DQG LI QRW LQVWDOOHG DQG XVHG LQ DFFRUGDQFH ZLWK WKH LQVWUXFWLRQV PD\ FDXVH KDUPIXO LQWHUIHUHQFH WR UDGLR FRPPXQLFDWLRQV +RZHYHU WKHUH LV QR JXDUDQWHH WKDW LQWHUIHUHQFH ZLOO QRW RFFXU LQ D SDUWLFXODU LQVWDOODWLRQ ,I WKLV HTXLSPHQW GRHV FDXVH KDUPIXO LQWHUIHUHQFH WR UDGLR RU WHOHYLVLRQ UHFHSWLRQ ZKLFK FDQ EH GHWHUPLQHGE\WXUQLQJWKHHTXLSPHQWRIIDQGRQWKHXVHULVHQFRXUDJHGWRWU\WRFRUUHFWWKHLQWHUIHUHQFHE\ RQHRUPRUHRIWKHIROORZLQJPHDVXUHV ±5HRULHQWRUUHORFDWHWKHUHFHLYLQJDQWHQQD ±,QFUHDVHWKHVHSDUDWLRQEHWZHHQWKHHTXLSPHQWDQGUHFHLYHU ±&RQQHFWWKHHTXLSPHQWLQWRDQRXWOHWRQDFLUFXLWGLIIHUHQWIURPWKDWWRZKLFKWKHUHFHLYHULVFRQQHFWHG ±&RQVXOWWKHGHDOHURUDQH[SHULHQFHGUDGLR79WHFKQLFLDQIRUKHOS 8VHRIVKLHOGHGFDEOHLVUHTXLUHGWRFRPSO\ZLWKFODVV%OLPLWVLQ6XESDUW%RI3DUWRI)&&5XOHV 'RQRWPDNHDQ\FKDQJHVRUPRGLILFDWLRQVWRWKHHTXLSPHQWXQOHVVRWKHUZLVHVSHFLILHGLQWKHLQVWUXFWLRQV,I VXFKFKDQJHVRUPRGLILFDWLRQVVKRXOGEHPDGH\RXFRXOGEHUHTXLUHGWRVWRSRSHUDWLRQRIWKHHTXLSPHQW 0RGHO1XPEHU 3/&;53/&;5 7UDGH1DPH 6DQ\R 5HVSRQVLEOHSDUW\ 6$1<2),6+(5&203$1< $GGUHVV 3OXPPHU6WUHHW&KDWVZRUWK&DOLIRUQLD 7HOHSKRQH1R AC Power Cord Requirement 7KH$&3RZHU&RUGVXSSOLHGZLWKWKLVSURMHFWRUPHHWVWKHUHTXLUHPHQWIRUXVHLQWKHFRXQWU\\RXSXUFKDVHGLW AC Power Cord for the United States and Canada: $&3RZHU&RUGXVHGLQWKH8QLWHG6WDWHVDQG&DQDGDLVOLVWHGE\WKH8QGHUZULWHUV /DERUDWRULHV8/DQGFHUWLILHGE\WKH&DQDGLDQ6WDQGDUG$VVRFLDWLRQ&6$ $&3RZHU&RUGKDVDJURXQGLQJW\SH$&OLQHSOXJ7KLVLVDVDIHW\IHDWXUHWREHVXUHWKDWWKH SOXJZLOOILWLQWRWKHSRZHURXWOHW'RQRWWU\WRGHIHDWWKLVVDIHW\IHDWXUH6KRXOG\RXEHXQDEOH WRLQVHUWWKHSOXJLQWRWKHRXWOHWFRQWDFW\RXUHOHFWULFLDQ GROUND AC Power Cord for the United Kingdom: 7KLVFRUGLVDOUHDG\ILWWHGZLWKDPRXOGHGSOXJLQFRUSRUDWLQJDIXVHWKHYDOXHRIZKLFKLVLQGLFDWHGRQWKHSLQ IDFHRIWKHSOXJ6KRXOGWKHIXVHQHHGWREHUHSODFHGDQ$67$DSSURYHG%6IXVHPXVWEHXVHGRIWKH VDPHUDWLQJPDUNHGWKXV ,IWKHIXVHFRYHULVGHWDFKDEOHQHYHUXVHWKHSOXJZLWKWKHFRYHURPLWWHG,ID UHSODFHPHQWIXVHFRYHULVUHTXLUHGHQVXUHLWLVRIWKHVDPHFRORXUDVWKDWYLVLEOHRQWKHSLQIDFHRIWKHSOXJ LHUHGRURUDQJH)XVHFRYHUVDUHDYDLODEOHIURPWKH3DUWV'HSDUWPHQWLQGLFDWHGLQ\RXU8VHU,QVWUXFWLRQV ,IWKHSOXJVXSSOLHGLVQRWVXLWDEOHIRU\RXUVRFNHWRXWOHWLWVKRXOGEHFXWRIIDQGGHVWUR\HG 7KHHQGRIWKHIOH[LEOHFRUGVKRXOGEHVXLWDEO\SUHSDUHGDQGWKHFRUUHFWSOXJILWWHG WARNING : A PLUG WITH BARED FLEXIBLE CORD IS HAZARDOUS IF ENGAGED IN A LIVE SOCKET OUTLET. 7KH:LUHVLQWKLVPDLQVOHDGDUHFRORXUHGLQDFFRUGDQFHZLWKWKHIROORZLQJFRGH *UHHQDQG\HOORZ(DUWK %OXH 1HXWUDO %URZQ /LYH $VWKHFRORXUVRIWKHZLUHVLQWKHPDLQVOHDGRIWKLVDSSDUDWXVPD\QRWFRUUHVSRQGZLWKWKHFRORXUHGPDUNLQJV LGHQWLI\LQJWKHWHUPLQDOVLQ\RXUSOXJSURFHHGDVIROORZV 7KHZLUHZKLFKLVFRORXUHGJUHHQDQG\HOORZPXVWEHFRQQHFWHGWRWKHWHUPLQDOLQWKHSOXJZKLFKLVPDUNHGE\ WKHOHWWHU(RUE\WKHVDIHW\HDUWKV\PERO RUFRORXUHGJUHHQRUJUHHQDQG\HOORZ 7KH ZLUH ZKLFK LV FRORXUHG EOXH PXVW EH FRQQHFWHG WR WKH WHUPLQDO ZKLFK LV PDUNHG ZLWK WKH OHWWHU 1 RU FRORXUHGEODFN 7KH ZLUH ZKLFK LV FRORXUHG EURZQ PXVW EH FRQQHFWHG WR WKH WHUPLQDO ZKLFK LV PDUNHG ZLWK WKH OHWWHU / RU FRORXUHGUHG WARNING: THIS APPARATUS MUST BE EARTHED. ASA THE SOCKET-OUTLET SHOULD BE INSTALLED NEAR THE EQUIPMENT AND EASILY ACCESSIBLE. 7 Part Names and Functions Top controls and Indicators Zoom Ring Front Focus Ring Speaker Infrared Remote Receiver Projection Lens Lens Cap 6HHSDJHIRUDWWDFKLQJ CAUTION 'RQRWWXUQRQDSURMHFWRUZLWKOHQVFDSDWWDFKHG+LJK WHPSHUDWXUHIURPOLJKWEHDPPD\GDPDJHOHQVFDSDQG UHVXOWLQILUHKD]DUG Air Intake Vent Lamp Cover Back Terminals and Connectors LAN Connection Terminal Power Cord Connector Exhaust Vents CAUTION +RWDLULVH[KDXVWHGIURPWKHH[KDXVWYHQW'RQRWSXW KHDWVHQVLWLYHREMHFWVQHDUWKLVVLGH Filters Adjustable Foot ¼ Bottom 31RWH /$1&RQQHFWLRQ7HUPLQDOLVIRUWKH1HWZRUNIXQFWLRQ 5HIHUWRWKHRZQHU¶VPDQXDORI³1HWZRUN6HWXSDQG 2SHUDWLRQ´ ¼Kensington Security Slot 7KLVVORWLVIRUD.HQVLQJWRQORFNXVHGWRGHWHUWKHIWRI WKHSURMHFWRU ¼ .HQVLQJWRQLVDUHJLVWHUHGWUDGHPDUNRI$&&2%UDQGV &RUSRUDWLRQ 8 Part Names and Functions Rear Terminal CONTROL PORT :KHQWKHSURMHFWRULVFRQWUROOHGE\DFRPSXWHU FRQQHFWWRWKLVMDFNZLWKVHULDOFRQWUROFDEOH AUDIO OUT (VARIABLE) COMPUTER IN 1 /S-VIDEO IN / COMPONENT IN &RQQHFWDQDORJ5*%RXWSXWVLJQDOIURPD FRPSXWHU69,'(2RXWSXWVLJQDOIURPYLGHR HTXLSPHQWRU5*%VFDUWSLQYLGHRRXWSXWRU FRPSRQHQWYLGHRRXWSXWWRWKLVWHUPLQDOSS COMPUTER IN 2 / MONITOR OUT ±&RQQHFWDQDORJ5*%RXWSXWVLJQDOIURPD FRPSXWHUWRWKLVWHUPLQDOS ±7KLVWHUPLQDOFDQEHXVHGWRRXWSXWWKHLQFRPLQJ DQDORJ5*%DQG&RPSRQHQWVLJQDOIURP &20387(5,169,'(2,1&20321(17,1 WHUPLQDOWRWKHRWKHUPRQLWRUSS &RQQHFWDQH[WHUQDODXGLRDPSOLILHUWRWKLVMDFN SS 7KLVWHUPLQDORXWSXWVVRXQGIURP$8',2,1 WHUPLQDO VIDEO IN &RQQHFWWKHFRPSRVLWHYLGHRRXWSXWVLJQDOWRWKLV MDFNS LAN Connection Terminal &RQQHFWWKH/$1FDEOHUHIHUWRWKHRZQHU¶V PDQXDORI³1HWZRUN6HWXSDQG2SHUDWLRQ´ AUDIO IN &RQQHFWWKHDXGLRRXWSXWVLJQDOIURPFRPSXWHURU YLGHRHTXLSPHQWWRWKLVMDFNSS 9 Part Names and Functions Top Control SELECT button ±([HFXWHWKHVHOHFWHGLWHPS ±([SDQGRUFRPSUHVVWKHLPDJHLQWKH'LJLWDO ]RRPPRGHS POINT ŸźŻŹ (VOLUME +/–) buttons ±6HOHFWDQLWHPRUDGMXVWWKHYDOXHLQWKH 2Q6FUHHQ0HQXS ±3DQWKHLPDJHLQWKH'LJLWDO]RRPPRGH S ±$GMXVWWKHYROXPHOHYHO3RLQWŻŹEXWWRQV S AUTO SETUP button ([HFXWHWKHVHWWLQJRI$XWRVHWXSLQFOXGHV,QSXW VHDUFK$XWR3&DGMDQG$XWR.H\VWRQHIXQFWLRQV LQWKHVHWWLQJPHQXSS ON/STAND–BY button 7XUQWKHSURMHFWRURQRURIISS 10 POWER indicator ±/LJKWVUHGZKHQWKHSURMHFWRULVLQVWDQGE\PRGH ±/LJKWVJUHHQGXULQJRSHUDWLRQV ±%OLQNVJUHHQLQWKH3RZHUPDQDJHPHQWPRGH S MENU button 2SHQRUFORVHWKH2Q6FUHHQ0HQXS LAMP REPLACE indicator /LJKWV\HOORZZKHQWKHSURMHFWLRQODPSUHDFKHVLWV HQGRIOLIHSS WARNING indicator ±/LJKWVUHGZKHQWKHSURMHFWRUGHWHFWVDQ DEQRUPDOFRQGLWLRQ ±%OLQNVUHGZKHQWKHLQWHUQDOWHPSHUDWXUHRIWKH SURMHFWRUH[FHHGVWKHRSHUDWLQJUDQJHSS Part Names and Functions Remote Control ON/STAND-BY button 7XUQWKHSURMHFWRURQRURIISS AUTO SET button ([HFXWHWKHVHWWLQJRI$XWRVHWXSLQFOXGHV,QSXWVHDUFK$XWR3&DGM DQG$XWR.H\VWRQHIXQFWLRQVLQWKHVHWWLQJPHQX SS COMPUTER 1/2 buttons 6HOHFWWKH&20387(5RU&20387(5LQSXWVRXUFH SS VIDEO button 6HOHFWWKH9,'(2LQSXWVRXUFHS S-VIDEO button 6HOHFWWKH69,'(2LQSXWVRXUFHS Point ŸźŻŹEXWWRQV ±6HOHFWDQLWHPRUDGMXVWWKHYDOXHLQWKH2Q6FUHHQ0HQXS ±3DQWKHLPDJHLQWKH'LJLWDO]RRPPRGHS SCREEN button 6HOHFWDVFUHHQPRGHSS MENU button 2SHQRUFORVHWKH2Q6FUHHQ0HQXS FREEZE button )UHH]HWKHSLFWXUHRQWKHVFUHHQS NO SHOW button 7HPSRUDULO\WXUQRIIWKHLPDJHRQWKHVFUHHQS D.ZOOM Ÿźbuttons =RRPLQDQGRXWWKHLPDJHVSS VOLUME +/- buttons $GMXVWWKHYROXPHOHYHOS MUTE button 0XWHWKHVRXQGS IMAGE button 6HOHFWWKHLPDJHPRGHSS P-TIMER button 2SHUDWHWKH3WLPHUIXQFWLRQS LAMP button 6HOHFWDODPSPRGHSS INFO. button 2SHUDWHWKHLQIRUPDWLRQIXQFWLRQS KEYSTONE button &RUUHFWNH\VWRQHGLVWRUWLRQSS SELECT button ±([HFXWHWKHVHOHFWHGLWHPS ±([SDQGRUFRPSUHVVWKHLPDJHLQ'LJLWDO]RRPPRGHS COMPONENT button 6HOHFWWKH&20321(17LQSXWVRXUFHS 3Note: 7RHQVXUHVDIHRSHUDWLRQSOHDVHREVHUYHWKHIROORZLQJSUHFDXWLRQV ± 'RQRWEHQGGURSRUH[SRVHWKHUHPRWHFRQWUROWRPRLVWXUHRUKHDW ± )RUFOHDQLQJXVHDVRIWGU\FORWK'RQRWDSSO\EHQ]HQHWKLQQHUVSUD\ RUDQ\FKHPLFDOPDWHULDO 11 Part Names and Functions Remote Control Battery Installation 1 2SHQWKHEDWWHU\ FRPSDUWPHQWOLG 2 ,QVWDOOQHZEDWWHULHV LQWRWKHFRPSDUWPHQW 3 5HSODFHWKH FRPSDUWPHQWOLG Two AAA size batteries )RUFRUUHFWSRODULW\ DQG±EHVXUH EDWWHU\WHUPLQDOVDUH LQFRQWDFWZLWKSLQVLQ FRPSDUWPHQW 7RHQVXUHVDIHRSHUDWLRQSOHDVHREVHUYHWKHIROORZLQJSUHFDXWLRQV Ɣ 8VHWZR$$$RU/5W\SHDONDOLQHEDWWHULHV Ɣ $OZD\VUHSODFHEDWWHULHVLQVHWV Ɣ 'RQRWXVHDQHZEDWWHU\ZLWKDXVHGEDWWHU\ Ɣ $YRLGFRQWDFWZLWKZDWHURUOLTXLG Ɣ 'RQRWH[SRVHWKHUHPRWHFRQWUROWRPRLVWXUHRUKHDW Ɣ 'RQRWGURSWKHUHPRWHFRQWURO Ɣ ,IWKHEDWWHU\KDVOHDNHGRQWKHUHPRWHFRQWUROFDUHIXOO\ZLSHWKHFDVHFOHDQDQGLQVWDOOQHZEDWWHULHV Ɣ 5LVNRIDQH[SORVLRQLIEDWWHU\LVUHSODFHGE\DQLQFRUUHFWW\SH Ɣ 'LVSRVHRIXVHGEDWWHULHVDFFRUGLQJWRWKHLQVWUXFWLRQVRU\RXUORFDOGLVSRVDOUXOHRUJXLGHOLQHV Remote Control Operating Range 3RLQW WKH UHPRWH FRQWURO WRZDUG WKH SURMHFWRU ,QIUDUHG 5HPRWH 5HFHLYHU ZKHQ SUHVVLQJ WKH EXWWRQV 0D[LPXP RSHUDWLQJ UDQJH IRU WKH UHPRWH FRQWURO LV DERXW P DQGGHJUHHVLQIURQWRIWKHSURMHFWRU P 5HPRWHFRQWURO Remote Control Code 7KH GLIIHUHQW UHPRWH FRQWURO FRGHV &RGH ±&RGH DUH DVVLJQHGWRWKLVSURMHFWRU6ZLWFKLQJWKHUHPRWH FRQWURO FRGHV SUHYHQWV LQWHUIHUHQFH IURP RWKHU UHPRWH FRQWUROVZKHQVHYHUDOSURMHFWRUVRUYLGHRHTXLSPHQW QH[W WR HDFK RWKHU DUH RSHUDWHG DW WKH VDPH WLPH &KDQJH WKHUHPRWHFRQWUROFRGHIRUWKHSURMHFWRUILUVWEHIRUH FKDQJLQJ WKDW IRU WKH UHPRWH FRQWURO 6HH 5HPRWH FRQWURO LQWKH6HWWLQJ0HQXRQSDJH 3UHVVDQGKROGWKH0(18DQG,0$*(EXWWRQVIRUPRUH WKDQILYHVHFRQGVWRVZLWFKEHWZHHQWKHCode 1DQGCode 27KHLQLWLDOFRGHLVVHWWRCode 1 MENU button IMAGE button 12 Installation Positioning the Projector )RUSURMHFWRUSRVLWLRQLQJVHHWKHILJXUHVEHORZ7KHSURMHFWRUVKRXOGEHVHWSHUSHQGLFXODUO\WRWKHSODQHRIWKH VFUHHQ 3Note: 7KH EULJKWQHVV LQ WKH URRP KDV D JUHDW LQIOXHQFH RQ SLFWXUH TXDOLW\ ,W LV UHFRPPHQGHG WR OLPLW DPELHQW OLJKWLQJLQRUGHUWRREWDLQWKHEHVWLPDJH $OOPHDVXUHPHQWVDUHDSSUR[LPDWHDQGPD\YDU\IURPWKHDFWXDOVL]HV 38.7'(11.80m) A:B = 6:1 (Inch Diagonal) 32.3'(9.84m) 300"(tele ) 300"(wide) 21.5'(6.55m) Max. Zoom 16.1'(4.90m) 200" 250 10.7'(3.26m) 150" 4.3'(1.30m) Min. Zoom 167 A 100" 125 40" 83 (Center) B Screen Size (W x H) mm 4 : 3 aspect ratio 40” 100” 150” 200” 300” 813 x 610 2032 x 1524 3048 x 2286 4064 x 3048 6096 x 4572 Zoom (max) 4.3'(1.30m) 10.7'(3.26m) 16.1'(4.90m) 21.5'(6.55m) 32.3'(9.84m) Zoom (min) 5.1'(1.55m) 12.9'(3.92m) 19.4'(5.90m) 25.8(7.87m) 38.7'(11.80m) Adjustable Foot 3URMHFWLRQDQJOHFDQEHDGMXVWHGXSWRGHJUHHVZLWK WKHDGMXVWDEOHIRRW /LIWWKHIURQWRIWKHSURMHFWRUDQGSXVKWKHIRRWORFN ODWFKRQWKHSURMHFWRU 5HOHDVHWKHIRRWORFNODWFKWRORFNWKHDGMXVWDEOHIRRW DQGURWDWHWKHDGMXVWDEOHIRRWWRDGMXVWWKHSRVLWLRQDQG WLOW 7RUHWUDFWWKHDGMXVWDEOHIRRWOLIWWKHIURQWRIWKH SURMHFWRUDQGSXVKDQGXQGRWKHIRRWORFNODWFK .H\VWRQHGLVWRUWLRQRIWKHSURMHFWHGLPDJHFDQEH FRUUHFWHGE\PHQXRSHUDWLRQVHHSDJHV )RRW/RFN/DWFK $GMXVWDEOH)RRW 13 Installation Connecting to a Computer Cables used for connection 9*$&DEOHV0LQL'VXESLQ2QO\RQHFDEOHLVVXSSOLHG $XGLR&DEOHV (2QHFDEOHLVVXSSOLHGRWKHUFDEOHVDUHQRWVXSSOLHGZLWKWKHSURMHFWRU $XGLR2XWSXW 0RQLWRU 2XWSXW 0RQLWRU,QSXW RU 0RQLWRU2XWSXW ([WHUQDO$XGLR(TXLSPHQW 9*$ FDEOH 9*$ FDEOH $XGLRFDEOH VWHUHR $XGLR,QSXW &20387(5,1 69,'(2,1 &20321(17,1 &20387(5,1 021,725287 7KLVWHUPLQDOLVVZLWFKDEOH 6HWXSWKHWHUPLQDODV HLWKHU&RPSXWHULQSXWRU 0RQLWRURXWSXW6HH3DJH $XGLRFDEOH VWHUHR $8',2287 VWHUHR $8',2,1 3Note: ,QSXWVRXQGWRWKH$8',2,1WHUPLQDOZKHQXVLQJWKH&20387(5,169,'(2,1&20321(17,1 DQGWKH&20387(5,1021,725287WHUPLQDOVDVLQSXW :KHQWKH$8',2287LVSOXJJHGLQWKHSURMHFWRU VEXLOWLQVSHDNHULVQRWDYDLODEOH :KHQWKHFDEOHLVRIWKHORQJHUYDULHW\LWLVDGYLVDEOHWRXVHWKH&20387(5,169,'(2,1&20321(17,1DQG QRWWKH&20387(5,1021,725287 8QSOXJWKHSRZHUFRUGVRIERWKWKHSURMHFWRUDQGH[WHUQDOHTXLSPHQWIURPWKH$&RXWOHWEHIRUHFRQQHFWLQJ FDEOHV 14 Installation Connecting to Video Equipment Cables used for connection 9LGHR&DEOH 69LGHR&DEOH 69LGHR9*$&DEOH $XGLR&DEOHV0LQL3OXJVWHUHR &DEOHVDUHQRWVXSSOLHGZLWKWKHSURMHFWRU ([WHUQDO$XGLR(TXLSPHQW 69LGHR2XWSXW $XGLR2XWSXW $XGLR,QSXW &RPSRVLWH9LGHRDQG$XGLR2XWSXW 69LGHRFDEOH $XGLRFDEOH $XGLRFDEOH VWHUHR VWHUHR 9LGHRFDEOH 69LGHR9*$ FDEOH &20387(5,1 69,'(2,1 &20321(17,1 $8',2,1 $8',2287 VWHUHR 9,'(2,1 3Note: :KHQWKH$8',2287LVSOXJJHGLQWKHSURMHFWRU VEXLOWLQVSHDNHULVQRWDYDLODEOH 6HHSDJHIRURUGHULQJRSWLRQDOFDEOHV 8QSOXJWKHSRZHUFRUGVRIERWKWKHSURMHFWRUDQGH[WHUQDOHTXLSPHQWIURPWKH$&RXWOHWEHIRUHFRQQHFWLQJ FDEOHV 15 Installation Connecting to Component Video and RGB ( Scart) Equipment Cables used for connection $XGLR&DEOHV0LQL3OXJVWHUHR 6FDUW9*$&DEOH &RPSRQHQW&DEOH &RPSRQHQW9*$&DEOH &DEOHVDUHQRWVXSSOLHGZLWKWKLVSURMHFWRU $XGLR2XWSXW &RPSRQHQW9LGHR2XWSXW <3E&E3U&U 5*%6FDUW SLQ2XWSXW &RPSRQHQW FDEOH $XGLR,QSXW ([WHUQDO$XGLR(TXLSPHQW 6FDUW9*$ FDEOH &RPSRQHQW 9*$FDEOH $XGLRFDEOH VWHUHR &20387(5,169,'(2,1&20321(17,1 $XGLRFDEOH VWHUHR $8',2 287 VWHUHR $8',2,1 3Note: :KHQWKH$8',2287LVSOXJJHGLQWKHSURMHFWRU VEXLOWLQVSHDNHULVQRWDYDLODEOH 6HHSDJHIRURUGHULQJRSWLRQDOFDEOHV 8QSOXJWKHSRZHUFRUGVRIERWKWKHSURMHFWRUDQGH[WHUQDOHTXLSPHQWIURPWKH$&RXWOHWEHIRUHFRQQHFWLQJ FDEOHV 16 Installation Connecting the AC Power Cord 7KLV SURMHFWRU XVHV QRPLQDO LQSXW YROWDJHV RI 9 RU ±9$&DQGLWDXWRPDWLFDOO\VHOHFWVWKHFRUUHFWLQSXW YROWDJH ,W LV GHVLJQHG WR ZRUN ZLWK VLQJOHSKDVH SRZHU V\VWHPV KDYLQJ D JURXQGHG QHXWUDO FRQGXFWRU 7R UHGXFH WKHULVNRIHOHFWULFDOVKRFNGRQRWSOXJLQWRDQ\RWKHUW\SHRI SRZHUV\VWHP ,I \RX DUH QRW VXUH RI WKH W\SH RI SRZHU EHLQJ VXSSOLHG FRQVXOW\RXUDXWKRUL]HGGHDOHURUVHUYLFHVWDWLRQ &RQQHFW WKH SURMHFWRU ZLWK DOO SHULSKHUDO HTXLSPHQW EHIRUH WXUQLQJWKHSURMHFWRURQ &RQQHFW WKH $& SRZHU FRUG VXSSOLHG WR WKH SURMHFWRU CAUTION 7KH$&RXWOHWPXVWEHQHDUWKLVHTXLSPHQWDQGPXVWEH HDVLO\DFFHVVLEOH 3Note 8QSOXJWKH$&SRZHUFRUGZKHQWKHSURMHFWRULVQRW LQXVH:KHQWKLVSURMHFWRULVFRQQHFWHGWRDQRXWOHW ZLWKWKH$&SRZHUFRUGLWLVLQ6WDQGE\PRGHDQG FRQVXPHVDOLWWOHHOHFWULFSRZHU NOTE ON THE POWER CORD $&SRZHUFRUGPXVWPHHWUHTXLUHPHQWRIWKHFRXQWU\ZKHUH\RXXVHWKHSURMHFWRU &RQILUPWKH$&SOXJW\SHZLWKWKHFKDUWEHORZDQGSURSHU$&SRZHUFRUGPXVWEHXVHG ,IVXSSOLHG$&SRZHUFRUGGRHVQRWPDWFK\RXU$&RXWOHWFRQWDFW\RXUVDOHVGHDOHU Projector side AC outlet side For the U.S.A. and Canada For Continental Europe For the U.K. *URXQG 7RSRZHUFRUG FRQQHFWRURQ\RXU SURMHFWRU 7RWKH$&RXWOHW (120 V AC) 7RWKH$&RXWOHW (200 - 240 V AC) 7RWKH$&RXWOHW (200 - 240 V AC) 17 Basic Operation Turning On the Projector 1 &RPSOHWHSHULSKHUDOFRQQHFWLRQVZLWKDFRPSXWHU 9&5HWFEHIRUHWXUQLQJRQWKHSURMHFWRU 2 &RQQHFWWKHSURMHFWRU¶V$&SRZHUFRUGLQWRDQ$& RXWOHW7KH32:(5LQGLFDWRUOLJKWVUHG2SHQWKHOHQV FDSVHHSDJHV 3 3UHVVWKH216<$1'%<EXWWRQRQWKHWRSFRQWURORU RQWKHUHPRWHFRQWURO7KH32:(5LQGLFDWRUOLJKWV JUHHQDQGWKHFRROLQJIDQVVWDUWWRRSHUDWH7KH SUHSDUDWLRQGLVSOD\DSSHDUVRQWKHVFUHHQDQGWKH FRXQWGRZQVWDUWV 4 5 $IWHUWKHFRXQWGRZQWKHLQSXWVRXUFHWKDWZDVVHOHFWHG WKHODVWWLPHDQGWKHODPSFRQWUROVWDWXVLFRQVHHSDJH DSSHDURQWKHVFUHHQ ,IWKHUHLVQRVLJQDOLQSXWZKHQVWDUWRQWKHSURMHFWRU RUWKHFXUUHQWVLJQDOLVPLVVHGZKLOHRSHUDWLQJWKH SURMHFWRUWKH9LGHR3&VHOHFWLRQZLQGRZZLOOEH GLVSOD\HGRQWKHVFUHHQSOHDVHPRYHWKHSRLQWHUWR LQSXWVRXUFHGHVLUHGE\SUHVVLQJWKH3RLQWŸźEXWWRQV DQGSUHVVWKH6(/(&7EXWWRQ$QGWKHQIROORZWKH LQSXWVLJQDOJXLGDQFHZLQGRZWRFRUUHFWWKHVLJQDODQG FRQQHFWLRQ 16 7KHSUHSDUDWLRQGLVSOD\ZLOOGLVDSSHDU DIWHUVHFRQGV Selected Input Source and Lamp Control Video /DPSFRQWUROVWDWXV 6HHSDJHIRU/DPSFRQWUROVWDWXV 3Note: 7KH)LOWHUZDUQLQJDQG/DPSUHSODFHPHQW LFRQVPD\DSSHDURQWKHVFUHHQ GHSHQGLQJRQWKHXVDJHVWDWHRIWKH SURMHFWRU Video / PC selection window Project Video ,IWKHSURMHFWRULVORFNHGZLWKD3,1FRGH3,1FRGHLQSXW GLDORJER[ZLOODSSHDU(QWHUWKH3,1FRGHDVLQVWUXFWHG RQWKHQH[WSDJH Project Computer Cancel Input signal guidance window 1RVLJQDO &XUUHQW,QSXWVHWWLQJ9LGHR ,V VLJQDO SURFHVVHG FRUUHFWO\" ,V FDEOH FRQQHFWHG SURSHUO\" Video / PC selection window Project Video 3Note: :KHQWKH/RJRVHOHFWIXQFWLRQLVVHWWROffWKHORJRZLOO QRWEHVKRZQRQWKHVFUHHQS :KHQ Countdown off RU Off LV VHOHFWHG LQ WKH 'LVSOD\ IXQFWLRQ WKH SUHSDUDWLRQ GLVSOD\ ZLOO QRW EH VKRZQ RQ WKHVFUHHQS :KHQWKH,QSXW6HDUFKIXQFWLRQLVVHWWROn2WKHLQSXW VLJQDOZLOOEHVHDUFKHGDXWRPDWLFDOO\S :KHQOffLVVHOHFWHGLQWKH'LVSOD\IXQFWLRQWKH9LGHR 3& VHOHFWLRQ ZLQGRZ DQG WKH LQSXW VLJQDO JXLGDQFH ZLQGRZDUHQRWVKRZQRQWKHVFUHHQS 18 Project Computer Cancel Input signal guidance window 1RVLJQDO &XUUHQW,QSXWVHWWLQJ5*% ,V VLJQDO SURFHVVHG FRUUHFWO\" ,V FDEOH FRQQHFWHG SURSHUO\" Basic Operation Enter a PIN code 8VHWKH3RLQWŸźEXWWRQVWRHQWHUDQXPEHU3UHVVWKH 3RLQWŻŹEXWWRQVWRIL[WKHQXPEHUDQGPRYHWKHUHG IUDPHSRLQWHUWRWKHQH[WER[7KHQXPEHUFKDQJHVWR³¼´ ,I\RXIL[HGDQLQFRUUHFWQXPEHUXVHWKH3RLQWŻŹEXWWRQV WRPRYHWKHSRLQWHUWRWKHQXPEHU\RXZDQWWRFRUUHFWDQG WKHQHQWHUWKHFRUUHFWQXPEHU 5HSHDWWKLVVWHSWRFRPSOHWHHQWHULQJDIRXUGLJLWQXPEHU $IWHUHQWHULQJWKHIRXUGLJLWQXPEHUPRYHWKHSRLQWHUWRSet 3UHVVWKH6(/(&7EXWWRQVRWKDW\RXFDQVWDUWWRRSHUDWH WKHSURMHFWRU PIN Code Input Dialog Box $IWHUWKH2.LFRQGLVDSSHDUV \RXFDQRSHUDWHWKHSURMHFWRU ,I\RXHQWHUHGDQLQFRUUHFW3,1FRGHPIN codeDQGWKH QXPEHU¼¼¼¼ZLOOWXUQUHGIRUDPRPHQW(QWHUWKH FRUUHFW3,1FRGHDOORYHUDJDLQ What is PIN code? 3,13HUVRQDO,GHQWLILFDWLRQ1XPEHUFRGHLVDVHFXULW\ FRGHWKDWDOORZVWKHSHUVRQZKRNQRZVLWWRRSHUDWHWKH SURMHFWRU6HWWLQJD3,1FRGHSUHYHQWVXQDXWKRUL]HGXVHRI WKHSURMHFWRU $3,1FRGHFRQVLVWVRIDIRXUGLJLWQXPEHU5HIHUWRWKH3,1 FRGHORFNIXQFWLRQLQWKH6HWWLQJ0HQXRQSDJHVIRU ORFNLQJRSHUDWLRQRIWKHSURMHFWRUZLWK\RXU3,1FRGH 3Note: ,IWKH3,1FRGHQXPEHULVQRWHQWHUHGZLWKLQWKUHH PLQXWHVDIWHUWKH3,1FRGHGLDORJER[DSSHDUHGWKH SURMHFWRUZLOOEHWXUQHGRIIDXWRPDWLFDOO\ 7KH³´LVVHWDVWKHLQLWLDO3,1FRGHDWWKHIDFWRU\ CAUTION ON HANDLING PIN CODE ,I\RXIRUJHW\RXU3,1FRGHWKHSURMHFWRUFDQQR ORQJHUEHVWDUWHG7DNHDVSHFLDOFDUHLQVHWWLQJ DQHZ3,1FRGHZULWHGRZQWKHQXPEHULQD FROXPQRQSDJHRIWKLVPDQXDODQGNHHSLW RQKDQG6KRXOGWKH3,1FRGHEHPLVVLQJRU IRUJRWWHQFRQVXOW\RXUGHDOHURUVHUYLFHFHQWHU 19 Basic Operation Turning Off the Projector 1 3UHVV WKH 2167$1'%< EXWWRQ RQ WKH WRS FRQWURO RU RQWKHUHPRWHFRQWURODQGPower off? DSSHDUVRQWKH VFUHHQ 2 3UHVV WKH 2167$1'%< EXWWRQ DJDLQ WR WXUQ RII WKH SURMHFWRU7KH32:(5LQGLFDWRUVWDUWVWREOLQNUHGDQG WKHFRROLQJIDQVNHHSUXQQLQJ<RXFDQVHOHFWWKHOHYHO RIIDQV¶TXLHWQHVVDQGVSHHG6HH³)DQ´RQSDJH $WWKLVWLPH\RXFDQXQSOXJWKH$&SRZHUFRUGHYHQLI WKHIDQVDUHVWLOOUXQQLQJ 3 :KHQ WKH SURMHFWRU KDV FRROHG GRZQ HQRXJK WKH 32:(5 LQGLFDWRU VWRSV EOLQNLQJ DQG \RX FDQ WXUQ RQ WKHSURMHFWRU 720$,17$,17+(/,)(2)7+(/$0321&( <2878517+(352-(&72521:$,7$7 /($67),9(0,187(6%()25(7851,1*,7 2)) '212723(5$7(7+(352-(&725 &217,18286/<:,7+2875(67 &217,1828686(0$<5(68/7,1 6+257(1,1*7+(/$03/,)(78512))7+( 352-(&725$1'/(767$1')25$%287$1 +285,1(9(5<+2856 3Note: :KHQWKH2QVWDUWIXQFWLRQLVVHWWROnWKHSURMHFWRUZLOO EHWXUQHGRQDXWRPDWLFDOO\E\FRQQHFWLQJWKH$&SRZHU FRUGWRDQ$&RXWOHWS 7KHUXQQLQJVSHHGRIFRROLQJIDQVLVFKDQJHGDFFRUGLQJ WRWKHWHPSHUDWXUHLQVLGHWKHSURMHFWRU 'RQRWSXWWKHSURMHFWRULQDFDVHEHIRUHWKHSURMHFWRULV FRROHGHQRXJK ,IWKH:$51,1*LQGLFDWRUEOLQNVRUOLJKWVUHGVHH ³:$51,1*LQGLFDWRU´RQSDJH :KLOHWKH32:(5LQGLFDWRULVEOLQNLQJWKHODPSLVEHLQJ FRROHGGRZQDQGWKHSURMHFWRUFDQQRWEHWXUQHGRQ:DLW XQWLO WKH 32:(5LQGLFDWRU VWRSV EOLQNLQJ WRWXUQ RQ WKH SURMHFWRUDJDLQ 7KH IDQ URWDWLRQ ZLOO WHUPLQDWH GLUHFWO\ LI WKH$& SRZHU FRUG LV XQSOXJJHG LPPHGLDWHO\ DIWHU WKH SURMHFWRU LV WXUQHGRII 7KH SURMHFWRU FDQ EH WXUQHG RQ DIWHU WKH 32:(5 LQGLFDWRU WXUQV UHG 7KH ZDLWLQJ WLPH WR UHVWDUW ZLOO EH VKRUWHQHGZKHQWKHQRUPDOSRZHURIISURFHVVLQJIRUIDQ FRROLQJ LV FRPSOHWHG FRPSDUHG ZLWK WKH WLPH WKH $& SRZHU FRUG LV LPPHGLDWHO\ XQSOXJJHG DIWHU WKH SRZHU RII 20 Power off?GLVDSSHDUVDIWHUVHFRQGV Basic Operation How to Operate the On-Screen Menu 7KHSURMHFWRUFDQEHDGMXVWHGRUVHWYLDWKH2Q6FUHHQ 0HQX7KHPHQXVKDYHDKLHUDUFKLFDOVWUXFWXUHZLWK DPDLQPHQXWKDWLVGLYLGHGLQWRVXEPHQXVZKLFKDUH IXUWKHUGLYLGHGLQWRRWKHUVXEPHQXV)RUHDFKDGMXVWPHQW DQGVHWWLQJSURFHGXUHUHIHUWRUHVSHFWLYHVHFWLRQVLQWKLV PDQXDO 1 Top Control POINT buttons (arrowhead) 3UHVVWKH0(18EXWWRQRQWKHWRSFRQWURORUWKH UHPRWHFRQWUROWRGLVSOD\WKH2Q6FUHHQ0HQX SELECT button 2 8VHWKH3RLQWŸźEXWWRQVWRKLJKOLJKWRUVHOHFWDPDLQ PHQXLWHP3UHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQ WRDFFHVVWKHVXEPHQXLWHPV7KHVHOHFWHGLWHPLV KLJKOLJKWHGLQRUDQJH 3 8VHWKH3RLQWŸźEXWWRQVWRVHOHFWWKHGHVLUHG VXEPHQXLWHPDQGSUHVVWKH6(/(&7EXWWRQWRVHWRU DFFHVVWKHVHOHFWHGLWHP 4 8VHWKH3RLQWŸźŻŹEXWWRQVWRDGMXVWWKHVHWWLQJRU VZLWFKEHWZHHQHDFKRSWLRQDQGSUHVVWKH6(/(&7 EXWWRQWRDFWLYDWHLWDQGUHWXUQWRWKHVXEPHQX 5 3UHVVWKH3RLQWŻEXWWRQWRUHWXUQWRWKHPDLQPHQX 3UHVVWKH0(18EXWWRQWRH[LWWKH2Q6FUHHQ0HQX MENU button Remote Control POINT buttons (arrowhead) SELECT button MENU button On-Screen Menu Point Ź or SELECT button 7KHFXUUHQWO\VHWLWHPLV FKHFNPDUNHG 7KHVHOHFWHGLWHPLV KLJKOLJKWHGLQRUDQJH 21 Basic Operation Menu Bar )RUGHWDLOHGIXQFWLRQVRIHDFKPHQXVHH³0HQX7UHH´RQSDJHV 0DLQ0HQX 6XE0HQX Input 8VHGWRVHOHFWDQLQSXWVRXUFHIURPComputer 1Computer 2RUVideoSS PC adjust 6HOHFWAuto PC adj.Fine syncTotal dotsHorizontalVerticalClampDisplay area-HDQGDisplay area-VWRDGMXVW WKHSDUDPHWHUVWRPDWFKZLWKWKH3&LQSXWVLJQDOIRUPDWSS Image select )RUFRPSXWHUVRXUFHXVHGWRVHOHFWDQLPDJHPRGHIURPDPRQJDynamicStandardRealBlackboard(Green) ColorboardDQGimage1 - 4S )RU9LGHRVRXUFHXVHGWRVHOHFWDQLPDJHPRGHDPRQJDynamicStandardCinemaBlackboard(Green)Colorboard DQGImage 1- 4S Image adjust )RUFRPSXWHUVRXUFHXVHGWRDGMXVWFRPSXWHULPDJH>ContrastBrightnessColor temp.White balance (R/G/B) SharpnessDQGGamma@SS )RU9LGHRVRXUFHXVHGWRDGMXVWSLFWXUHLPDJH>ContrastBrightnessColorTintColor temp.White balance (R/G/ B)SharpnessGammaNoise reductionDQGProgressive@SS Screen )RUFRPSXWHUVRXUFHXVHGWRDGMXVWVL]HRIWKHLPDJH>NormalTrueWideFullCustomDQGDigital zoom +/–@SS )RU9LGHRVRXUFHXVHGWRVHWVL]HRILPDJH>NormalWideDQGCustom@S Sound 8VHGWRDGMXVWWKHYROXPHRUPXWHWKHVRXQGS Setting 8VHGWRVHWWKHSURMHFWRU¶VRSHUDWLQJFRQILJXUDWLRQVSS Information 'LVSOD\WKHLQSXWVRXUFHLQIRUPDWLRQInputH-sync freq.V-sync freq.ScreenLanguageLamp statusLamp counterPower managementKey lockPIN code lockDQGRemote controlS Network 6HHWKHRZQHU¶VPDQXDORI³1HWZRUN6HWXSDQG2SHUDWLRQ´ Guide 7KHNH\RSHUDWLRQLVGLVSOD\HG 22 Basic Operation Zoom and Focus Adjustment 5RWDWHWKH=RRP5LQJWR]RRPLQDQGRXW 5RWDWHWKH)RFXV5LQJWRDGMXVWWKHIRFXVRIWKHLPDJH =RRP5LQJ Auto Setup Function $XWRVHWXSIXQFWLRQLVSURYLGHGWRDXWRPDWLFDOO\H[HFXWHWKH VHWWLQJRI$XWRVHWXSLQFOXGHV,QSXWVHDUFK$XWR3&DGM DQG$XWR.H\VWRQHIXQFWLRQVLQWKHVHWWLQJPHQXE\MXVW SUHVVLQJWKH$8726(783EXWWRQRQWKHWRSFRQWURORUWKH $8726(7EXWWRQRQWKHUHPRWHFRQWURO5HIHUWRSDJH IRUWKHVHWWLQJRIWKH$XWRVHWXSIXQFWLRQ 3Notes: $XWR.H\VWRQHFRUUHFWVYHUWLFDOGLVWRUWLRQRQO\LWGRHV QRWFRUUHFWKRUL]RQWDOGLVWRUWLRQ $XWR.H\VWRQHFDQQRWZRUNZKHQ&HLOLQJIHDWXUHLVVHW WROnLQWKH6HWWLQJPHQXS 3HUIHFWFRUUHFWLRQRIWKHLPDJHGLVWRUWLRQFDQQRWEH HQVXUHGZLWKWKH$XWRVHWXSIXQFWLRQ,IWKHGLVWRUWLRQ FDQQRWEHFRUUHFWHGSURSHUO\E\SUHVVLQJWKH$872 6(783RU$8726(7EXWWRQDGMXVWPDQXDOO\E\ SUHVVLQJWKH.(<6721(EXWWRQRQWKHUHPRWHFRQWURO RUVHOHFWLQJ.H\VWRQHLQWKH6HWWLQJPHQXS Fine syncTotal dotsHorizontalDQGVertical SRVLWLRQRIVRPHFRPSXWHUVFDQQRWEHIXOO\DGMXVWHG ZLWKWKH$XWR3&$GMXVWPHQWIXQFWLRQ:KHQWKHLPDJH LVQRWSURYLGHGSURSHUO\ZLWKWKLVRSHUDWLRQPDQXDO DGMXVWPHQWVDUHUHTXLUHGSS )RFXV5LQJ Top Control AUTO SETUP button POINT Ÿźbuttons Remote Control AUTO SET button POINT Ÿźbuttons KEYSTONE button Keystone Correction ,IDSURMHFWHGSLFWXUHVWLOOKDVNH\VWRQHGLVWRUWLRQDIWHU SUHVVLQJWKH$8726(783EXWWRQRQWKHWRSFRQWURORUWKH $8726(7EXWWRQRQWKHUHPRWHFRQWUROFRUUHFWWKHLPDJH PDQXDOO\DVIROORZV 3UHVVWKH.(<6721(EXWWRQRQWKHUHPRWHFRQWURO7KH .H\VWRQHGLDORJER[DSSHDUV8VHWKH3RLQWŸźEXWWRQVWR FRUUHFWNH\VWRQHGLVWRUWLRQ7KHNH\VWRQHDGMXVWPHQWFDQEH VWRUHGVHHSDJH 5HGXFHWKHXSSHUZLGWK ZLWKWKH3RLQWŸEXWWRQ 5HGXFHWKHORZHUZLGWK ZLWKWKH3RLQWźEXWWRQ 7KHZKLWHDUURZVLQGLFDWHWKDWWKHUHLVQR FRUUHFWLRQ $UHGDUURZLQGLFDWHVWKHGLUHFWLRQRIFRUUHFWLRQ $QDUURZGLVDSSHDUVDWWKHPD[LPXPFRUUHFWLRQ ,I\RXSUHVVWKH.(<6721(EXWWRQRQWKH UHPRWHFRQWURORQFHPRUHZKLOHWKHNH\VWRQH GLDORJER[LVEHLQJGLVSOD\HGWKHNH\VWRQH DGMXVWPHQWZLOOEHFDQFHOHG 7KHDGMXVWDEOHUDQJHLVOLPLWHGGHSHQGLQJRQWKH LQSXWVLJQDO 23 Basic Operation Sound Adjustment Direct Operation Top Control VOLUME+/buttons Volume 3UHVVWKH92/80(±EXWWRQVRQWKHWRSFRQWURORURQWKH UHPRWHFRQWUROWRDGMXVWWKHYROXPH7KHYROXPHGLDORJER[ DSSHDUVRQWKHVFUHHQIRUDIHZVHFRQGV Mute Remote Control 3UHVVWKH087(EXWWRQRQWKHUHPRWHFRQWUROWRVHOHFW On WR WHPSRUDULO\ WXUQ RII WKH VRXQG 7R WXUQ WKH VRXQG EDFN RQSUHVVWKH087(EXWWRQDJDLQWRVHOHFWOffRUSUHVVWKH 92/80(±EXWWRQV7KH0XWHIXQFWLRQLVDOVRHIIHFWLYHIRU WKH$8',2287MDFN VOLUME+ button MUTE button VOLUME- button Menu Operation 1 2 3UHVVWKH0(18EXWWRQWRGLVSOD\WKH2Q6FUHHQ0HQX 8VH WKH 3RLQW Ÿź EXWWRQV WR VHOHFW Sound 3UHVV WKH 3RLQW Ź RU WKH 6(/(&7 EXWWRQ WR DFFHVV WKH VXEPHQX LWHPV 8VHWKH3RLQWŸźEXWWRQVWRVHOHFWWKHGHVLUHGVXEPHQX LWHPDQGSUHVVWKH6(/(&7EXWWRQWRDFFHVVWKH VHOHFWHGLWHP Volume 3UHVV WKH 3RLQW Ÿ EXWWRQ WR WXUQ XS WKH YROXPH SUHVV WKH 3RLQWźEXWWRQWRWXUQGRZQWKHYROXPH 16 3UHVVWKH087(EXWWRQWRVHWWKH 0XWHIXQFWLRQOnRUOff7KHGLDORJ ER[GLVDSSHDUVDIWHUVHFRQGV Sound Menu Mute 3UHVVWKH6(/(&7EXWWRQWRVZLWFKWKHPXWHIXQFWLRQOn/ Off:KHQWKHVRXQGLVWXUQHGRIIOnLVGLVSOD\HG3UHVV WKH92/80(±EXWWRQVDJDLQWRWXUQWKHVRXQGEDFNRQ 24 $SSUR[LPDWHOHYHO RIWKHYROXPH Volume Dialog Box Basic Operation Remote Control Operation 8VLQJWKHUHPRWHFRQWUROIRUVRPHIUHTXHQWO\XVHGRSHUDWLRQVLVDGYLVDEOH-XVWSUHVVLQJRQHRIWKHEXWWRQV HQDEOHV\RXWRPDNHWKHGHVLUHGRSHUDWLRQTXLFNO\ZLWKRXWFDOOLQJXSWKH2Q6FUHHQ0HQX COMPUTER 1/2, VIDEO, S-VIDEO and COMPONENT buttons 3UHVVWKH&20387(59,'(269,'(2DQG &20321(17EXWWRQVRQWKHUHPRWHFRQWUROWRVHOHFWWKH LQSXWVRXUFH6HHSDJHVIRUGHWDLOV FREEZE button 3UHVVWKH)5((=(EXWWRQRQWKHUHPRWHFRQWUROWRIUHH]H WKHSLFWXUHRQWKHVFUHHQ7RFDQFHOWKH)UHH]HIXQFWLRQ SUHVVWKH)5((=(EXWWRQDJDLQRUSUHVVDQ\RWKHUEXWWRQ INFO. button 'LVSOD\WKHLQSXWVRXUFHLQIRUPDWLRQInputH-sync freq. V-sync freq.ScreenLanguageLamp statusLamp counterPower managementKeylockPIN code lock DQGRemote controlS Remote Control COMPUTER 1/2 buttons S-VIDEO button VIDEO button FREEZE button D.ZOOM buttons COMPONENT button INFO. button LAMP button D.ZOOM buttons 3UHVVWKH'=220EXWWRQVRQWKHUHPRWHFRQWUROWRHQWHUWR WKH'LJLWDO]RRP±PRGH6HHSDJHIRUGHWDLOV 3Note: 6HHWKHQH[WSDJHIRUWKHGHVFULSWLRQRIRWKHU LAMP button EXWWRQV 3UHVV WKH /$03 EXWWRQ RQ WKH UHPRWH FRQWURO WR VHOHFW WKH ODPSPRGHIRUFKDQJLQJWKHEULJKWQHVVRQWKHVFUHHQ High %ULJKWHUWKDQWKH1RUPDOPRGH Normal 1RUPDOEULJKWQHVV Eco /RZHUEULJKWQHVVUHGXFHVWKHODPSSRZHU FRQVXPSWLRQDQGH[WHQGVWKHODPSOLIH 25 Basic Operation NO SHOW button 3UHVVWKH126+2:EXWWRQRQWKHUHPRWHFRQWUROWREODFNRXW WKH LPDJH 7R UHVWRUH WR QRUPDO SUHVV WKH 12 6+2: EXWWRQ DJDLQRUSUHVVDQ\RWKHUEXWWRQ7KHVFUHHQFKDQJHVHDFKWLPH \RXSUHVVWKH126+2:EXWWRQDVIROORZV EODFNRXWĺQRUPDOĺEODFNRXWĺQRUPDO No show GLVDSSHDUVDIWHUVHFRQGV P-TIMER button 3UHVVWKH37,0(5EXWWRQRQWKHUHPRWHFRQWURO7KH37LPHU GLVSOD\00:00DSSHDUVRQWKHVFUHHQDQGWKHFRXQWGRZQVWDUWV ± 7RVWRSWKHFRXQWGRZQSUHVVWKH37,0(5EXWWRQ7RFDQFHO WKH37LPHUIXQFWLRQSUHVVWKH37,0(5EXWWRQDJDLQ 37LPHUGLVSOD\ SCREEN button IMAGE button P-TIMER button 3UHVVWKH,0$*(EXWWRQRQWKHUHPRWHFRQWUROWRVHOHFWD GHVLUHGLPDJHPRGHRIWKHVFUHHQ6HHSDJHVIRU GHWDLOV NO SHOW button IMAGE button SCREEN button 6HOHFWWKHVFUHHQVL]H6HHSDJHVIRUGHWDLOV 3Note: 6HHWKHSUHYLRXVSDJHIRUWKHGHVFULSWLRQRI RWKHUEXWWRQV 26 Computer Input Input Source Selection (RGB: Computer 1/Computer 2) Direct Operation &KRRVHHLWKHUComputer 1(RGB) RUComputer 2(RGB)E\SUHVVLQJWKH&20387(5RU&RPSXWHUEXWWRQ RQWKHUHPRWHFRQWURO %HIRUH XVLQJ WKHVH EXWWRQV FRUUHFW LQSXW VRXUFH VKRXOG EH VHOHFWHG WKURXJK 0HQX RSHUDWLRQ DV GHVFULEHG EHORZ Remote Control COMPUTER 1 button Computer 1(RGB) Computer 1(Scart) COMPUTER 2 button Computer 2 (RGB) Input Menu Menu Operation 1 3UHVVWKH0(18EXWWRQWRGLVSOD\WKH2Q6FUHHQ 0HQX8VHWKH3RLQWŸźEXWWRQVWRVHOHFWInputDQG WKHQSUHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQ 2 8VHWKH3RLQWŸźEXWWRQVWRVHOHFWComputer 1 3 :KHQComputer 1LVVHOHFWHGSUHVVWKH3RLQWŹ EXWWRQWRDFFHVVWKHVXEPHQXLWHPV8VHWKH3RLQWŸ źEXWWRQVWRVHOHFWWKH5*%LQSXWVRXUFHDQGWKHQ SUHVVWKH6(/(&7EXWWRQ Computer 1 3Note: :KHQWKH,QSXW6HDUFKIXQFWLRQLVVHWWROn1RUOn2LQ WKH$XWRVHWXSIXQFWLRQWKHLQSXWVLJQDOZLOOEHVHDUFKHG DXWRPDWLFDOO\S 27 Computer Input Computer System Selection 7KLVSURMHFWRUDXWRPDWLFDOO\WXQHVWRYDULRXVW\SHVRIFRPSXWHUVEDVHGRQ9*$69*$;*$6;*$:;*$ RU:8;*$ZLWKLWV0XOWLVFDQV\VWHPDQG$XWR3&$GMXVWPHQW,IDFRPSXWHULVVHOHFWHGDVDVLJQDOVRXUFH WKLVSURMHFWRUDXWRPDWLFDOO\GHWHFWVWKHVLJQDOIRUPDWDQGWXQHVWRSURMHFWDSURSHULPDJHZLWKRXWDQ\DGGLWLRQDO VHWWLQJV6LJQDOIRUPDWVSURYLGHGLQWKLVSURMHFWRUDUHVKRZQRQSDJH 2QHRIWKHIROORZLQJPHVVDJHVPD\DSSHDUZKHQ Auto 7KHSURMHFWRUFDQQRWUHFRJQL]HWKHFRQQHFWHG VLJQDOFRQIRUPLQJWRWKHSURYLGHG3&6\VWHPV AutoLVGLVSOD\HGRQWKH6\VWHP0HQXER[ DQGWKH$XWR3&$GMXVWPHQWIXQFWLRQZRUNV WRGLVSOD\SURSHULPDJHV,IWKHLPDJHLVQRW SURMHFWHGSURSHUO\DPDQXDODGMXVWPHQWLV UHTXLUHGSS ----- 7KHUHLVQRVLJQDOLQSXWIURPWKHFRPSXWHU &KHFNWKHFRQQHFWLRQEHWZHHQ\RXUFRPSXWHU DQGWKHSURMHFWRU6HH³7URXEOHVKRRWLQJ´RQ S Mode 1 7KHSUHVHWV\VWHPLVPDQXDOO\DGMXVWHGLQWKH 3&DGMXVW0HQX7KHDGMXVWHGGDWDFDQEH VWRUHGLQMode 1–5SS SVGA 1 3&6\VWHPVSURYLGHGLQWKLVSURMHFWRULVFKRVHQ 7KHSURMHFWRUFKRRVHVDSURSHUV\VWHPSURYLGHG LQWKHSURMHFWRUDQGGLVSOD\VLW PC System Menu 7KH3&6\VWHP0HQX 6HOHFWHGV\VWHPLV GLVSOD\HG 0RGHDQG69*$DUHH[DPSOHV &XVWRPL]HGMode (1–5)VHWLQWKH 3&DGMXVW0HQX SS Selecting Computer System Manually 3&V\VWHPFDQDOVREHVHOHFWHGPDQXDOO\ PC System Menu 1 3UHVVWKH0(18EXWWRQWRGLVSOD\WKH2Q6FUHHQ 0HQX8VHWKH3RLQWŸźEXWWRQVWRVHOHFWInputDQG WKHQSUHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQ 2 8VHWKH3RLQWŸźEXWWRQVWRVHOHFWSystemDQGWKHQ SUHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQ 3 8VHWKH3RLQWŸźEXWWRQVWRVHOHFWWKHGHVLUHGV\VWHP DQGWKHQSUHVVWKH6(/(&7EXWWRQ RGB(Computer 1) 6\VWHPVLQWKLVGLDORJER[ FDQEHVHOHFWHG 28 Computer Input Auto PC Adjustment $XWR3&$GMXVWPHQWIXQFWLRQLVSURYLGHGWRDXWRPDWLFDOO\DGMXVWFine syncTotal dotsHorizontalDQGVertical SRVLWLRQVWRFRQIRUPWR\RXUFRPSXWHU Menu Operation PC adjust Menu Auto PC adj. 1 3UHVVWKH0(18EXWWRQWRGLVSOD\WKH2Q6FUHHQ 0HQX8VHWKH3RLQWŸźEXWWRQVWRVHOHFWPC adjust DQGWKHQSUHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQ 2 8VHWKH3RLQWŸźEXWWRQVWRVHOHFWAuto PC adj.DQG WKHQSUHVVWKH6(/(&7EXWWRQ To store adjustment parameters 7KHDGMXVWHGSDUDPHWHUVIURPWKH$XWR3&$GMXVWPHQWFDQ EHVWRUHGLQWKHSURMHFWRU2QFHWKHSDUDPHWHUVDUHVWRUHG WKHVHWWLQJFDQEHGRQHMXVWE\VHOHFWLQJDMode (1–5)LQ WKH3&6\VWHP0HQXVHHSDJH6HHDOVR³6WRUH´RQ SDJH 8VH3RLQWŸźEXWWRQVWRVHOHFW Auto PC adj. DQGSUHVVWKH6(/(&7EXWWRQ Please wait...DSSHDUVZKLOHWKH$XWR3& DGMXVWPHQWLVLQSURFHVV 3Note: Fine syncTotal dotsHorizontalDQGVertical SRVLWLRQRIVRPHFRPSXWHUVFDQQRWEHIXOO\DGMXVWHG ZLWKWKH$XWR3&$GMXVWPHQWIXQFWLRQ:KHQWKHLPDJH LVQRWSURYLGHGSURSHUO\ZLWKWKLVRSHUDWLRQPDQXDO DGMXVWPHQWVDUHUHTXLUHGSS 7KH$XWR3&$GMXVWPHQWFDQQRWEHRSHUDWHGZKHQ480i 575i480p575p720p1035iRU1080iLVVHOHFWHGLQWKH 3&6\VWHP0HQXS 29 Computer Input Manual PC Adjustment 6RPHFRPSXWHUVHPSOR\VSHFLDOVLJQDOIRUPDWVZKLFKPD\QRWEHWXQHGE\0XOWLVFDQV\VWHPRIWKLVSURMHFWRU 0DQXDO3&$GMXVWPHQWHQDEOHV\RXWRSUHFLVHO\DGMXVWVHYHUDOSDUDPHWHUVWRPDWFKWKRVHVLJQDOIRUPDWV7KH SURMHFWRU KDV ILYH LQGHSHQGHQW PHPRU\ DUHDV WR VWRUH WKRVH SDUDPHWHUV PDQXDOO\ DGMXVWHG ,W DOORZV \RX WR UHFDOOWKHVHWWLQJIRUDVSHFLILFFRPSXWHU 1 3UHVVWKH0(18EXWWRQWRGLVSOD\WKH2Q6FUHHQ 0HQX8VHWKH3RLQWŸźEXWWRQVWRVHOHFWPC adjust DQGWKHQSUHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQ 2 8VHWKH3RLQWŸźEXWWRQVWRVHOHFWWKHGHVLUHGLWHP DQGWKHQSUHVVWKH6(/(&7EXWWRQWRGLVSOD\WKH DGMXVWPHQWGLDORJER[8VHWKH3RLQWŻŹEXWWRQVWR DGMXVWWKHVHWWLQJYDOXH Fine sync 8VHWKH3RLQWŻŹEXWWRQVWRDGMXVWWKHYDOXHHOLPLQDWLQJD IOLFNHUIURPWKHLPDJHGLVSOD\HGIURPWR Total dots 8VHWKH3RLQWŻŹEXWWRQVWRDGMXVWWKHQXPEHURIWRWDOGRWV LQRQHKRUL]RQWDOSHULRGWRPDWFK\RXU3&LPDJH Horizontal 8VHWKH3RLQWŻŹEXWWRQVWRDGMXVWWKHKRUL]RQWDOSLFWXUH SRVLWLRQ Vertical 8VHWKH3RLQWŻŹEXWWRQVWRDGMXVWWKHYHUWLFDOSLFWXUH SRVLWLRQ Clamp 8VHWKH3RLQWŻŹEXWWRQVWRDGMXVWWKHFODPSOHYHO:KHQ WKHLPDJHKDVGDUNEDUVWU\WKLVDGMXVWPHQW Display area H 8VH WKH 3RLQW ŻŹ EXWWRQV WR DGMXVW WKH KRUL]RQWDO DUHD GLVSOD\HGE\WKLVSURMHFWRU Display area V 8VH WKH 3RLQW ŻŹ EXWWRQV WR DGMXVW WKH YHUWLFDO DUHD GLVSOD\HGE\WKLVSURMHFWRU 30 PC adjust Menu Computer Input Reset 7R UHVHW WKH DGMXVWHG GDWD VHOHFW Reset DQG SUHVV WKH 6(/(&7EXWWRQ$FRQILUPDWLRQER[DSSHDUVDQGWKHQVHOHFW Yes$OODGMXVWPHQWVZLOOUHWXUQWRWKHLUSUHYLRXVILJXUHV Mode free Mode free 7RFOHDUWKHVWRUHGGDWDVHOHFWMode freeDQGWKHQSUHVV WKH3RLQWŹRUWKH6(/(&7EXWWRQ0RYHWKHKLJKOLJKWWRWKH 0RGHWKDW\RXZDQWWRFOHDUDQGWKHQSUHVVWKH6(/(&7 EXWWRQ 7KLV0RGHKDVVWRUHG SDUDPHWHUV Store 7RVWRUHWKHDGMXVWHGGDWDVHOHFW Store DQGWKHQSUHVVWKH 3RLQWŹRUWKH6(/(&7EXWWRQ0RYHWKHKLJKOLJKWWRRQHRI WKH0RGHVWRLQZKLFK\RXZDQWWRVWRUHDQGWKHQSUHVV WKH6(/(&7EXWWRQ 9DOXHVRITotal dotsHorizontal VerticalDisplay area HDQG Display area V 9DFDQW Store tore 3UHVV0(18EXWWRQ WRFORVHWKLVGLDORJ ER[ tore 3UHVV6(/(&7EXWWRQWR VWRUHWKHGDWD 3Note: Display area (H/V) FDQQRWEHVHOHFWHGZKHQ480i575i480p575p720p1035iRU1080iLVVHOHFWHGLQWKH 3&6\VWHP0HQXS :KHQLQSXWFRPSXWHUVLJQDOWRWKHSURMHFWRU PC adjust ZLOOEHFRPHDYDLODEOH 31 Computer Input Image Mode Selection Direct Operation Remote Control 6HOHFWWKHGHVLUHGLPDJHPRGHDPRQJDynamicStandard RealBlackboard (Green)ColorboardImage 1Image 2 Image 3DQGImage 4E\SUHVVLQJWKH,0$*(EXWWRQRQWKH UHPRWHFRQWURO IMAGE button Dynamic Standard Real Blackboard(Green) IMAGE button Colorboard Image 1 Image 2 Menu Operation 1 2 Image 4 8VHWKH3RLQWŸźEXWWRQVWRVHOHFWWKHGHVLUHGLWHP DQGWKHQSUHVVWKH6(/(&7EXWWRQ Dynamic )RUYLHZLQJSLFWXUHVLQDEULJKWURRP Standard 1RUPDOSLFWXUHPRGHSUHVHWRQWKHSURMHFWRU Real 3LFWXUHPRGHZLWKLPSURYHGKDOIWRQHIRUJUDSKLFV Blackboard (Green) )RUWKHLPDJHSURMHFWHGRQDEODFNERDUG 7KLVPRGHKHOSVHQKDQFHWKHLPDJHSURMHFWHGRQD EODFNERDUG7KLVLVPDLQO\HIIHFWLYHRQDJUHHQFRORUHG ERDUGQRWWUXO\HIIHFWLYHRQDEODFNFRORUHGERDUG Colorboard $WWKHWLPHRIVLPSOHSURMHFWLRQRQWKHFRORUHGZDOO\RX FDQJHWWKHFORVHFRORULPDJHWRWKHFRORULPDJHSURMHFWHG RQDZKLWHVFUHHQE\VHOHFWLQJWKHVLPLODUFRORUWRWKHZDOO FRORUIURPWKHSUHVHWIRXUFRORUV Image 1–4 )RUYLHZLQJZLWKWKHXVHUSUHVHWLPDJHPRGHLQWKH,PDJH $GMXVW0HQXVHHSDJHV7KLV,PDJHPHPRU\LV SURYLGHGLQHDFKFRPSXWHUFRPSRQHQW6YLGHRDQGYLGHR LQSXWVRXUFH 32 Image 3 3UHVVWKH0(18EXWWRQWRGLVSOD\WKH2Q6FUHHQ0HQX 8VHWKH3RLQWŸźEXWWRQVWRVHOHFW Image select DQG WKHQSUHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQ Image select Menu Computer Input Image Adjustment 1 3UHVVWKH0(18EXWWRQWRGLVSOD\WKH2Q6FUHHQ 0HQX8VHWKH3RLQWŸźEXWWRQVWRVHOHFWImage adjustDQGWKHQSUHVVWKH3RLQWŹRUWKH6(/(&7 EXWWRQ 2 8VHWKH3RLQWŸźEXWWRQVVHOHFWWKHGHVLUHGLWHP DQGWKHQSUHVVWKH6(/(&7EXWWRQWRGLVSOD\WKH DGMXVWPHQWGLDORJER[8VHWKH3RLQWŻŹEXWWRQVWR DGMXVWWKHVHWWLQJYDOXH Image Adjust Menu Contrast 3UHVVWKH3RLQWŻEXWWRQWRGHFUHDVHWKHFRQWUDVWSUHVVWKH 3RLQWŹEXWWRQWRLQFUHDVHWKHFRQWUDVWIURPWR Brightness 6HOHFWHG,PDJHPRGH 3UHVVWKH3RLQW ŻEXWWRQWRGHFUHDVHWKHEULJKWQHVVSUHVV WKH3RLQWŹEXWWRQWRLQFUHDVHWKHEULJKWQHVVIURPWR Color temp. 8VHWKH3RLQW ŻŹEXWWRQVWRVHOHFWWKHGHVLUHG&RORUWHPS OHYHO;/RZ/RZ0LGRU+LJK White balance (Red) 3UHVVWKH3RLQWŻEXWWRQWROLJKWHQUHGWRQHSUHVVWKH3RLQW ŹEXWWRQWRGHHSHQUHGWRQHIURPWR White balance (Green) 8VHWKH3RLQWŻŹ EXWWRQVWRDGMXVWWKH VHWWLQJYDOXH 3UHVV WKH 3RLQW Ż EXWWRQ WR OLJKWHQ JUHHQ WRQH SUHVV WKH 3RLQWŹEXWWRQWRGHHSHQJUHHQWRQHIURPWR White balance (Blue) 3UHVVWKH3RLQWŻEXWWRQWROLJKWHQEOXHWRQHSUHVVWKH 3RLQWŹEXWWRQWRGHHSHQEOXHWRQHIURPWR Sharpness 3UHVVWKH3RLQW ŻEXWWRQWRGHFUHDVHWKHVKDUSQHVVRIWKH LPDJHSUHVVWKH3RLQW ŹEXWWRQWRLQFUHDVHWKHVKDUSQHVV RIWKHLPDJHIURPWR Gamma 8VH WKH 3RLQW ŻŹ EXWWRQV WR DGMXVW WKH JDPPD YDOXH WR REWDLQDEHWWHUEDODQFHRIFRQWUDVWIURPWR Reset 7R UHVHW WKH DGMXVWHG GDWD VHOHFW Reset DQG SUHVV WKH 6(/(&7EXWWRQ$FRQILUPDWLRQER[DSSHDUVDQGWKHQVHOHFW Yes$OODGMXVWPHQWVZLOOUHWXUQWRWKHLUSUHYLRXVILJXUHV 3Note: :KHQ:KLWHEDODQFH RedGreenRUBlueLV DGMXVWHGColor temp.ZLOOFKDQJHWRUser :KHQBlackboard(Green)RUColorboard LVVHOHFWHGLQ,PDJHVHOHFWColor temp.ZLOO FKDQJHWRBlackboardRUColorboard 33 Computer Input Store 7RVWRUHWKHDGMXVWHGGDWDVHOHFWStoreDQGSUHVVWKH3RLQW ŹRUWKH6(/(&7EXWWRQ8VHWKH3RLQWŸźEXWWRQVWR VHOHFWRQHIURPImage 1WR4DQGSUHVVWKH6(/(&7EXWWRQ $FRQILUPDWLRQER[DSSHDUVDQGWKHQVHOHFWYes6WRUHG GDWDFDQEHFDOOHGXSE\VHOHFWLQJDQImage (1–4)LQWKH ,PDJH0RGH6HOHFWLRQRQSDJH $FRQILUPDWLRQER[DSSHDUVDQG WKHQVHOHFWYes Screen Size Adjustment 7KLVSURMHFWRUKDVWKHSLFWXUHVFUHHQUHVL]HIXQFWLRQZKLFK HQDEOHV\RXWRFXVWRPL]HWKHLPDJHVL]H 1 3UHVVWKH0(18EXWWRQWRGLVSOD\WKH2Q6FUHHQ 0HQX8VHWKH3RLQWŸźEXWWRQVWRVHOHFWScreenDQG WKHQSUHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQ 2 8VHWKH3RLQWŸźEXWWRQVVHOHFWWKHGHVLUHGLWHPDQG WKHQSUHVVWKH6(/(&7EXWWRQ Screen Menu Normal 3URYLGHWKHLPDJHWRILWWKHVFUHHQVL]H True 3URYLGHWKHLPDJHLQLWVRULJLQDOVL]H:KHQWKHRULJLQDO LPDJHVL]HLVODUJHURUVPDOOHUWKDQWKHVFUHHQVL]H [WKHSURMHFWRUHQWHUVWRWKHSDQQLQJPRGH DXWRPDWLFDOO\8VHWKH3RLQWŸźŻŹEXWWRQVWRSDQWKH LPDJH:KHQDGMXVWHGWKHDUURZVZLOOWXUQUHG:KHQ UHDFKHGWRWKHFRUUHFWLRQOLPLWVWKHDUURZVZLOOGLVDSSHDU Wide 3URYLGHWKHLPDJHWRILWWKHZLGHYLGHRDVSHFWUDWLRE\ H[SDQGLQJWKHLPDJHZLGWKXQLIRUPO\7KLVIXQFWLRQFDQEH XVHGIRUSURYLGLQJDVTXHH]HGYLGHRVLJQDODW Full 3URYLGHWKHIXOOVFUHHQLPDJH 3Note: 7KH6FUHHQ0HQXRQO\NormalDQGCustomFDQEHRSHUDWHGWideZLOOEHGLVDEOHGDQGGLVSOD\HGLQJUD\ ZKHQ720p(HDTV)1035i (HDTV)RU1080i (HDTV)LVVHOHFWHGLQWKH3&6\VWHP0HQXS 7KLVSURMHFWRUFDQQRWGLVSOD\DQ\UHVROXWLRQKLJKHUWKDQ[,I\RXUFRPSXWHU¶VVFUHHQUHVROXWLRQLV KLJKHUWKDQLWUHVHWWKHUHVROXWLRQWRWKHORZHUEHIRUHFRQQHFWLQJWRWKHSURMHFWRU 7KHLPDJHGDWDLQRWKHUWKDQ[LVPRGLILHGWRILWWKHVFUHHQVL]HLQLQLWLDOPRGH TrueFullDQGDigital zoom +/–DUHGLVDEOHGDQGFDQQRWEHGLVSOD\HGZKHQ480i575i480pRU575pLV VHOHFWHGLQWKH3&6\VWHP0HQXS 34 Computer Input Custom $GMXVW WKH VFUHHQ VFDOH DQG SRVLWLRQ PDQXDOO\ ZLWK WKLV IXQFWLRQ 3UHVVWKH3RLQWŹEXWWRQDWCustomDQGWKHCustomLV GLVSOD\HGRQWKHVFUHHQ\RXFDQXVHWKH3RLQWŸźEXWWRQV WRFKRRVHWKHLWHP\RXZDQWWRDGMXVW Scale H/V $GMXVWWKH+RUL]RQWDO9HUWLFDOVFUHHQ VFDOH H&V :KHQVHWWROnWKHDVSHFWUDWLRLV IL[HG7KHScale VDSSHDUVGLPPHGDQG EHFRPHVXQDYDLODEOH$GMXVWScale H WKHQWKHVFUHHQVFDOHLVDXWRPDWLFDOO\ PRGLILHGEDVHGRQWKHDVSHFWUDWLR Position H/V $GMXVW WKH +RUL]RQWDO9HUWLFDO VFUHHQ SRVLWLRQ Common 6DYHWKHDGMXVWHGVFDOHRUSRVLWLRQWRDOO WKHLQSXWV3UHVVWKH6(/(&7EXWWRQDW CommonWRGLVSOD\DFRQILUPDWLRQER[ 7RVDYHWKHVFDOHRUSRVLWLRQSUHVVWKH 6(/(&7EXWWRQDWYes:KHQCustom LVVHOHFWHGWKHVDYHGVFDOHRUSRVLWLRQLV XVHG Reset 5HVHWWKHDOODGMXVWHGYDOXHV3UHVV WKH6(/(&7EXWWRQDWResetWRGLVSOD\ DFRQILUPDWLRQER[7RUHVHWSUHVVWKH 6(/(&7EXWWRQDWYes For zooming in and out the images 3Note: :KHQQRVLJQDOLVGHWHFWHGNormalLVVHW DXWRPDWLFDOO\ 7KHDGMXVWDEOHUDQJHIRUScale H/VDQG Position H/VLVOLPLWHGGHSHQGLQJRQWKH LQSXWVLJQDO Remote Control POINT buttons Digital zoom + 6HOHFWDigital zoom +7KH2Q6FUHHQ0HQXGLVDSSHDUVDQG D. zoom +DSSHDUV3UHVVWKH6(/(&7EXWWRQWRH[SDQGWKH LPDJHVL]H8VHWKH3RLQWŸźŻŹEXWWRQVWRSDQWKHLPDJH 7KH3DQQLQJIXQFWLRQFDQZRUNRQO\ZKHQWKHLPDJHLVODUJHU WKDQWKHVFUHHQVL]H $ SURMHFWHG LPDJH FDQ EH DOVR H[SDQGHG E\ SUHVVLQJ WKH '=220ŸRUWKH6(/(&7EXWWRQRQWKHUHPRWHFRQWURO Digital zoom – 6HOHFWDigital zoom –7KH2Q6FUHHQ0HQXGLVDSSHDUVDQG D. zoom –DSSHDUV3UHVVWKH6(/(&7EXWWRQWRFRPSUHVV LPDJHVL]H 7KHSURMHFWHGLPDJHFDQEHDOVRFRPSUHVVHGE\SUHVVLQJWKH '=220źRUWKH6(/(&7EXWWRQRQWKHUHPRWHFRQWURO 7RH[LWWKH'LJLWDO]RRP±PRGHSUHVVDQ\EXWWRQH[FHSW WKH'=220ŸźEXWWRQV6(/(&7DQG3RLQWEXWWRQV 7R UHWXUQ WR WKH SUHYLRXV VFUHHQ VL]H VHOHFW D VFUHHQ VL]H IURP WKH 6FUHHQ 6L]H$GMXVWPHQW 0HQX RU VHOHFW DQ LQSXW VRXUFH IURP WKH ,QSXW 6RXUFH 6HOHFWLRQ 0HQX VHH SDJH DJDLQ RU DGMXVW WKH VFUHHQ VL]H ZLWK WKH '=220 Ÿź EXWWRQV SELECT button D.ZOOM + button D.ZOOM - button 3Note: 7KHPLQLPXPFRPSUHVVLRQUDWLRLVOLPLWHG GHSHQGLQJRQWKHLQSXWVLJQDOZKHQWKH .H\VWRQHIXQFWLRQLVZRUNLQJRUZKHQWKH FXVWRPLVVHOHFWHGIRUWKHVFUHHQVL]H TrueFullDQGDigital zoom +/–FDQQRW EHVHOHFWHGZKHQ480i575i480pRU 575pLVVHOHFWHGLQWKH3&6\VWHP0HQX S Digital zoom +/-FDQQRWEHVHOHFWHG ZKHQFullRUTrueLVVHOHFWHG :KHQCustomLVVHOHFWHGWKH'LJLWDO ]RRPIXQFWLRQLVGLVDEOHG 35 Video Input Input Source Selection (Video, S-video) Direct Operation &KRRVH Video RU S-video E\ SUHVVLQJ WKH 9,'(2 RU WKH 69,'(2EXWWRQRQWKHUHPRWHFRQWURO %HIRUH XVLQJ WKHVH EXWWRQV FRUUHFW LQSXW VRXUFH VKRXOG EH VHOHFWHGWKURXJKPHQXRSHUDWLRQDVGHVFULEHGEHORZ Remote Control VIDEO button Video S-VIDEO button S-video Menu Operation 1 3UHVVWKH0(18EXWWRQWRGLVSOD\WKH2Q6FUHHQ 0HQX8VHWKH3RLQWŸźEXWWRQVWRVHOHFWInputDQG WKHQSUHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQ 2 8VHWKH3RLQWŸźEXWWRQVWRVHOHFWVideoDQGWKHQ SUHVVWKH6(/(&7EXWWRQ Input Menu or 3 8VHWKH3RLQWŸźEXWWRQVWRVHOHFWComputer 1$QG WKHQSUHVVWKH3RLQWŹEXWWRQWRDFFHVVWKHVXEPHQX LWHPV8VHWKH3RLQWŸźEXWWRQVWRVHOHFWWKHS-video DQGWKHQSUHVVWKH6(/(&7EXWWRQ or Video :KHQ YLGHR LQSXW VLJQDO LV FRQQHFWHG WR WKH 9,'(2MDFNVHOHFWVideo S-video :KHQ YLGHR LQSXW VLJQDO LV FRQQHFWHG WR WKH 6 9,'(2MDFNVHOHFWS-video 3Note: :KHQWKH,QSXW6HDUFKIXQFWLRQLVVHWWROn1RUOn2LQ WKH$XWRVHWXSIXQFWLRQWKHLQSXWVLJQDOZLOOEHVHDUFKHG DXWRPDWLFDOO\S 36 Computer 1 Video Input Input Source Selection (Component, RGB Scart 21-pin) Direct Operation &KRRVHComputer 1(Component)RUComputer 1(Scart) E\SUHVVLQJWKH&20321(17RUWKH&20387(5 EXWWRQRQWKHUHPRWHFRQWURO %HIRUHXVLQJWKHVHEXWWRQVFRUUHFWLQSXWVRXUFHVKRXOGEHVHOHFWHGWKURXJK0HQXRSHUDWLRQDVGHVFULEHG EHORZ Remote Control COMPUTER 1 button Computer 1(RGB) Computer 1(Scart) COMPONENT button Computer 1(Component) Menu Operation 1 3UHVVWKH0(18EXWWRQWRGLVSOD\WKH2Q6FUHHQ 0HQX8VHWKH3RLQWŸźEXWWRQVWRVHOHFWInputDQG WKHQSUHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQ 2 8VHWKH3RLQWŸźEXWWRQVWRVHOHFWComputer 1DQG WKHQSUHVVWKH3RLQWŹEXWWRQ 3 8VHWKH3RLQWŸźEXWWRQVWRVHOHFWComponentRU RGB(Scart)DQGWKHQSUHVVWKH6(/(&7EXWWRQ Component :KHQWKHLQSXWVRXUFHLVFRPLQJIURPYLGHR HTXLSPHQWFRQQHFWHGWRWKH&20387(5 ,169,'(2,1&20321(17,1WHUPLQDO ZLWKD&RPSRQHQW9*$&DEOHVHOHFW Component RGB (Scart) :KHQWKHLQSXWVRXUFHLVFRPLQJIURPYLGHR HTXLSPHQWFRQQHFWHGWRWKH&20387(5 ,169,'(2,1&20321(17,1WHUPLQDO ZLWKD6FDUW9*$&DEOHVHOHFWRGB (Scart) Input Menu 3Note: :KHQWKH,QSXW6HDUFKIXQFWLRQLVVHWWROn1RUOn2 WKHLQSXWVLJQDOZLOOEHVHDUFKHGDXWRPDWLFDOO\S 37 Video Input Video System Selection 1 3UHVVWKH0(18EXWWRQWRGLVSOD\WKH2Q6FUHHQ 0HQX8VHWKH3RLQWŸźEXWWRQVWRVHOHFWInputDQG WKHQSUHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQ 2 6HOHFWVideoS-videoRUComputer 1(Component) LQSXWVRXUFH6HHSDJHV 3 8VHWKH3RLQWŸźEXWWRQVWRVHOHFWSystemDQGWKHQ SUHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQ8VHWKH3RLQW ŸźEXWWRQVWRVHOHFWWKHGHVLUHGV\VWHPDQGWKHQ SUHVVWKH6(/(&7EXWWRQ AV System Menu (Video or S-video) Video or S-video Auto 7KH SURMHFWRU DXWRPDWLFDOO\ GHWHFWV DQ LQFRPLQJ YLGHR V\VWHP DQG DGMXVWV LWVHOI WR RSWLPL]H LWV SHUIRUPDQFH :KHQ9LGHR6\VWHPLVPAL-MRUPAL-NVHOHFWWKHV\VWHP PDQXDOO\ PAL/SECAM/NTSC/NTSC4.43/PAL-M/PAL-N ,I WKH SURMHFWRU FDQQRW UHSURGXFH SURSHU YLGHR LPDJH VHOHFW D VSHFLILF EURDGFDVW VLJQDO IRUPDW IURP DPRQJ PAL SECAMNTSCNTSC 4.43PAL-MDQGPAL-N Component Auto 7KH SURMHFWRU DXWRPDWLFDOO\ GHWHFWV DQ LQFRPLQJ YLGHR VLJQDODQGDGMXVWVLWVHOIWRRSWLPL]HLWVSHUIRUPDQFH AV System Menu (Component) COMPONENT VIDEO SIGNAL FORMAT ,IWKHSURMHFWRUFDQQRWUHSURGXFHSURSHUYLGHRLPDJHVHOHFW DVSHFLILFFRPSRQHQWYLGHRVLJQDOIRUPDWIURPDPRQJ480i 575i480p575p720p1035iDQG1080i Component 3Note: 7KH$96\VWHP0HQXFDQQRWEHVHOHFWHGZKHQVHOHFWLQJ RGB (Scart) 38 Video Input Image Mode Selection Direct Operation Remote Control IMAGE button Dynamic 6HOHFWWKHGHVLUHGLPDJHPRGHDPRQJDynamicStandard CinemaBlackboard (Green)ColorboardImage 1 Image 2Image 3DQGImage 4E\SUHVVLQJWKH,0$*( EXWWRQRQWKHUHPRWHFRQWURO Standard Cinema Menu Operation 1 2 3UHVVWKH0(18EXWWRQWRGLVSOD\WKH2Q6FUHHQ0HQX 8VHWKH3RLQWŸźEXWWRQVWRVHOHFWImageselectDQG WKHQSUHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQ Blackboard (Green) IMAGE button 8VHWKH3RLQWŸźEXWWRQVWRVHOHFWWKHGHVLUHGLWHP DQGWKHQSUHVVWKH6(/(&7EXWWRQ Colorboard Image 1 Image 2 Image 3 Image 4 Dynamic )RUYLHZLQJSLFWXUHVLQDEULJKWURRP Image select Menu Standard 1RUPDOSLFWXUHPRGHSUHVHWRQWKHSURMHFWRU Cinema 3LFWXUHPRGHDGMXVWHGZLWKILQHWRQH Blackboard (Green) )RUWKHLPDJHSURMHFWHGRQDEODFNERDUG 7KLVPRGHKHOSHQKDQFHWKHLPDJHSURMHFWHGRQD EODFNERDUG7KLVLVPDLQO\HIIHFWLYHRQDJUHHQFRORUHG ERDUGQRWWUXO\HIIHFWLYHRQDEODFNFRORUHGERDUG Colorboard $WWKHWLPHRIVLPSOHSURMHFWLRQRQWKHFRORUHGZDOO\RX FDQJHWWKHFORVHFRORULPDJHWRWKHFRORULPDJHSURMHFWHG RQDZKLWHVFUHHQE\VHOHFWLQJWKHVLPLODUFRORUWRWKHZDOO FRORUIURPWKHSUHVHWIRXUFRORUV Image 1–4 )RUYLHZLQJZLWKWKHXVHUSUHVHWLPDJHPRGHLQWKH,PDJH $GMXVW0HQXVHHSDJHV7KLV,PDJHPHPRU\LV SURYLGHGLQHDFKFRPSXWHUVFDUWFRPSRQHQW6YLGHRDQG YLGHRLQSXWVRXUFH 39 Video Input Image Adjustment 1 3UHVVWKH0(18EXWWRQWRGLVSOD\WKH2Q6FUHHQ 0HQX8VHWKH3RLQWŸźEXWWRQVWRVHOHFWImage adjustDQGWKHQSUHVVWKH3RLQWŹRUWKH6(/(&7 EXWWRQ 2 8VHWKH3RLQWŸźEXWWRQVVHOHFWWKHGHVLUHGLWHP DQGWKHQSUHVVWKH6(/(&7EXWWRQWRGLVSOD\WKH DGMXVWPHQWGLDORJER[8VHWKH3RLQWŻŹEXWWRQVWR DGMXVWWKHVHWWLQJYDOXH Image Adjust Menu Reset Contrast 3UHVVWKH3RLQWŻEXWWRQWRGHFUHDVHWKHFRQWUDVWSUHVVWKH 3RLQWŹEXWWRQWRLQFUHDVHWKHFRQWUDVWIURPWR Store 6HOHFWHG,PDJHPRGH Brightness 3UHVVWKH3RLQWŻEXWWRQWRGHFUHDVHWKHEULJKWQHVVSUHVV WKH3RLQWŹEXWWRQWRLQFUHDVHWKHEULJKWQHVVIURPWR Color 3UHVVWKH3RLQWŻEXWWRQGHFUHDVHWKHLQWHQVLW\RIWKHFRORU SUHVVWKH3RLQWŹEXWWRQLQFUHDVHWKHLQWHQVLW\RIWKHFRORU IURPWR Reset Store Tint 3UHVVWKH3RLQWŻŹEXWWRQVWRDGMXVWWKHWLQWYDOXHWRJHWD SURSHUFRORUEDODQFHIURPWR 8VHWKH3RLQWŻŹ EXWWRQVWRDGMXVWWKH VHWWLQJYDOXH Color temp. 8VHWKH3RLQWŻŹEXWWRQVWRVHOHFWWKHGHVLUHG&RORUWHPS OHYHO+LJK0LG/RZRU;/RZ White balance (Red) 3UHVVWKH3RLQWŻEXWWRQWROLJKWHQUHGWRQHSUHVVWKH3RLQW ŹEXWWRQWRGHHSHQUHGWRQHIURPWR White balance (Green) 3UHVV WKH 3RLQW Ż EXWWRQ WR OLJKWHQ JUHHQ WRQH SUHVV WKH 3RLQWŹEXWWRQWRGHHSHQJUHHQWRQHIURPWR White balance (Blue) 3UHVV WKH 3RLQW Ż EXWWRQ WR OLJKWHQ EOXH WRQH SUHVV WKH 3RLQWŹEXWWRQWRGHHSHQEOXHWRQHIURPWR 3Note: :KHQWKHWhite balance RedGreenRUBlueLVDGMXVWHGWKH&RORUWHPSOHYHOZLOOFKDQJHWRUser 7LQWFDQQRWEHVHOHFWHGZKHQWKHYLGHRV\VWHPLVPALSECAMPAL-MRUPAL-NS :KHQBlackboard(Green)RU Colorboard LVVHOHFWHGLQ,PDJHVHOHFWColortemp.ZLOOFKDQJHWR BlackboardRUColorboard 40 Video Input Sharpness 3UHVVWKH3RLQW ŻEXWWRQWRGHFUHDVHWKHVKDUSQHVVRIWKH LPDJHSUHVVWKH3RLQW ŹEXWWRQWRLQFUHDVHWKHVKDUSQHVV RIWKHLPDJHIURPWR Gamma 8VH WKH 3RLQW ŻŹ EXWWRQV WR DGMXVW WKH JDPPD YDOXH WR REWDLQDEHWWHUEDODQFHRIFRQWUDVWIURPWR Noise reduction 1RLVH LQWHUIHUHQFH RQ WKH VFUHHQ FDQ EH UHGXFHG 6HOHFW RQHRIWKHIROORZLQJRSWLRQVWRJHWVPRRWKHULPDJHV Off'LVDEOHG L1/RZHUUHGXFWLRQ L2+LJKHUUHGXFWLRQ Progressive $Q LQWHUODFHG YLGHR VLJQDO FDQ EH GLVSOD\HG LQ SURJUHVVLYH PRGH6HOHFWRQHRIWKHIROORZLQJRSWLRQV Off'LVDEOHG L1)RUDQDFWLYHSLFWXUH L2)RUDVWLOOSLFWXUH Film)RUZDWFKLQJDILOP:LWKWKLVIXQFWLRQWKH SURMHFWRUUHSURGXFHVSLFWXUHVIDLWKIXOWRWKH RULJLQDOILOPTXDOLW\ Reset Store Menu 7R UHVHW WKH DGMXVWHG GDWD VHOHFW Reset DQG SUHVV WKH 6(/(&7EXWWRQ$FRQILUPDWLRQER[DSSHDUVDQGWKHQVHOHFW Yes$OODGMXVWPHQWVZLOOUHWXUQWRWKHLUSUHYLRXVILJXUHV Store 7RVWRUHWKHDGMXVWHGGDWDVHOHFWStoreDQGSUHVVWKHWKH 3RLQWŹRUWKH6(/(&7EXWWRQ8VHWKH3RLQWŸźEXWWRQV WRVHOHFWRQHIURP,PDJHWRDQGSUHVVWKH6(/(&7 EXWWRQ $FRQILUPDWLRQER[DSSHDUVDQGWKHQVHOHFWYes6WRUHG GDWDFDQEHFDOOHGXSE\VHOHFWLQJDQImage (1–4)LQWKH ,PDJH0RGH6HOHFWLRQRQSDJH $FRQILUPDWLRQER[ DSSHDUVDQGWKHQ VHOHFWYes 3Note: Noise reductionDQGProgressiveFDQQRWEHVHOHFWHG ZKHQ480p575p720p1035iRU1080iLVVHOHFWHG S 41 Video Input Screen Size Adjustment 7KLVSURMHFWRUKDVWKHSLFWXUHVFUHHQUHVL]HIXQFWLRQZKLFKHQDEOHV\RXWRFXVWRPL]HWKHLPDJHVL]H 1 3UHVVWKH0(18EXWWRQWRGLVSOD\WKH2Q6FUHHQ 0HQX8VHWKH3RLQWŸźEXWWRQVWRVHOHFWScreenDQG WKHQSUHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQ 2 8VHWKH3RLQWŸźEXWWRQVVHOHFWWKHGHVLUHGLWHPDQG WKHQSUHVVWKH6(/(&7EXWWRQ Screen Menu Normal 3URYLGHWKHLPDJHDWWKHQRUPDOYLGHRDVSHFWUDWLR Wide 3URYLGHWKHLPDJHDWWKHZLGHVFUHHQUDWLR Custom $GMXVW WKH VFUHHQ VFDOH DQG SRVLWLRQ PDQXDOO\ ZLWK WKLV IXQFWLRQ 3UHVVWKH3RLQWŹEXWWRQDWCustomDQGWKHCustomLV GLVSOD\HGRQWKHVFUHHQ\RXFDQXVHWKH3RLQWŸźEXWWRQV WRFKRRVHWKHLWHP\RXZDQWWRDGMXVW Scale H/V $GMXVWWKH+RUL]RQWDO9HUWLFDOVFUHHQ VFDOH H&V :KHQVHWWROnWKHDVSHFWUDWLRLV IL[HG7KHScale VDSSHDUVGLPPHGDQG EHFRPHVXQDYDLODEOH$GMXVWScale H WKHQWKHVFUHHQVFDOHLVDXWRPDWLFDOO\ PRGLILHGEDVHGRQWKHDVSHFWUDWLR Position H/V $GMXVW WKH +RUL]RQWDO9HUWLFDO VFUHHQ SRVLWLRQ Common 6DYHWKHDGMXVWHGVFDOHRUSRVLWLRQWRDOO WKHLQSXWV3UHVVWKH6(/(&7EXWWRQDW CommonWRGLVSOD\DFRQILUPDWLRQER[ 7RVDYHWKHVFDOHRUSRVLWLRQSUHVVWKH 6(/(&7EXWWRQDWYes:KHQCustom LVVHOHFWHGWKHVDYHGVFDOHRUSRVLWLRQLV XVHG Reset 5HVHWWKHDOODGMXVWHGYDOXHV3UHVV WKH6(/(&7EXWWRQDWResetWRGLVSOD\ DFRQILUPDWLRQER[7RUHVHWSUHVVWKH 6(/(&7EXWWRQDWYes 42 3Note: :KHQQRVLJQDOLVGHWHFWHGNormalLVVHW DXWRPDWLFDOO\ 7KHDGMXVWDEOHUDQJHIRUScale H/VDQG Position H/VLVOLPLWHGGHSHQGLQJRQWKH LQSXWVLJQDO WideFDQQRWEHRSHUDWHGZKHQ720p 1035iRU1080iLVVHOHFWHGLQWKH$9 6\VWHP0HQXS Setting Setting 7KLVSURMHFWRUKDVD6HWWLQJPHQXWKDWDOORZV\RXWRVHWXS WKHRWKHUYDULRXVIXQFWLRQVGHVFULEHGEHORZ 1 3UHVVWKH0(18EXWWRQWRGLVSOD\WKH2Q6FUHHQ 0HQX3UHVVWKH3RLQWŸźEXWWRQVWRVHOHFWSetting DQGSUHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQWRDFFHVV WKHVXEPHQXLWHPV 2 8VHWKH3RLQWŸźEXWWRQVWRVHOHFWWKHGHVLUHGLWHP DQGWKHQSUHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQWR DFFHVVWKHVHOHFWHGLWHP 3 8VHWKH3RLQWŸźEXWWRQVVHOHFWWKHGHVLUHGLWHPDQG WKHQSUHVVWKH6(/(&7EXWWRQ Language Setting Menu Language 7KHODQJXDJHXVHGLQWKH2Q6FUHHQ0HQXLVDYDLODEOHLQ EnglishGermanFrenchItalianSpanishPortuguese DutchSwedishFinnishPolishHungarianRomanian RussianChineseKoreanJapanese,ThaiDQGTurkish Menu position 7KLVIXQFWLRQLVXVHGWRFKDQJHWKHSRVLWLRQRIWKH 2Q6FUHHQ0HQX6HOHFWMenu positionDQGSUHVVWKH 6(/(&7EXWWRQ 7KH0HQXSRVLWLRQFKDQJHVHDFKWLPH\RXSUHVV6(/(&7 EXWWRQDVIROORZV WKHWRSOHIWĺWKHWRSULJKWĺWKHFHQWHUĺWKHERWWRPOHIW ĺWKHERWWRPULJKWĺWKHWRSOHIWĺ 43 Setting Auto setup 7KLVIXQFWLRQHQDEOHV,QSXWVHDUFK$XWR.H\VWRQHFRUUHFWLRQ DQG$XWR3&DGMXVWPHQWE\SUHVVLQJWKH$8726(783EXWWRQ RQWKHWRSFRQWURORUWKH$8726(7EXWWRQRQWKHUHPRWH FRQWURO6HWWLQJVIRUWKRVHIXQFWLRQVFDQEHDOWHUHGDVIROORZV Auto setup Input search 7KLVIXQFWLRQGHWHFWVWKHLQSXWVLJQDODXWRPDWLFDOO\:KHQ DVLJQDOLVIRXQGWKHVHDUFKZLOOVWRS8VHWKH3RLQWŸź EXWWRQVWRVHOHFWRQHRIWKHIROORZLQJRSWLRQV Off,QSXWVHDUFKZLOOQRWZRUN On1,QSXWVHDUFKZRUNVXQGHUWKHIROORZLQJVLWXDWLRQ ±:KHQSUHVVLQJWKH$8726(783EXWWRQRQ WKHWRSFRQWURO ±:KHQ SUHVVLQJ WKH$872 6(7 EXWWRQ RQ WKH UHPRWHFRQWURO On2,QSXWVHDUFKZRUNVXQGHUWKHIROORZLQJVLWXDWLRQ ±:KHQWXUQLQJRQWKHSURMHFWRUE\SUHVVLQJWKH 2167$1'%<EXWWRQRQWKHWRSFRQWURORUWKH UHPRWHFRQWURO ±:KHQ SUHVVLQJ WKH$872 6(7 EXWWRQ RQ WKH UHPRWHFRQWURO ±:KHQ SUHVVLQJ WKH $872 6(783 EXWWRQ RQ WKHWRSFRQWURO ±:KHQWKHFXUUHQWLQSXWVLJQDOLVFXWRII ,IWKH1RVKRZRU)UHH]HIXQFWLRQLVDFWLYHFDQFHOLWWR DFWLYDWHWKH,QSXWVHDUFK,WLVDOVRXQDYDLODEOHZKHQ 2Q6FUHHQPHQXLVGLVSOD\HG Auto PC adj. On (QDEOHV $XWR 3& $GMXVWPHQW ZKHQ SUHVVLQJ WKH$8726(7EXWWRQRQWKHUHPRWHFRQWURORU WKH$8726(783EXWWRQRQWKHWRSFRQWURO Off 'LVDEOHV$XWR3&$GMXVWPHQW Auto Keystone Auto $OZD\VZRUNVDQGFRUUHFWVNH\VWRQHGLVWRUWLRQ DFFRUGLQJWRWKHSURMHFWRU VWLOW Manual :RUNVRQO\ZKHQSUHVVLQJWKH$8726(783 EXWWRQRQWKHWRSFRQWURORUWKH$8726(7 EXWWRQRQWKHUHPRWHFRQWURO Off 'LVDEOHV$XWR.H\VWRQH 3Note: :KLOHInput searchLVVHWWROn1RUOn2WKHVWDWXVRI,QSXW DQG/DPSDUHGLVSOD\HGHYHU\WLPHWKHVLJQDOLVVZLWFKHG 2QO\WKHODVWVHOHFWHGLQSXWVRXUFHFDQEHGHWHFWHG 'XULQJInput searchLVLQSURJUHVV,IWKH0(18EXWWRQRU WKH2167$1'%<EXWWRQLVSUHVVHGInput searchZLOOVWRS ,IWKH&20387(5EXWWRQRU9,'(2RU&20321(17RU 69,'(2EXWWRQLVSUHVVHGInput searchZLOOVWRSDQGJR EDFNWRWKHEXWWRQ VLQSXWVLJQDO Input searchAuto PC adj.DQGAuto KeystoneFDQQRWEH VHWOffDWWKHVDPHWLPH 44 3Note: Auto KeystoneFRUUHFWVYHUWLFDOGLVWRUWLRQRQO\ QRWFRUUHFWKRUL]RQWDOGLVWRUWLRQ 7KH$XWR.H\VWRQHIXQFWLRQFDQQRWZRUNZKHQ WKHCeilingIHDWXUHLVVHWOnLQWKH6HWWLQJPHQX S 3HUIHFWFRUUHFWLRQRIWKHLPDJHGLVWRUWLRQFDQQRW EHHQVXUHGZLWKWKH$XWRVHWXSIXQFWLRQ,IWKH GLVWRUWLRQLVQRWFRUUHFWHGSURSHUO\E\SUHVVLQJWKH $8726(783RUWKH$8726(7EXWWRQDGMXVW PDQXDOO\E\SUHVVLQJWKH.(<6721(EXWWRQRQ WKHUHPRWHFRQWURORUVHOHFWLQJKeystoneLQWKH 6HWWLQJPHQXSS Fine syncTotal dotsHorizontalDQGVertical SRVLWLRQRIVRPHFRPSXWHUVFDQQRWEHIXOO\ DGMXVWHGZLWKWKH$XWR3&$GMXVWPHQWIXQFWLRQ :KHQWKHLPDJHLVQRWSURYLGHGSURSHUO\ZLWK WKLVRSHUDWLRQPDQXDODGMXVWPHQWVDUHUHTXLUHG SS Setting Keystone 7KLVIXQFWLRQLVXVHGWRVWRUHRUUHVHWWKHNH\VWRQH FRUUHFWLRQZKHQWKH$&SRZHUFRUGLVXQSOXJJHG Keystone Store .HHS WKH NH\VWRQH FRUUHFWLRQ HYHQ ZKHQ WKH $&SRZHUFRUGLVXQSOXJJHG Reset 5HOHDVH WKH NH\VWRQH FRUUHFWLRQ ZKHQ WKH$& SRZHUFRUGLVXQSOXJJHG 7RFRUUHFWNH\VWRQHGLVWRUWLRQSUHVVWKH6(/(&7EXWWRQ KeystoneDSSHDUVRQWKHVFUHHQ8VHWKH3RLQWŸźEXWWRQV WRFRUUHFWNH\VWRQHGLVWRUWLRQS Background 6HOHFWWKHEDFNJURXQGVFUHHQIRUZKHQQRLQSXWVLJQDOLV GHWHFWHG3UHVVWKH3RLQWŸźEXWWRQVWRVZLWFKEHWZHHQ HDFKRSWLRQ Blue 3URMHFWDEOXHEDFNJURXQG User 3URMHFWDQLPDJHVHOHFWHGLQWKH/RJRVHWWLQJ Black 3URMHFWDEODFNEDFNJURXQG Display 7KLVIXQFWLRQGHFLGHVZKHWKHUWRGLVSOD\2Q6FUHHQ 'LVSOD\V On 6KRZDOOWKH2Q6FUHHQGLVSOD\V8VH WKLVIXQFWLRQZKHQ\RXZDQWWRSURMHFW LPDJHVDIWHUWKHODPSEHFRPHVEULJKW HQRXJK7KHIDFWRU\GHIDXOWVHWWLQJLV LQWKLVRSWLRQ Countdown Off 6KRZ WKH LQSXW LPDJH LQVWHDG RI WKH FRXQWGRZQ ZKHQ WXUQLQJ RQ WKH SURMHFWRU8VHWKLVIXQFWLRQZKHQ\RX ZDQWWRSURMHFWWKHLPDJHDVHDUO\DV SRVVLEOH HYHQ ZKHQ WKH ODPS LV QRW EULJKWHQRXJK Off +LGHWKH2Q6FUHHQ'LVSOD\VH[FHSW Ɣ2Q6FUHHQ0HQX ƔPower off?S Ɣ37LPHUGLVSOD\S ƔNo signalIRU3RZHUPDQDJHPHQW S ƔPlease wait ... Ɣ$UURZVIRUWKH7UXHIXQFWLRQLQWKH 6FUHHQ0HQXS 45 Setting Logo (Logo and Logo PIN code lock settings) 7KLVIXQFWLRQDOORZV\RXWRFXVWRPL]HWKHVFUHHQORJRZLWK Logo selectcaptureLogo PIN code lockDQGLogo PIN code changeIXQFWLRQV Logo select 3Note: :KHQOnLVVHOHFWHGLQWKH/RJR3,1FRGHORFNIXQFWLRQ Logo selectDQGCaptureIXQFWLRQVFDQQRWEHVHOHFWHG Logo select 7KLVIXQFWLRQGHFLGHVRQWKHVWDUWLQJXSGLVSOD\IURP DPRQJIROORZLQJRSWLRQV User 6KRZWKHLPDJH\RXFDSWXUHG Default 6KRZWKHIDFWRU\VHWORJR Off 6KRZWKHFRXQWGRZQGLVSOD\RQO\ 46 Off Setting Capture 7KLVIXQFWLRQHQDEOHV\RXWRFDSWXUHDQLPDJHEHLQJ SURMHFWHGWRXVHLWIRUDVWDUWLQJXSGLVSOD\RULQWHUYDORI SUHVHQWDWLRQV Capture 6HOHFWCaptureDQGSUHVVWKH6(/(&7EXWWRQ $FRQILUPDWLRQER[DSSHDUVDQGVHOHFWYesWRFDSWXUHWKH SURMHFWHGLPDJH $IWHU FDSWXULQJ WKH SURMHFWHG LPDJH JR WR WKH /RJR VHOHFW IXQFWLRQDQGVHWLWWRUser7KHQWKHFDSWXUHGLPDJHZLOOEH GLVSOD\HGWKHQH[WWLPH\RXWXUQRQWKHSURMHFWRU 7RFDQFHOWKHFDSWXUHIXQFWLRQVHOHFWYesLQWKH4XLW" FRQILUPDWLRQER[ 3Note: %HIRUH FDSWXULQJ DQ LPDJH VHOHFW Standard LQ WKH ,PDJH VHOHFW 0HQX WR FDSWXUH D SURSHU LPDJH SS $ VLJQDO IURP D FRPSXWHU FDQ EH FDSWXUHG XS WR ;*$ [ $ VLJQDO IURP YLGHR HTXLSPHQW FDQ EH FDSWXUHGH[FHSWIRUSLDQGL :KHQ FDSWXULQJ WKH LPDJH WKDW KDV EHHQ DGMXVWHG E\ WKH.H\VWRQHIXQFWLRQWKHDGMXVWHGGDWDLVDXWRPDWLFDOO\ UHVHW DQG WKH SURMHFWRU FDSWXUHV DQ LPDJH ZLWKRXW NH\VWRQHFRUUHFWLRQ :KHQLogo PIN code lockLVVHWWROncaptureFDQQRW EHVHOHFWHG :KHQ VWDUWLQJ WR FDSWXUH D QHZ LPDJH WKH SUHYLRXVO\ VWRUHGLPDJHLVFOHDUHGHYHQLI\RXFDQFHOWKHFDSWXULQJ :KHQ WKHUH LV QR FDSWXUHG LPDJH RU LW LV LQWHUUXSWHG ZKLOHFDSWXULQJDQLPDJHUserFDQQRWEHVHOHFWHG\RX FDQRQO\VZLWFKEHWZHHQDefaultDQGOff Logo PIN code lock 7KLVIXQFWLRQSUHYHQWVDQXQDXWKRUL]HGSHUVRQIURP FKDQJLQJWKHVFUHHQORJR Logo PIN code lock Off Off 7KHVFUHHQORJRFDQEHFKDQJHGIUHHO\IURP WKH/RJR0HQXS On 7KHVFUHHQORJRFDQQRWEHFKDQJHGZLWKRXWD /RJR3,1FRGH ,I\RXZDQWWRFKDQJHWKHLogo PIN code lockVHWWLQJ SUHVVWKH6(/(&7EXWWRQDQGWKH/RJR3,1FRGHGLDORJ ER[DSSHDUV(QWHUD/RJR3,1FRGHE\IROORZLQJWKHVWHSV EHORZ7KHLQLWLDOLogo PIN codeLVVHWWR³´DWWKH IDFWRU\ 47 Setting Enter a Logo PIN code 8VHWKH3RLQWŸźEXWWRQVWRHQWHUDQXPEHU3UHVVWKH 3RLQWŻŹEXWWRQVWRIL[WKHQXPEHUDQGPRYHWKHUHG IUDPHSRLQWHUWRWKHQH[WER[7KHQXPEHUFKDQJHVWR ¼,I\RXIL[HGDQLQFRUUHFWQXPEHUXVHWKH3RLQWŻŹ EXWWRQVWRPRYHWKHSRLQWHUWRWKHQXPEHU\RXZDQWWR FRUUHFWDQGWKHQHQWHUWKHFRUUHFWQXPEHU 5HSHDWWKLVVWHSWRFRPSOHWHHQWHULQJDIRXUGLJLW QXPEHU Enter a Logo PIN code $IWHUDFRUUHFW/RJR3,1FRGH LVHQWHUHGWKHIROORZLQJGLDORJ ER[DSSHDUV Change the Logo PIN code lock setting $IWHUHQWHULQJWKHIRXUGLJLWQXPEHUPRYHWKHSRLQWHUWR Set 3UHVV WKH 6(/(&7 EXWWRQ VR WKDW \RX FDQ VWDUW WR RSHUDWHWKHSURMHFWRU Off ,I\RXHQWHUHGDQLQFRUUHFW/RJR3,1FRGHLogo PIN codeDQGWKHQXPEHU¼¼¼¼ZLOOWXUQUHGIRUD PRPHQW(QWHUWKHFRUUHFW/RJR3,1FRGHDOORYHUDJDLQ 6HOHFW Change the Logo PIN code lock setting 8VHWKH3RLQWŸźEXWWRQVWRVZLWFKOnRUOffDQGWKHQ SUHVVWKH6(/(&7EXWWRQWRPDNHDFKLRFH Change the Logo PIN code Logo PIN code change /RJR3,1FRGHFDQEHFKDQJHGWR\RXUGHVLUHGIRXUGLJLW QXPEHU3UHVVWKH6(/(&7EXWWRQWRVHOHFWLogo PIN code changeLogo PIN code GLDORJER[DSSHDUVXVH WKH3RLQWŸźEXWWRQVWRHQWHUWKHFRUUHFWFRGH7KH1HZ /RJR3,1FRGHLQSXWGLDORJER[DSSHDUV6HWDQHZ/RJR 3,1FRGHFRQILUPDWLRQER[DSSHDUVFKRRVHYesWRVHW WKHQHZ/RJR3,1FRGH %HVXUHWRQRWHWKHQHZ/RJR3,1FRGHDQGNHHSLWRQ KDQG,I\RXORVWWKHQXPEHU\RXFRXOGQRORQJHUFKDQJH WKH/RJR3,1FRGHVHWWLQJ CAUTION: WHEN YOU HAVE CHANGED THE LOGO PIN CODE, WRITE DOWN THE NEW PIN CODE IN COLUMN OF THE LOGO PIN CODE NO. MEMO ON PAGE 75, AND KEEP IT SECURELY. SHOULD THE LOGO PIN CODE BE LOST OR FORGOTTEN, THE LOGO PIN CODE SETTING CAN NO LONGER BE CHANGED. 48 e t Setting Ceiling Ceiling :KHQ WKLV IXQFWLRQ LV VHW WR On WKH SLFWXUH ZLOO EH WRS ERWWRP DQG OHIWULJKW UHYHUVHG 7KLV IXQFWLRQ LV XVHG WR SURMHFWWKHLPDJHIURPDFHLOLQJPRXQWHGSURMHFWRU Rear :KHQWKLVIXQFWLRQLVVHWWROnWKHSLFWXUHZLOOEHOHIWULJKW UHYHUVHG 7KLV IXQFWLRQ LV XVHG WR SURMHFW WKH LPDJH IURP UHDURIWKHVFUHHQ Rear Terminal 7KH&20387(5,1021,725287WHUPLQDORQWKHEDFN RI WKH SURMHFWRU LV VZLWFKDEOH IRU FRPSXWHU LQSXW RU PRQLWRU RXWSXW 6HH SDJH 6HOHFW Computer 2 RU Monitor Out ZLWKWKH3RLQWŸźEXWWRQV Terminal Computer 2 FRPSXWHULQSXW Monitor Out PRQLWRURXW 7HUPLQDOIXQFWLRQLVQRWDYDLODEOHZKHQVHOHFWLQJComputer 2WRWKHLQSXWVRXUFH&KDQJHWKHLQSXWVRXUFHWRWKHRWKHUV (Computer 1, DQG VR RQ VR WKDW WKH7HUPLQDO IXQFWLRQ ZLOO EHDYDLODEOHS 49 Setting Power management Power management )RUUHGXFLQJSRZHUFRQVXPSWLRQDVZHOODVPDLQWDLQLQJ WKHODPSOLIHWKH3RZHUPDQDJHPHQWIXQFWLRQWXUQVRIIWKH SURMHFWLRQODPSZKHQWKHSURMHFWRULVQRWRSHUDWHGIRUD FHUWDLQSHULRG 6HOHFWRQHRIWKHIROORZLQJRSWLRQV Ready :KHQWKHODPSKDVEHHQIXOO\FRROHG GRZQWKH32:(5LQGLFDWRUFKDQJHV WRJUHHQEOLQNLQJ,QWKLVFRQGLWLRQ WKHSURMHFWLRQODPSZLOOEHWXUQHGRQLI WKHLQSXWVLJQDOLVUHFRQQHFWHGRUDQ\ EXWWRQRQWKHWRSFRQWURORUUHPRWH FRQWUROLVSUHVVHG Shut down :KHQWKHODPSKDVEHHQIXOO\FRROHG GRZQWKHSRZHUZLOOEHWXUQHGRII Off 3RZHUPDQDJHPHQWIXQFWLRQLVRII Timer ,IWKHLQSXWVLJQDOLVLQWHUUXSWHGDQG QREXWWRQLVSUHVVHGIRUPRUHWKDQ VHFRQGVWKHWLPHUGLVSOD\ZLWK No signalDSSHDUV,WVWDUWVWKH FRXQWGRZQXQWLOWKHODPSLVWXUQHGRII 8VHWKH3RLQWŸźEXWWRQVWRVHWWKH 7LPHUaPLQ 3Note: )DFWRU\GHIDXOWLVReady: 5 min On start :KHQWKLVIXQFWLRQLVVHWWROnWKHSURMHFWRUZLOOEH DXWRPDWLFDOO\WXUQHGRQMXVWE\FRQQHFWLQJWKH$&SRZHU FRUGWRDZDOORXWOHW 3Note: :KHQStandby modeLVVHWWREcoOn startFDQQRWEH VHOHFWHG,I\RXZDQWWRVHWOn start WROnStandby mode PXVWEHVHWWRNetwork %HVXUHWRWXUQRIIWKHSURMHFWRUSURSHUO\VHH³7XUQLQJ2II WKH3URMHFWRU´RQSDJH,IWKHSURMHFWRULVWXUQHGRIILQ WKHLQFRUUHFWVHTXHQFHWKH2QVWDUWIXQFWLRQZLOOQRW ZRUNSURSHUO\ 50 7LPHOHIWEHIRUH/DPSLVRII Setting Standby mode 7KLVIXQFWLRQLVDYDLODEOHZKHQRSHUDWLQJWKHSURMHFWRUYLD QHWZRUN Network 6XSSO\WKHSRZHUWRWKHQHWZRUNIXQFWLRQHYHQ DIWHU WXUQLQJ RII WKH SURMHFWRU E\ SUHVVLQJ WKH 2167$1'%< EXWWRQ RQ WKH UHPRWH FRQWURO <RX FDQ WXUQRQRIIWKHSURMHFWRUYLD QHWZRUN PRGLI\ QHWZRUN HQYLURQPHQW DQG UHFHLYH DQ HPDLO DERXW SURMHFWRU VWDWXV ZKLOH WKH SURMHFWRULVSRZHUHGRII Eco 6HOHFWEcoZKHQ\RXGRQRWXVHWKHSURMHFWRU YLD QHWZRUN 7KH SURMHFWRU¶V QHWZRUN IXQFWLRQ ZLOO VWRS ZKHQ WXUQLQJ RII WKH SURMHFWRU \RX FDQQRWWXUQRQWKHSURMHFWRUYLDQHWZRUN 5HIHUWRWKHRZQHU¶VPDQXDORI³1HWZRUN6HWXSDQG 2SHUDWLRQ´ Closed Caption 3Note: )DFWRU\GHIDXOWLVEco :KHQVHOHFWLQJNetworkWKHFRROLQJIDQVPD\EH UXQQLQJGHSHQGLQJRQWKHWHPSHUDWXUHLQVLGHWKH SURMHFWRUHYHQLIWKHSURMHFWRULVWXUQHGRII 6HW6WDQGE\PRGHWRNetwork ZKHQ2QVWDUWFRQWURO SRUWRUQHWZRUNIXQFWLRQVDUHDYDLODEOH Closed Caption &ORVHG&DSWLRQLVDSULQWHGYHUVLRQRIWKHSURJUDPVRXQGRU RWKHULQIRUPDWLRQGLVSOD\HGRQWKHVFUHHQ,IWKHLQSXWVLJQDO FRQWDLQVFORVHGFDSWLRQV\RXFDQWXUQRQWKHIHDWXUHDQG VZLWFKWKHFKDQQHOV3UHVVWKH3RLQWŸźEXWWRQVWRVHOHFW OffCC1CC2CC3RUCC4 IIWKH FORVHG FDSWLRQLV QRWFOHDU \RXFDQ FKDQJHWKHWH[W IURPColorWRWhite 3Note: 7KH&ORVHG&DSWLRQLVDYDLODEOHRQO\XQGHUWKHVLWXDWLRQ EHORZ :KHQWKHLQSXWVLJQDOLV&RPSRQHQWIRUDGMXVWPHQW RQO\9LGHRRU6YLGHRDQGWKHV\VWHPLVVHWWR$XWR 176&RULWKH&ORVHGFDSWLRQLVDYDLODEOH ,IWKHV\VWHPLVVHWWR$XWRDQGFKRRVH176&RU LDVWKHLQSXWVLJQDOWKH&ORVHGFDSWLRQZLOOEH DYDLODEOH &ORVHG&DSWLRQZLOOEHXQDYDLODEOHZKHQXQGHURWKHU VHWWLQJFRQGLWLRQV 7KH&ORVHGFDSWLRQLVXQDYDLODEOHZKHQ2Q6FUHHQ PHQXDQG37LPHUDUHGLVSOD\HG 7KHLWHPRI&ORVHG&DSWLRQLVGLVSOD\HGLQJUD\ZKLOHLW LVQRWDYDLODEOH 3UHVVWKH3RLQWŸźEXWWRQVWRVHOHFW OffCC1CC2CC3RUCC4DQGWKHQ SUHVVWKH6(/(&7EXWWRQ 51 Setting Lamp control Lamp life control Lamp control 7KLVIXQFWLRQDOORZV\RXWRFKDQJHEULJKWQHVVRIWKH VFUHHQ High %ULJKWHUWKDQWKH1RUPDOPRGH Normal 1RUPDOEULJKWQHVV Eco /RZHUEULJKWQHVVUHGXFHVWKHODPS SRZHUFRQVXPSWLRQDQGH[WHQGVWKH ODPSOLIH Lamp life control 6HOHFWWKHODPSRSHUDWLRQZKHQWKHWRWDOOLJKWLQJWLPHRID ODPSH[FHHGVWKHUHFRPPHQGHGWRWDOKRXUVRIXVH Mode 1 7KHODPSFDQEHWXUQHGRQHYHQDIWHU H[FHHGLQJWKHUHFRPPHQGHGWRWDO KRXUVRIXVH Mode 2 7KHODPSFDQEHWXUQHGRQHYHQDIWHU H[FHHGLQJWKHUHFRPPHQGHGWRWDO KRXUVRIXVH%XWWKHSURMHFWRUWXUQVRII DXWRPDWLFDOO\DIWHUPLQXWHV 3Note: /DPSPRGHFDQQRWEHFKDQJHGIRUDZKLOHDIWHUWXUQLQJ RQWKHSURMHFWRU/DPSQHHGVVRPHWLPHWRVWDELOL]H DIWHUWKHSRZHULVWXUQHGRQ6WRUHGODPSPRGHZLOOEH DFWLYHDIWHUWKHODPSLVVWDELOL]HG ,IMode 2KDVEHHQVHOHFWHGDQGWKHSURMHFWLRQODPS H[FHHGHVWKHUHFRPPHQGHGWRWDOKRXUVRIXVHWKH UHSODFHPHQWLFRQZLOOEHGLVSOD\HGDWWKHWLPHRISRZHU RQ7KHQWKHSURMHFWRUZLOOWXUQRIIDIWHUPLQXWHV Lamp replacement icon 7KH/DPSUHSODFHPHQWLFRQZLOOQRWDSSHDUZKHQWKH 'LVSOD\IXQFWLRQLVVHWWROffSGXULQJFreeze SRU No showS Remote control 7KLVSURMHFWRUSURYLGHVWZRGLIIHUHQWUHPRWHFRQWUROFRGHV WKHIDFWRU\VHWLQLWLDOFRGHCode 1DQGWKHVHFRQGDU\FRGH (Code 27KLVVZLWFKLQJIXQFWLRQSUHYHQWVUHPRWHFRQWURO LQWHUIHUHQFHZKHQRSHUDWLQJVHYHUDOSURMHFWRUVRUYLGHR HTXLSPHQWDWWKHVDPHWLPH :KHQRSHUDWLQJWKHSURMHFWRULQCode 2ERWKWKHSURMHFWRU DQGWKHUHPRWHFRQWUROPXVWEHVZLWFKHGWRCode 2 Remote control To change the code for the projector: 6HOHFWHLWKHUCode 1RUCode 2LQWKLV6HWWLQJ0HQX To change the code for the remote control: 3UHVVDQGKROGERWKWKH0(18DQG,0$*(EXWWRQV WRJHWKHUIRUVHFRQGVRUPRUH$IWHUFKDQJLQJWKHFRGH PDNHVXUHWKHUHPRWHFRQWURORSHUDWHVSURSHUO\ 3Note: :KHQGLIIHUHQWFRGHVDUHVHWRQWKHSURMHFWRUDQGRQWKHUHPRWHFRQWURODQ\RSHUDWLRQFDQQRWEHPDGH,QWKDWFDVH VZLWFKWKHFRGHRQWKHUHPRWHFRQWUROWRILWWKHFRGHRQWKHSURMHFWRU ,IWKHEDWWHULHVDUHUHPRYHGIURPWKHUHPRWHFRQWUROIRUDORQJSHULRGRIWLPHWKHUHPRWHFRQWUROFRGHZLOOEHUHVHW 52 Setting Security (Key lock and PIN code lock) Key lock 7KLVIXQFWLRQDOORZV\RXWRXVHWKH.H\ORFNDQG3,1FRGH ORFNIXQFWLRQWRVHWWKHVHFXULW\IRUWKHSURMHFWRURSHUDWLRQ Key lock 7KLVIXQFWLRQORFNVWKHWRSFRQWURODQGUHPRWHFRQWURO EXWWRQVWRSUHYHQWRSHUDWLRQE\XQDXWKRUL]HGSHUVRQV 6HOHFWKey lockDQGWKHQSUHVVWKH6(/(&7EXWWRQ DQGVHOHFWWKHGHVLUHGLWHPE\SUHVVLQJWKH3RLQWŸź EXWWRQV 8QORFNHG /RFNWKHRSHUDWLRQRIWKHWRSFRQWURO7R XQORFNXVHWKHUHPRWHFRQWURO /RFNWKHRSHUDWLRQRIWKHUHPRWHFRQWURO 7RXQORFNXVHWKHWRSFRQWURO ,IWKHWRSFRQWURODFFLGHQWDOO\EHFRPHVORFNHGDQG\RXGR QRWKDYHWKHUHPRWHFRQWUROQHDUE\RUWKHUHLVVRPHWKLQJ ZURQJZLWK\RXUUHPRWHFRQWUROFRQWDFWWKHGHDOHUZKHUH \RXSXUFKDVHGWKHSURMHFWRURUWKHVHUYLFHFHQWHU PIN code lock 7KLVIXQFWLRQSUHYHQWVWKHSURMHFWRUIURPEHLQJRSHUDWHG E\XQDXWKRUL]HGSHUVRQVDQGSURYLGHVWKHIROORZLQJ VHWWLQJRSWLRQVIRUVHFXULW\ Off 8QORFNHG On1 (QWHUWKH3,1FRGHHYHU\WLPHWXUQLQJRQ WKHSURMHFWRU On2 (QWHUWKH3,1FRGHWRRSHUDWHWKHSURMHFWRU RQFHWKHSRZHUFRUGLVGLVFRQQHFWHGDV ORQJDVWKH$&SRZHUFRUGLVFRQQHFWHG WKHSURMHFWRUFDQEHRSHUDWHGZLWKRXWD 3,1FRGH PIN code lock :KHQHYHU\RXFKDQJHWKH3,1FRGHORFNVHWWLQJRUWKH 3,1FRGHWKHIRXUGLJLWQXPEHU\RXDUHUHTXLUHGWR HQWHUWKH3,1FRGH7KH³´LVVHWDVWKHLQLWLDO3,1 FRGHDWWKHIDFWRU\ ,I\RXZDQWWRFKDQJHWKH3,1FRGHORFNVHWWLQJ3UHVV WKH6(/(&7EXWWRQDQGWKH3,1FRGHGLDORJER[ DSSHDUV :KHQWKHSURMHFWRULVORFNHGZLWKWKH3,1FRGHWKH 6HFXULW\LFRQDSSHDUVRQWKHJXLGH 53 Setting Enter a PIN code 8VHWKH3RLQWŸźEXWWRQVWRHQWHUDQXPEHU3UHVVWKH 3RLQWŻŹEXWWRQVWRIL[WKHQXPEHUDQGPRYHWKHUHG IUDPHSRLQWHUWRWKHQH[WER[7KHQXPEHUFKDQJHVWR ¼,I\RXIL[HGDQLQFRUUHFWQXPEHUXVHWKH3RLQWŻŹ EXWWRQVWRPRYHWKHSRLQWHUWRWKHQXPEHU\RXZDQWWR FRUUHFWDQGWKHQHQWHUWKHFRUUHFWQXPEHU Enter a PIN code 5HSHDWWKLVVWHSWRFRPSOHWHHQWHULQJDIRXUGLJLW QXPEHU $IWHUHQWHULQJWKHIRXUGLJLWQXPEHUPRYHWKHSRLQWHUWR Set3UHVVWKH6(/(&7EXWWRQVRWKDW\RXFDQFKDQJH WKHIROORZLQJ3,1FRGHORFNVHWWLQJ ,I\RXHQWHUHGDQLQFRUUHFW3,1FRGHPIN codeDQGWKH QXPEHU¼¼¼¼ZLOOWXUQUHGIRUDPRPHQW(QWHUWKH FRUUHFW3,1FRGHDOORYHUDJDLQ Change the PIN code lock setting 8VHWKH3RLQWŸźEXWWRQVWRVHOHFWOffOn1RU On2 DQGWKHQSUHVVWKH6(/(&7EXWWRQWRPDNHDFKRLFH Change the PIN code 7KH3,1FRGHFDQEHFKDQJHGWR\RXUGHVLUHGIRXUGLJLW QXPEHU3UHVVWKH6(/(&7EXWWRQWRVHOHFWPIN code change3LQFRGHGLDORJER[DSSHDUVXVHWKH3RLQWŸź EXWWRQVWRHQWHUWKHFRUUHFWFRGH7KH1HZ3,1FRGH LQSXWGLDORJER[DSSHDUV6HWDQHZ3,1FRGH CAUTION: WHEN YOU HAVE CHANGED THE PIN CODE, WRITE DOWN THE NEW PIN CODE IN COLUMN OF THE PIN CODE NO. MEMO ON PAGE 75, AND KEEP IT SECURELY. IF YOU FORGET YOUR PIN CODE, THE PROJECTOR CAN NO LONGER BE STARTED. 54 Change the PIN code Setting Fan 7KLV IXQFWLRQ SURYLGHV WKH IROORZLQJ RSWLRQV LQ WKH FRROLQJ IDQV¶RSHUDWLRQZKHQWKHSURMHFWRULVWXUQHGRIIS L11RUPDORSHUDWLRQ L26ORZHUDQGORZHUVRXQGWKDQWKHQRUPDORSHUDWLRQ (L1 EXW LW WDNHV PRUH WLPH WR FRRO WKH SURMHFWRU GRZQ Fan control 7KLVSURMHFWRUSURYLGHV)DQFRQWUROIXQFWLRQLQWKH6HWWLQJ PHQX &KRRVHWKHUXQQLQJVSHHGRIFRROLQJIDQVIURPWKHIROORZLQJ RSWLRQVDFFRUGLQJWRWKHJURXQGHOHYDWLRQXQGHUZKLFK\RX XVHWKHSURMHFWRU Off1RUPDOVSHHG6HWWKLVIXQFWLRQWR2IIZKHQ XVLQJWKHSURMHFWRULQQRQKLJKDOWLWXGH HQYLURQPHQW On1)DVWHUWKDQ2IIPRGH6HOHFWWKLVPRGH ZKHQXVLQJWKHSURMHFWRULQKLJKDOWLWXGHV DERXWPHWHUVWRPHWHUVDERYH WKHVHDOHYHOZKHUHWKHIDQVKDYHOHVV FRROLQJHIIHFW On2)DVWHUWKDQ2QPRGH6HOHFWWKLVPRGH ZKHQXVLQJWKHSURMHFWRULQKLJKHUDOWLWXGHV DERXWPHWHUVWRPHWHUV DERYHWKHVHDOHYHOZKHUHWKHIDQVKDYH OHVVHUFRROLQJHIIHFW 3Note 7KHIDQQRLVHEHFRPHVORXGHULQ2QDQG2Q Lamp counter reset Lamp counter %H VXUH WR UHVHW WKH /DPS UHSODFHPHQW FRXQWHU DIWHU WKH ODPSLVUHSODFHGS 3UHVV WKH 3RLQW Ÿź EXWWRQV WR FKRRVH WKH /DPS FRXQWHU IXQFWLRQDQGWKHQSUHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQWR DFFHVVWKHVXEPHQXLWHPV Lamp counter7KLVLWHPVKRZVWKHWRWDO DFFXPXODWHGWLPHRIWKHODPS XVDJH Lamp counter reset3UHVVWKHWKH6(/(&7 EXWWRQ WRFKRRVHLamp counter reset. 6HOHFWYesLQWKHFRQILUPDWLRQ ER[LI\RXZDQWWRUHVHWWKHODPS FRXQWHUDQGWKHQFKRRVHYesLQ WKHVHFRQGFRQILUPDWLRQER[WR UHVHWODPSFRXQWHU 55 Setting Filter counter Filter counter 7KLVIXQFWLRQLVXVHGWRVHWDIUHTXHQF\IRUWKHILOWHU FOHDQLQJ Filter counter reset :KHQWKHSURMHFWRUUHDFKHGDVSHFLILHGWLPHEHWZHHQ FOHDQLQJVD)LOWHUZDUQLQJLFRQDSSHDUVRQWKHVFUHHQ QRWLI\LQJWKHFOHDQLQJLVQHFHVVDU\$IWHUFOHDQLQJWKHILOWHU EHVXUHWRVHOHFWResetDQGVHWWKHWLPHU7KH)LOWHUZDUQLQJ LFRQZLOOQRWWXUQRIIXQWLOWKHILOWHUFRXQWHULVUHVHW )RUGHWDLOVDERXWUHVHWWLQJWKHWLPHUUHIHUWR³5HVHWWLQJWKH )LOWHU&RXQWHU´RQSDJH Fig.1)LOWHUZDUQLQJLFRQ )LOWHUZDUQLQJLFRQDSSHDUVRQWKHVFUHHQDWDVHWWLPH 3UHVVWKH6(/(&7EXWWRQWRVHOHFWTimerDQGWKHQ XVHWKH3RLQWŸźEXWWRQVWRVHWWKHWLPHU6HOHFW IURPOff100H200H300HGHSHQGLQJRQWKHXVH HQYLURQPHQW 3Note: 7KLVLFRQDOVRDSSHDUVDWWXUQLQJRQ 3Note: 7KH)LOWHUZDUQLQJLFRQ)LJZLOOQRWDSSHDUZKHQWKH 'LVSOD\IXQFWLRQLVVHWWROffSGXULQJFreezeS RUNo showS Warning log 7KLVIXQFWLRQUHFRUGVDQRPDORXVRSHUDWLRQVZKLOHWKH SURMHFWRULVLQRSHUDWLRQDQGXVHLWZKHQGLDJQRVLQJIDXOWV 8SWRZDUQLQJORJVDUHGLVSOD\HGZLWKWKHODWHVWZDUQLQJ PHVVDJHDWWKHWRSRIWKHOLVWIROORZHGE\SUHYLRXVZDUQLQJ PHVVDJHVLQFKURQRORJLFDORUGHU 3Note: :KHQWKH)DFWRU\GHIDXOWIXQFWLRQLVH[HFXWHGDOOWKH ZDUQLQJORJUHFRUGVZLOOEHGHOHWHG Factory default 7KLVIXQFWLRQUHWXUQVDOOVHWWLQJYDOXHVH[FHSWIRUWKHUser logoPIN code lockLogo PIN code lockLamp counter DQGFilter counterWRWKHIDFWRU\GHIDXOWVHWWLQJV 56 Factory default Information Input Source Information Display 7KH,QIRUPDWLRQ0HQXLVXVHGIRUFKHFNLQJWKHVWDWXVRIWKHLPDJHVLJQDOEHLQJSURMHFWHGDQGWKHRSHUDWLRQRIWKHSURMHFWRU Direct Operation 3UHVVWKH,1)2EXWWRQRQWKHUHPRWHFRQWUROWRGLVSOD\WKH ,QIRUPDWLRQ0HQX Remote Control INFO. button Menu Operation 3UHVVWKH3RLQWŸźEXWWRQVWRVHOHFWWKH,QIRUPDWLRQ7KH ,QIRUPDWLRQ0HQXLVGLVSOD\HG 6HHEHORZIRUGLVSOD\HGLQIRUPDWLRQ Input 7KHVHOHFWHGLQSXWVRXUFHLVGLVSOD\HG Information Menu H-sync freq. 7KHKRUL]RQWDOIUHTXHQF\RIWKHLQSXWVLJQDOLVGLVSOD\HGLQ KHzRU- - - - -ZKHQQRVLJQDO V-sync freq. 7KHYHUWLFDOIUHTXHQF\RIWKHLQSXWVLJQDOLVGLVSOD\HGLQHz RU- - - - -ZKHQQRVLJQDO1XPEHUVRI+]GRXEOHVZKHQ GXULQJ,QWHUODFH Screen 7KHVHOHFWHGVFUHHQVL]HLVGLVSOD\HG Language 7KHVHOHFWHGODQJXDJHLVGLVSOD\HG Lamp status 7KHVHOHFWHGODPSPRGHLVGLVSOD\HG Lamp counter 7KHFXPXODWLYHODPSRSHUDWLQJWLPHLVGLVSOD\HG Power management OffReadyShut downRUTimerLVGLVSOD\HG Key lock 7KHVHOHFWHG.H\ORFNLFRQLVGLVSOD\HG PIN code lock OffRUOn1RUOn2LVGLVSOD\HG Remote control 7KHVHOHFWHGUHPRWHFRGHLVGLVSOD\HG 57 Maintenance and Cleaning WARNING indicator 7KH:$51,1*LQGLFDWRUVKRZVWKHVWDWHRIWKHIXQFWLRQZKLFKSURWHFWVWKHSURMHFWRU&KHFNWKHVWDWHRIWKH :$51,1*LQGLFDWRUDQGWKH32:(5LQGLFDWRUWRWDNHSURSHUPDLQWHQDQFH The projector is shut down and the WARNING indicator is blinking red. Top Control :KHQWKHWHPSHUDWXUHLQVLGHWKHSURMHFWRUUHDFKHVD FHUWDLQOHYHOWKHSURMHFWRUZLOOEHDXWRPDWLFDOO\VKXWGRZQWR SURWHFWWKHLQVLGHRIWKHSURMHFWRU7KH32:(5LQGLFDWRULV EOLQNLQJZKLOHWKHSURMHFWRULVEHLQJFRROHGGRZQ:KHQWKH SURMHFWRUKDVFRROHGGRZQHQRXJKWRLWVQRUPDORSHUDWLQJ WHPSHUDWXUHLWFDQEHWXUQHGRQDJDLQE\SUHVVLQJWKH21 67$1'%<EXWWRQ :$51,1* EOLQNLQJ UHG 3Note: 7KH:$51,1*LQGLFDWRUFRQWLQXHVWREOLQNHYHQDIWHU WKHWHPSHUDWXUHLQVLGHWKHSURMHFWRUUHWXUQVWRQRUPDO :KHQWKHSURMHFWRULVWXUQHGRQDJDLQWKH:$51,1* LQGLFDWRUVWRSVEOLQNLQJ Then check the matters below: ±'LG\RXSURYLGHDSSURSULDWHVSDFHIRUWKHSURMHFWRUWREH YHQWLODWHG"&KHFNWKHLQVWDOOLQJFRQGLWLRQWRVHHLIWKHDLU YHQWVRIWKHSURMHFWRUDUHQRWEORFNHG ±+DVWKHSURMHFWRUEHHQLQVWDOOHGQHDUDQ$LU&RQGLWLRQLQJ +HDWLQJ'XFWRU9HQW"0RYHWKHLQVWDOODWLRQRIWKH SURMHFWRUDZD\IURPWKHGXFWRUYHQW ±,VWKHILOWHUFOHDQ"&OHDQWKHILOWHUSHULRGLFDOO\ The projector is shut down and the WARNING indicator lights red. :KHQWKHSURMHFWRUGHWHFWVDQDEQRUPDOFRQGLWLRQLWLV DXWRPDWLFDOO\VKXWGRZQWRSURWHFWWKHLQVLGHRIWKHSURMHFWRU DQGWKH:$51,1*LQGLFDWRUOLJKWVUHG,QWKLVFDVHXQSOXJ WKH$&SRZHUFRUGDQGUHFRQQHFWLWDQGWKHQWXUQWKH SURMHFWRURQRQFHDJDLQWRYHULI\RSHUDWLRQ,IWKHSURMHFWRU FDQQRWEHWXUQHGRQDQGWKH:$51,1*LQGLFDWRUVWLOOOLJKWV UHGXQSOXJWKH$&SRZHUFRUGDQGFRQWDFWWKHVHUYLFH VWDWLRQ CAUTION '2127/($9(7+(352-(&725:,7+7+( $&32:(5&25'&211(&7('81'(5$1 $%1250$/&21',7,21,70$<5(68/7,1 ),5(25(/(&75,&6+2&. 58 Top Control :$51,1*OLJKWV UHG Maintenance and Cleaning Cleaning the Filters )LOWHUSUHYHQWVGXVWIURPDFFXPXODWLQJRQWKHRSWLFDOHOHPHQWVLQVLGHWKHSURMHFWRU6KRXOGWKHILOWHUVEHFRPH FORJJHGZLWKGXVWSDUWLFOHVLWZLOOUHGXFHFRROLQJIDQV¶HIIHFWLYHQHVVDQGPD\UHVXOWLQLQWHUQDOKHDWEXLOGXS DQGDGYHUVHO\DIIHFWWKHOLIHRIWKHSURMHFWRU,ID³)LOWHUZDUQLQJ´LFRQDSSHDUVRQWKHVFUHHQFOHDQWKHILOWHUV LPPHGLDWHO\&OHDQWKHILOWHUVE\IROORZLQJWKHVWHSVEHORZ 1 7XUQ RII WKH SURMHFWRU DQG XQSOXJ WKH$& SRZHU FRUG IURPWKH$&RXWOHW 2 5HPRYHWKHIURQWDLUILOWHUE\SXOOLQJWKHODWFK KRUL]RQWDOO\ 5HPRYHWKHEDFNDLUILOWHUE\SXOOLQJWKHODWFK KRUL]RQWDOO\DQGWKHQUHPRYHLWOHIWZDUG 3 &OHDQWKHDLUILOWHUVZLWKDEUXVKRUULQVHWKHPVRIWO\ 4 :KHQFOHDQLQJWKHDLUILOWHUVE\ULQVLQJGU\LWZHOO 5HSODFHWKHDLUILOWHUVSURSHUO\0DNHVXUHWKDWWKHDLU ILOWHUVDUHIXOO\LQVHUWHG CAUTION 'RQRWRSHUDWHWKHSURMHFWRUZLWKWKHILOWHUV UHPRYHG'XVWPD\DFFXPXODWHRQWKHRSWLFDO HOHPHQWVGHJUDGLQJSLFWXUHTXDOLW\ 'RQRWSXWDQ\WKLQJLQWRWKHDLUYHQWV'RLQJVR PD\UHVXOWLQPDOIXQFWLRQRIWKHSURMHFWRU RECOMMENDATION We recommend avoiding dusty/smoky environments when you operate the projector. Usage in these environments may cause poor image quality. :KHQXVLQJWKHSURMHFWRUXQGHUGXVW\RUVPRN\FRQGLWLRQV GXVWPD\DFFXPXODWHRQDOHQV/&'SDQHOVRURSWLFDO HOHPHQWVLQVLGHWKHSURMHFWRUGHJUDGLQJWKHTXDOLW\RID SURMHFWHGLPDJH:KHQWKHV\PSWRPVDERYHDUHQRWLFHG FRQWDFW\RXUDXWKRUL]HGGHDOHURUVHUYLFHVWDWLRQIRUSURSHU FOHDQLQJ $LUILOWHUIURQW 3XOOKRUL]RQWDOO\DQGUHPRYH 3Note 3OHDVHEHVXUHWR ILWWKLVHGJHZKHQ LQVHUWLQJWKLVILOWHU $LUILOWHUEDFN 3XOOKRUL]RQWDOO\DQGWKHQUHPRYHLWOHIWZDUG Filter counter Resetting the Filter Counter %HVXUHWRUHVHWWKH)LOWHUFRXQWHUDIWHUFOHDQLQJRUUHSODFLQJ WKHILOWHUV 1 3UHVVWKH0(18EXWWRQWRGLVSOD\WKH2Q6FUHHQ 0HQX8VHWKH3RLQWŸźEXWWRQVWRVHOHFWSettingDQG WKHQSUHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQ 2 8VHWKH3RLQWŸźEXWWRQVWRVHOHFWFilter counterDQG WKHQSUHVVWKH3RLQWŹRUWKH6(/(&7EXWWRQ8VHWKH 3RLQWŸźEXWWRQVWRVHOHFWFilter counter resetDQG WKHQSUHVVWKH6(/(&7EXWWRQFilter counter Reset? DSSHDUV6HOHFWYesWRFRQWLQXH 3 $QRWKHUFRQILUPDWLRQGLDORJER[DSSHDUVVHOHFWYesWR UHVHWWKH)LOWHUFRXQWHU Filter counter Reset? DSSHDUV 6HOHFWYesWKHQ DQRWKHUFRQILUPDWLRQ ER[DSSHDUV 6HOHFWYesDJDLQ WRUHVHWWKH)LOWHU FRXQWHU 59 Maintenance and Cleaning Attaching the Lens Cap :KHQ PRYLQJ WKLV SURMHFWRU RU ZKLOH QRW XVLQJ LW RYHU DQ H[WHQGHGSHULRGRIWLPHUHSODFHWKHOHQVFDS $WWDFKWKHOHQVFDSDFFRUGLQJWRWKHIROORZLQJSURFHGXUHV 1 7KUHDGWKHVWULQJWKURXJKWKHKROHRQWKHOHQVFDSDQG WKHQWLHDNQRWLQWKHVWULQJWRVHFXUHLWLQSODFH 2 7RSDVVWKHRWKHUHQGRIWKHVWULQJLQWRWKHKROHRQWKH ERWWRPRIWKHSURMHFWRUDQGSXOODWLW Cleaning the Projection Lens 8QSOXJWKH$&SRZHUFRUGEHIRUHFOHDQLQJ *HQWO\ ZLSH WKH SURMHFWLRQ OHQV ZLWK D FOHDQLQJ FORWK WKDW FRQWDLQV D VPDOO DPRXQW RI QRQDEUDVLYH FDPHUD OHQV FOHDQHU RU XVH D OHQV FOHDQLQJ SDSHU RU FRPPHUFLDOO\ DYDLODEOHDLUEORZHUWRFOHDQWKHOHQV $YRLG XVLQJ DQ H[FHVVLYH DPRXQW RI FOHDQHU$EUDVLYH FOHDQHUV VROYHQWV RU RWKHU KDUVK FKHPLFDOV PLJKW VFUDWFK WKHVXUIDFHRIWKHOHQV Cleaning the Projector Cabinet 8QSOXJWKH$&SRZHUFRUGEHIRUHFOHDQLQJ *HQWO\ZLSHWKHSURMHFWRUERG\ZLWKDVRIWGU\FOHDQLQJFORWK :KHQ WKH FDELQHW LV KHDYLO\ VRLOHG XVH D VPDOO DPRXQW RI PLOGGHWHUJHQWDQGILQLVKZLWKDVRIWGU\FOHDQLQJFORWK$YRLG XVLQJ DQ H[FHVVLYH DPRXQW RI FOHDQHU$EUDVLYH FOHDQHUV VROYHQWVRURWKHUKDUVKFKHPLFDOVPLJKWVFUDWFKWKHVXUIDFH RIWKHFDELQHW :KHQ WKH SURMHFWRU LV QRW LQ XVH SXW WKH SURMHFWRU LQ DQ DSSURSULDWH FDUU\LQJ FDVH WR SURWHFW LW IURP GXVW DQG VFUDWFKHV 60 Maintenance and Cleaning Lamp Replacement :KHQWKHSURMHFWLRQODPSRIWKHSURMHFWRUUHDFKHVLWVHQG RIOLIHWKH/DPSUHSODFHPHQWLFRQDSSHDUVRQWKHVFUHHQ DQG/$035(3/$&(LQGLFDWRUOLJKWV\HOORZ5HSODFHWKH ODPSZLWKDQHZRQHSURPSWO\7KHWLPLQJZKHQWKH/$03 5(3/$&(LQGLFDWRUVKRXOGOLJKWLVGHSHQGLQJRQWKHODPS PRGH Top Control LAMP REPLACE indicator Lamp replacement icon 3Note: :KHQMode 2LVVHOHFWHGLQWKH/DPSOLIHFRQWUROPHQXLIWKHSURMHFWLRQODPSRIWKHSURMHFWRUUHDFKHVLWV HQGRIOLIHWKHODPSUHSODFHPHQWLFRQDSSHDUVRQWKHVFUHHQDQGWKHSURMHFWRULVWXUQHGRIIDXWRPDWLFDOO\ DIWHUPLQXWHV 7KH/DPSUHSODFHPHQWLFRQZLOOQRWDSSHDUZKHQWKH'LVSOD\IXQFWLRQLVVHWWROffSGXULQJFreeze SRUNo showS CAUTION $OORZDSURMHFWRUWRFRROIRUDWOHDVWPLQXWHV EHIRUH\RXRSHQWKH/DPS&RYHU7KHLQVLGHRI WKHSURMHFWRUFDQEHFRPHYHU\KRW CAUTION )RUFRQWLQXHGVDIHW\UHSODFHZLWKDODPSRIWKH VDPHW\SH'RQRWGURSDODPSRUWRXFKDJODVV EXOE7KHJODVVFDQVKDWWHUDQGPD\FDXVHLQMXU\ CAUTION :KHQUHSODFLQJWKHODPSEHFDXVHLWKDVVWRSSHGLOOXPLQDWLQJWKHUHLVDSRVVLELOLW\WKDWWKHODPSPD\EH EURNHQ ,IUHSODFLQJWKHODPSRIDSURMHFWRUZKLFKKDVEHHQLQVWDOOHGRQWKHFHLOLQJ\RXVKRXOGDOZD\VDVVXPHWKDW WKH ODPS LV EURNHQ DQG \RX VKRXOG VWDQG WR WKH VLGH RI WKH ODPS FRYHU QRW XQGHUQHDWK LW 5HPRYH WKH ODPSFRYHUJHQWO\6PDOOSLHFHVRIJODVVPD\IDOORXWZKHQWKHODPSFRYHULVRSHQHG,ISLHFHVRIJODVVJHW LQWR\RXUH\HVRUPRXWKVHHNPHGLFDODGYLFHLPPHGLDWHO\ /DPS&RYHU )ROORZWKHVHVWHSVWRUHSODFHWKHODPS 1 8QSOXJWKH$&SRZHUFRUG/HWWKHSURMHFWRUFRROIRUDW OHDVWPLQXWHV 2 3 /RRVHQWKHVFUHZDQGRSHQWKHODPSFRYHU 4 5HSODFHWKHODPSZLWKDQHZRQHDQGVHFXUHWKHWKUHH VFUHZV0DNHVXUHWKDWWKHODPSLVVHWSURSHUO\ &ORVHWKHODPSFRYHUDQGVHFXUHWKHVFUHZ 5 &RQQHFWWKH$&SRZHUFRUGWRWKHSURMHFWRUDQGWXUQ RQWKHSURMHFWRU 6 Reset the lamp replacement counter. 6HH/DPS&RXQWHURQSDJH /RRVHQWKHWKUHHVFUHZVWKDWVHFXUHWKHODPS/LIW WKHODPSRXWRIWKHSURMHFWRUE\XVLQJWKHKDQGOHV 6FUHZ 6FUHZ +DQGOHV 6FUHZ /DPS 6FUHZ 61 Maintenance and Cleaning ORDER REPLACEMENT LAMP 5HSODFHPHQWODPSFDQEHRUGHUHGWKURXJK\RXUGHDOHU:KHQRUGHULQJDSURMHFWLRQODPSJLYHWKHIROORZLQJ LQIRUPDWLRQWRWKHGHDOHU Ɣ Model No. of your projector Ɣ Replacement Lamp Type No. : PLC-XR201, PLC-XR251 : POA-LMP132 6HUYLFH3DUWV1R LAMP HANDLING PRECAUTIONS 7KLVSURMHFWRUXVHVDKLJKSUHVVXUHODPSZKLFKPXVWEHKDQGOHGFDUHIXOO\DQGSURSHUO\ ,PSURSHUKDQGOLQJPD\UHVXOWLQDFFLGHQWVLQMXU\RUFUHDWHDILUHKD]DUG Ɣ/DPSOLIHPD\GLIIHUIURPODPSWRODPSDQGDFFRUGLQJWRWKHHQYLURQPHQWRIXVH7KHUHLVQRJXDUDQWHH RIWKHVDPHOLIHIRUHDFKODPS6RPHODPSVPD\IDLORUWHUPLQDWHWKHLUOLIHLQDVKRUWHUSHULRGRIWLPH WKDQRWKHUVLPLODUODPSV Ɣ,IWKHSURMHFWRULQGLFDWHVWKDWWKHODPSVKRXOGEHUHSODFHGLHLIWKH/$035(3/$&(LQGLFDWRUOLJKWV XSUHSODFHWKHODPSZLWKDQHZRQH,00(',$7(/<DIWHUWKHSURMHFWRUKDVFRROHGGRZQ )ROORZFDUHIXOO\WKHLQVWUXFWLRQVLQWKH/DPS5HSODFHPHQWVHFWLRQRIWKLVPDQXDO&RQWLQXRXVXVHRI WKHODPSZLWKWKH/$035(3/$&(LQGLFDWRUOLJKWHGPD\LQFUHDVHWKHULVNRIODPSH[SORVLRQ Ɣ$ /DPS PD\ H[SORGH DV D UHVXOW RI YLEUDWLRQ VKRFN RU GHJUDGDWLRQ DV D UHVXOW RI KRXUV RI XVH DV LWV OLIHWLPH GUDZV WR DQ HQG 5LVN RI H[SORVLRQ PD\ GLIIHU DFFRUGLQJ WR WKH HQYLURQPHQW RU FRQGLWLRQV LQ ZKLFKWKHSURMHFWRUDQGODPSDUHEHLQJXVHG IF A LAMP EXPLODES, THE FOLLOWING SAFETY PRECAUTIONS SHOULD BE TAKEN. ,I D ODPS H[SORGHV GLVFRQQHFW WKH SURMHFWRU¶V $& SOXJ IURP WKH $& RXWOHW LPPHGLDWHO\ &RQWDFW DQ DXWKRUL]HG VHUYLFH VWDWLRQ IRU D FKHFNXS RI WKH XQLW DQG UHSODFHPHQW RI WKH ODPS$GGLWLRQDOO\ FKHFN FDUHIXOO\WRHQVXUHWKDWWKHUHDUHQREURNHQVKDUGVRUSLHFHVRIJODVVDURXQGWKHSURMHFWRURUFRPLQJRXW IURP WKH FRROLQJ DLU FLUFXODWLRQ KROHV$Q\ EURNHQ VKDUGV IRXQG VKRXOG EH FOHDQHG XS FDUHIXOO\ 1R RQH VKRXOG FKHFN WKH LQVLGH RI WKH SURMHFWRU H[FHSW WKRVH ZKR DUH DXWKRUL]HG WUDLQHG WHFKQLFLDQV DQG ZKR DUHIDPLOLDUZLWKSURMHFWRUVHUYLFH,QDSSURSULDWHDWWHPSWVWRVHUYLFHWKHXQLWE\DQ\RQHHVSHFLDOO\WKRVH ZKRDUHQRWDSSURSULDWHO\WUDLQHGWRGRVRPD\UHVXOWLQDQDFFLGHQWRULQMXU\FDXVHGE\SLHFHVRIEURNHQ JODVV 62 Appendix Troubleshooting %HIRUHFDOOLQJ\RXUGHDOHURUVHUYLFHFHQWHUIRUDVVLVWDQFHFKHFNWKHLWHPVEHORZRQFHDJDLQ ±0DNHVXUH\RXKDYHSURSHUO\FRQQHFWHGWKHSURMHFWRUWRSHULSKHUDOHTXLSPHQWDVGHVFULEHGRQSDJHV ±0DNHVXUHDOOHTXLSPHQWLVFRQQHFWHGWR$&RXWOHWDQGWKHSRZHULVWXUQHGRQ ±:KHQWKHSURMHFWRUGRHVQRWSURMHFWDQLPDJHIURPWKHFRQQHFWHGFRPSXWHUUHVWDUWWKHFRPSXWHU Problem: ±6ROXWLRQV ±3OXJWKHSRZHUFRUGRIWKHSURMHFWRULQWRWKH$&RXWOHW ±6HHLIWKH32:(5LQGLFDWRUOLJKWVUHG ±:DLWXQWLOWKH32:(5LQGLFDWRUVWRSVEOLQNLQJWRWXUQRQWKHSURMHFWRU DJDLQ7KHSURMHFWRUFDQEHWXUQHGRQDIWHUWKH32:(5LQGLFDWRU WXUQVUHG6HHSDJH ±&KHFNWKH:$51,1*LQGLFDWRU,IWKH:$51,1*LQGLFDWRUOLJKWVUHG SURMHFWRUFDQQRWEHWXUQHGRQ6HHSDJH ±&KHFNWKHSURMHFWLRQODPS6HHSDJH ±8QORFNWKH.H\ORFNIXQFWLRQIRUWKHSURMHFWRU6HHSDJH The initial display is not shown. ±0DNHVXUHOffRUCountdown offDUHQRWFKRVHQDWGLVSOD\ IXQFWLRQ6HHSDJH The initial display is not same as the default set. ±0DNHVXUHUserRUOffDUHQRWFKRVHQDW/RJRVHOHFW IXQFWLRQ6HHSDJH Input signal switches automatically. (or does not switch automatically) ±0DNHVXUH,QSXWVHDUFKIXQFWLRQLVDGMXVWHGSURSHUO\6HHSDJH No power When the projector is on and you ±7KDWLVWKH)LOWHUZDUQLQJLFRQ6HHSDJH press the input source buttons, an icon other than the Lamp mode icon appears An icon other than Input mode or Lamp mode icon appears. ±7KDWLVWKH/DPSUHSODFHPHQWLFRQRUWKH)LOWHUZDUQLQJLFRQ6HH SDJHVRU Image is out of focus. ±$GMXVWIRFXVRIWKHSURMHFWRU6HHSDJH ±3URYLGHSURSHUGLVWDQFHEHWZHHQWKHSURMHFWRUDQGWKHSURMHFWLRQ VFUHHQ6HHSDJH ±&KHFNWKHSURMHFWLRQOHQVWRVHHLILWQHHGVFOHDQLQJ6HHSDJH ±0RYLQJWKHSURMHFWRUIURPDFRROWRZDUPSODFHPD\UHVXOWLQ PRLVWXUHFRQGHQVDWLRQRQWKHSURMHFWLRQOHQV,QVXFKFDVHVOHDYH WKHSURMHFWRURIIDQGZDLWXQWLOFRQGHQVDWLRQHYDSRUDWHV Image is Left/Right reversed. Image is Top/Bottom reversed. Picture is not bright enough. ±&KHFNWKH&HLOLQJ5HDUIXQFWLRQ6HHSDJH ±&KHFNWKH&HLOLQJIXQFWLRQ6HHSDJH ±&KHFNLIWKHContrastRUBrightnessLVDGMXVWHGSURSHUO\6HH SDJHV ±&KHFNLIImage modeLVVHOHFWHGSURSHUO\6HHSDJHV ±&KHFNWKHODPSFRQWUROIXQFWLRQ6HHSDJHV ±&KHFNWKH/$035(3/$&(LQGLFDWRU,ILWOLJKWVWKHHQGRIODPSOLIH LVDSSURDFKLQJ5HSODFHWKHODPSZLWKDQHZRQHSURPSWO\6HHSDJH 63 Appendix ±&KHFNWKHFRQQHFWLRQEHWZHHQ\RXUFRPSXWHURUYLGHRHTXLSPHQW DQGWKHSURMHFWRU6HHSDJHV ±6HHLIWKHLQSXWVLJQDOLVFRUUHFWO\RXWSXWIURP\RXUFRPSXWHU6RPH ODSWRSFRPSXWHUVPD\QHHGWRFKDQJHWKHVHWWLQJIRUPRQLWRURXWSXW ZKHQFRQQHFWLQJWRDSURMHFWRU6HH\RXUFRPSXWHU¶VLQVWUXFWLRQ PDQXDOIRUWKHVHWWLQJ ±,WWDNHVDERXWVHFRQGVWRGLVSOD\DQLPDJHDIWHUWXUQLQJRQWKH SURMHFWRU6HHSDJH ±&KHFNWKH,QSXWVLJQDOFRORUV\VWHPYLGHRV\VWHPRUFRPSXWHU V\VWHPPRGH ±0DNHVXUHWKHWHPSHUDWXUHLVQRWRXWRIWKHVSHFLILHG2SHUDWLQJ 7HPSHUDWXUHÛ)±Û)>Û&±Û&@ ±:KHQNo ShowLVRSHUDWLQJWKHLPDJHFDQQRWEHGLVSOD\HG3UHVV WKH126+2:EXWWRQRUDQ\RWKHUEXWWRQRQWKHUHPRWHFRQWURO No sound ±&KHFNWKHDXGLRFDEOHFRQQHFWLRQIURPDXGLRLQSXWVRXUFH ±$GMXVWWKHDXGLRVRXUFH ±3UHVVWKH9ROXPHEXWWRQ6HHSDJH ±3UHVVWKH0XWHEXWWRQ6HHSDJH ±:KHQWKH$8',2287LVSOXJJHGLQWKHSURMHFWRU VEXLOWLQVSHDNHU LVQRWDYDLODEOH ±,VWKHLPDJHSURMHFWHG"<RXZLOOKHDUWKHVRXQGRQO\ZKHQWKHLPDJH LVSURMHFWHG The color is strange. ±&KHFNWKH,QSXWVLJQDOFRORUV\VWHPYLGHRV\VWHPRUFRPSXWHU V\VWHPPRGH ±0DNHVXUHWKHBlackboardLVQRWVHOHFWHGRQ,PDJHVHOHFW PHQX6HHSDJHV Some displays are not seen during the operation. ±&KHFNWKH'LVSOD\IXQFWLRQ6HHSDJH Auto PC adjustment function does not work. ±&KHFNWKH,QSXWVLJQDO$XWR3&DGMXVWPHQWIXQFWLRQFDQQRWZRUN ZKHQ480p575p720p480i575i1035iRU1080iLVVHOHFWHG6HH SDJH The setting does not remain after turning off power. ±0DNHVXUH\RXVHOHFWHGStoreDIWHUDGMXVWLQJVHWWLQJ6RPHVHWWLQJV FDQQRWEHVWRUHGLIQRWUHJLVWHUHGZLWKStore6HHSDJHV Power management does not work. ±3RZHUPDQDJHPHQWIXQFWLRQFDQQRWZRUNZKLOHFreezeRUNo ShowIXQFWLRQLVUXQQLQJ6HHSDJH Capture function does not work. ±&KHFNWKHFRQQHFWLRQDQGWKHLQSXWVLJQDOWRVHHLIWKHUHLVVLJQDO No image Auto setup does not work properly. ±0DNHVXUHOffLVQRWVHOHFWHGDWDQ\IXQFWLRQRI Auto setup6HHSDJH ±0DNHVXUHOnLVQRWVHOHFWHGDWWKH&HLOLQJIXQFWLRQ6HHSDJH Auto keystone function does not work even when the projector is tipped. 64 ±0DNHVXUHWKH$XWRNH\VWRQHIXQFWLRQLVQRWVHWWRManual3UHVV WKH$8726(783EXWWRQRQWKHWRSFRQWURO6HHSDJHV Appendix The image is distorted or runs off. ±&KHFNPC adjustPHQXRUScreenPHQXDQGDGMXVWWKHP 6HHSDJHV PIN code dialog box appears at start-up. ±3,1FRGHORFNLVEHLQJVHW(QWHUD3,1FRGHWKH³´RUQXPEHUV \RXKDYHVHW6HHSDJHV The Remote Control does not work. ±&KHFNWKHEDWWHULHV ±0DNHVXUHQRREVWUXFWLRQLVEHWZHHQWKHSURMHFWRUDQGUHPRWH FRQWURO ±0DNHVXUH\RXDUHQRWWRRIDUIURPWKHSURMHFWRUZKHQXVLQJWKH UHPRWHFRQWURO0D[LPXPRSHUDWLQJUDQJHLV P ±0DNHVXUHWKHFRGHRIWKHUHPRWHFRQWUROLVFRQIRUPHGWRWKH SURMHFWRU¶VFRGH6HHSDJH ±8QORFNWKH.H\ORFNIXQFWLRQIRUWKHUHPRWHFRQWUROIXQFWLRQ6HH SDJH Indicator blinks or lights. ±&KHFNWKHVWDWXVRIWKHSURMHFWRUZLWKUHIHUULQJWR,QGLFDWRUVDQG SURMHFWRU&RQGLWLRQ6HHSDJH The exclamation mark appears on the screen. ±<RXURSHUDWLRQLVLQYDOLG2SHUDWHFRUUHFWO\ Top control does not work. Unable to unlock the Logo PIN code lock, Security key lock or Security PIN code lock. ±7KHWRSFRQWUROLVQRWDYDLODEOHLIWKHWRSFRQWUROLVORFNHGDWKey lock XQGHUSecurityRI6(77,1*VHFWLRQ6HHSDJH ±&RQWDFWWKHGHDOHUZKHUH\RXSXUFKDVHGWKHSURMHFWRURUWKHVHUYLFH FHQWHU 65 Appendix WARNING : High voltages are used to operate this projector. Do not attempt to open the cabinet. ,ISUREOHPVVWLOOSHUVLVWDIWHUIROORZLQJDOORSHUDWLQJLQVWUXFWLRQVFRQWDFWWKHGHDOHUZKHUH\RXSXUFKDVHGWKH SURMHFWRURUWKHVHUYLFHFHQWHU6SHFLI\WKHPRGHOQXPEHUDQGH[SODLQDERXWWKHSUREOHP:HZLOODGYLVH\RX KRZWRREWDLQVHUYLFH 7KH &( 0DUN LV D 'LUHFWLYH FRQIRUPLW\ PDUNRIWKH(XURSHDQ&RPPXQLW\(& 3L[HOZRUNV,&VXVHG 66 7KLVV\PERORQWKHQDPHSODWH PHDQVWKHSURGXFWLV/LVWHG E\8QGHUZULWHUV/DERUDWRULHV ,QF,WLVGHVLJQHGDQG PDQXIDFWXUHGWRPHHWULJLG 8/VDIHW\VWDQGDUGVDJDLQVW ULVNRIILUHFDVXDOW\DQG HOHFWULFDOKD]DUGV Appendix Menu Tree Computer Input/Video Input Input ,QSXW 5*% &RPSXWHU &RPSRQHQW 5*%6FDUW 6YLGHR 5*% &RPSXWHU 9LGHR Sound 9ROXPH 0XWH Sound ± 2Q2II Computer Input Image select '\QDPLF 6WDQGDUG 5HDO %ODFNERDUG*UHHQ 5HG%OXH<HOORZ*UHHQ &RORUERDUG ,PDJH ,PDJH ,PDJH ,PDJH Image Adjust &RQWUDVW %ULJKWQHVV &RORUWHPS 69*$ 0RGH 0RGH System 6\VWHPVGLVSOD\HGLQWKH6\VWHP0HQXYDU\ GHSHQGLQJRQDQLQSXWVLJQDO PC adjust $XWR3&DGM )LQHV\QF 7RWDOGRWV +RUL]RQWDO 9HUWLFDO &ODPS 'LVSOD\DUHD+ 'LVSOD\DUHD9 5HVHW 0RGHIUHH 6WRUH ± 5HG *UHHQ %OXH <HV1R 0RGH 0RGH 0RGH 0RGH 0RGH 0RGH 0RGH 0RGH 0RGH 0RGH 6KDUSQHVV *DPPD 5HVHW 6WRUH Screen 1RUPDO 7UXH :LGH )XOO &XVWRP ± ± ;/RZ /RZ 0LG +LJK 8VHU ± ± ± ± ± <HV1R ,PDJH ,PDJH ,PDJH ,PDJH 6FDOH +9 3RVLWLRQ &RPPRQ 5HVHW +9 2Q2II +9 <HV1R <HV1R 'LJLWDO]RRP 'LJLWDO]RRP± 67 Appendix Video Input Setting /DQJXDJH ODQJXDJHVSURYLGHG 0HQXSRVLWLRQ $XWRVHWXS $XWR 3$/ 6(&$0 176& 176& 3$/0 3$/1 System Image select Setting $XWR L L S S S L L System .H\VWRQH %DFNJURXQG 'LVSOD\ /RJR '\QDPLF 6WDQGDUG &LQHPD %ODFNERDUG*UHHQ &RORUERDUG 5HG%OXH<HOORZ*UHHQ ,PDJH ,PDJH ,PDJH ,PDJH ,QSXWVHDUFK &HLOLQJ 2Q2II 5HDU 2Q2II 7HUPLQDO &RPSXWHU0RQLWRURXW 3RZHUPDQDJHPHQW Image Adjust &RQWUDVW %ULJKWQHVV &RORU 7LQW &RORUWHPS 5HG *UHHQ %OXH 6KDUSQHVV *DPPD 1RLVHUHGXFWLRQ 3URJUHVVLYH 5HVHW 6WRUH ± ± ± ± ;/RZ /RZ 0LG +LJK 8VHU ± ± ± ± ± 2II / / 2II / / )LOP <HV1R ,PDJH ,PDJH ,PDJH ,PDJH 2Q2II 6WDQGE\PRGH (FR1HWZRUN &ORVHG&DSWLRQ &ORVHG&DSWLRQ 2II&&&&&&&& &RORU &RORU:KLWH /DPSFRQWURO /DPSFRQWURO 5HPRWHFRQWURO &RGH±&RGH 6HFXULW\ .H\ORFN 0RGH0RGH 2II 3URMHFWRU 5HPRWHFRQWURO 3,1FRGHORFN 2II2Q2Q 3,1FRGHFKDQJH )DQ )DQFRQWURO /DPSFRXQWHU // 2II2Q2Q /DPSFRXQWHU +RXUV /DPSFRXQWHUUHVHW :LGH 68 +LJK1RUPDO(&2 /DPSOLIHFRQWURO 1RUPDO &XVWRP 5HDG\ 6KXWGRZQ 2II 7LPHU±0LQ 2QVWDUW )LOWHUFRXQWHU Screen 2II2Q2Q $XWR3&DGM 2Q2II $XWRNH\VWRQH $XWR 0DQXDO 2II 6WRUH5HVHW %OXH8VHU%ODFN 2II2Q&RXQWGRZQRII /RJRVHOHFW 8VHU 'HIDXOW 2II &DSWXUH <HV1R /RJR3,1FRGHORFN 2II2Q /RJR3,1FRGHFKDQJH <HV1R )LOWHUFRXQWHU +RXUV 7LPHU 2II+++ )LOWHUFRXQWHUUHVHW <HV1R :DUQLQJORJ 6FDOH +9 3RVLWLRQ &RPPRQ 5HVHW +9 2Q2II +9 <HV1R <HV1R )DFWRU\GHIDXOW Information <HV1R ,QSXW6RXUFH,QIRUPDWLRQ'LVSOD\ Appendix Indicators and Projector Condition &KHFNWKHLQGLFDWRUVIRUSURMHFWRUFRQGLWLRQ Indicators 32:(5 :$51,1* red/green red Projector Condition /$03 5(3/$&( yellow 7KHSURMHFWRULVRII7KH$&SRZHUFRUGLVXQSOXJJHG  7KHSURMHFWRULVLQVWDQGE\PRGH3UHVVWKH2167$1'%<EXWWRQ WRWXUQRQWKHSURMHFWRU  7KHSURMHFWRULVRSHUDWLQJQRUPDOO\  7KHSURMHFWRULVSUHSDULQJIRUVWDQGE\RUWKHSURMHFWLRQODPSLV EHLQJFRROHGGRZQ7KHSURMHFWRUFDQQRWEHWXUQHGRQXQWLOFRROLQJ LVFRPSOHWHGDQGWKH32:(5LQGLFDWRUVWRSVEOLQNLQJ  7KHSURMHFWRULVLQWKH3RZHUPDQDJHPHQWPRGH  7KHWHPSHUDWXUHLQVLGHWKHSURMHFWRULVDEQRUPDOO\KLJK7KH SURMHFWRUFDQQRWEHWXUQHGRQ:KHQWKHSURMHFWRULVFRROHGGRZQ HQRXJKDQGWKHWHPSHUDWXUHUHWXUQVWRQRUPDOWKH32:(5 LQGLFDWRUVWRSVEOLQNLQJDQGWKHSURMHFWRUFDQEHWXUQHGRQ7KH :$51,1*LQGLFDWRUNHHSVEOLQNLQJ  7KHSURMHFWRUKDVEHHQFRROHGGRZQHQRXJKDQGWKHWHPSHUDWXUH UHWXUQVWRQRUPDO:KHQWXUQLQJRQWKHSURMHFWRUWKH:$51,1* LQGLFDWRUVWRSVEOLQNLQJ  7KHSURMHFWRUGHWHFWVDQDEQRUPDOFRQGLWLRQDQGFDQQRWEHWXUQHG RQ8QSOXJWKH$&SRZHUFRUGDQGSOXJLWDJDLQWRWXUQRQWKH SURMHFWRU,IWKHSURMHFWRULVWXUQHGRIIDJDLQXQSOXJWKH$&SRZHU FRUGDQGFRQWDFWWKHGHDOHURUWKHVHUYLFHFHQWHUIRUVHUYLFHDQG FKHFNXS'RQRWOHDYHWKHSURMHFWRURQ,WPD\FDXVHDQHOHFWULF VKRFNRUDILUHKD]DUG JUHHQ UHG EOLQNVJUHHQ EOLQNVUHG RII :KHQWKHSURMHFWLRQODPSUHDFKHVLWVHQGRIOLIHWKH/$035(3/$&(LQGLFDWRUOLJKWV\HOORZ:KHQWKLVLQGLFDWRU OLJKWV\HOORZUHSODFHWKHSURMHFWLRQODPSZLWKDQHZRQHSURPSWO\SS 69 Appendix Compatible Computer Specifications %DVLFDOO\WKLVSURMHFWRUFDQDFFHSWWKHVLJQDOIURPDOOFRPSXWHUVZLWKWKH9+)UHTXHQF\PHQWLRQHGEHORZ DQGOHVVWKDQ0+]RI'RW&ORFN :KHQVHOHFWLQJWKHVHPRGHV3&DGMXVWPHQWFDQEHOLPLWHG ON-SCREEN DISPLAY 9*$ 9*$ 9*$ 9*$ 9*$ 9*$ 9*$ 0$&/& 0$& S S L L 69*$ 69*$ 69*$ 69*$ 69*$ 69*$ 69*$ 69*$ 69*$ 69*$ 69*$ 0$& 0$& ;*$ ;*$ ;*$ ;*$ ;*$ ;*$ ;*$ ;*$ ;*$ ;*$ ;*$ ;*$ ;*$ ;*$ ;*$ 6;*$ 6;*$ 6;*$ 6;*$ RESOLUTION [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ H-Freq. (KHz) V-Freq. (Hz) ,QWHUODFH ,QWHUODFH ,QWHUODFH ,QWHUODFH ON-SCREEN DISPLAY 6;*$ 6;*$ 6;*$ 6;*$ 6;*$ 6;*$ 6;*$ 6;*$ 6;*$ 6;*$ 6;*$ 6;*$ 6;*$ 6;*$ 6;*$ 6;*$ 6;*$ 6;*$ 6;*$ 0$& 0$& 0$& :;*$ :;*$ :;*$ :;*$ :;*$ :;*$ :;*$ :;*$ :;*$ :;*$ :8;*$ :8;*$ :6;*$ :;*$ :;*$ 8;*$ 8;*$ 8;*$ 8;*$ S S L L L 3Note: 7KHVSHFLILFDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH 70 RESOLUTION [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ H-Freq. (KHz) V-Freq. (Hz) ,QWHUODFH ,QWHUODFH ,QWHUODFH ,QWHUODFH ,QWHUODFH ,QWHUODFH Appendix Technical Specifications Mechanical Information 3URMHFWRU7\SH 'LPHQVLRQV:[+[' 1HW:HLJKW 0XOWLPHGLD3URMHFWRU [[PP[PP[PP1RWLQFOXGLQJSURWUXVLRQV OEVNJ )RRW$GMXVWPHQW ÛWRÛ Panel Resolution /&'3DQHO6\VWHP 3DQHO5HVROXWLRQ 1XPEHURI3L[HOV 7)7$FWLYH0DWUL[W\SHSDQHOV [GRWV [[SDQHOV Signal Compatibility &RORU6\VWHP +LJK'HILQLWLRQ796LJQDO 3$/6(&$0176&176&3$/0DQG3$/1 LSLSSLDQGL 6FDQQLQJ)UHTXHQF\ +V\QFN+]±N+]9V\QF±+] 3URMHFWLRQ,PDJH6L]H'LDJRQDO 7KURZ'LVWDQFH $GMXVWDEOHIURP´WR´ PP 3URMHFWLRQ/HQV 3URMHFWLRQ/DPS )aOHQVZLWKIPPaPPZLWKPDQXDO]RRPDQGIRFXV : Optical Information Interface 9LGHR,QSXW-DFN $XGLR,QSXW-DFN 5&$7\SH[ 0LQL-DFNVWHUHR[ &RPSXWHU,Q6YLGHR,Q &RPSRQHQW,QSXW7HUPLQDO 0LQL'VXESLQ[ &RPSXWHU,Q0RQLWRU2XW7HUPLQDO &RQWUROSRUW 0LQL'VXESLQ[ 'VXESLQ[ $XGLR2XWSXW-DFN 0LQL-DFNVWHUHR[YDULDEOH /$1&RQQHFWLRQ7HUPLQDO%DVH7;0ESV%DVH70ESV5- Audio ,QWHUQDO$XGLR$PS %XLOWLQ6SHDNHU :506 VSHDNHU¡PP Power 9ROWDJHDQG3RZHU&RQVXPSWLRQ PLC-XR201: $&±9$0D[$PSHUH+]7KH86$DQG&DQDGD $&±9$0D[$PSHUH+]&RQWLQHQWDO(XURSHDQG7KH8. PLC-XR251: $&±9$0D[$PSHUH+]7KH86$DQG&DQDGD $&±9$0D[$PSHUH+]&RQWLQHQWDO(XURSHDQG7KH8. Operating Environment 2SHUDWLQJ7HPSHUDWXUH 6WRUDJH7HPSHUDWXUH Û)±Û)Û&±Û& Û)±Û)Û&±Û& Remote Control %DWWHU\ 2SHUDWLQJ5DQJH 'LPHQVLRQV $$$RU/59$/.$/,1(7<3([ PÛ :[+['PP[PP[PP 1HW:HLJKW R]JLQFOXGLQJEDWWHULHV 71 Appendix Accessories 2ZQHU¶V0DQXDO&'520 4XLFN5HIHUHQFH*XLGH6DIHW\0DQXDO $&3RZHU&RUG 5HPRWH&RQWURODQG%DWWHULHV 9*$&DEOH /HQV&DSZLWK6WULQJ 3,1&RGH/DEHO 1HWZRUN$SSOLFDWLRQ&'520 Ɣ 7KHVSHFLILFDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH /&'SDQHOVDUHPDQXIDFWXUHGWRWKHKLJKHVWSRVVLEOHVWDQGDUGV(YHQWKRXJKRIWKHSL[HOVDUH HIIHFWLYHDWLQ\IUDFWLRQRIWKHSL[HOVRUOHVVPD\EHLQHIIHFWLYHE\WKHFKDUDFWHULVWLFVRIWKH/&' SDQHOV Ɣ Optional Parts 7KHSDUWVOLVWHGEHORZDUHRSWLRQDOO\DYDLODEOH:KHQRUGHULQJWKRVHSDUWVVSHFLI\WKHLWHPQDPHDQG0RGHO1R WRWKHVDOHVGHDOHU 0RGHO1R COMPONENT-VGA Cable : 32$&$&2039*$ S-video-VGA Cable : 32$&$9*$6 SCART-VGA Cable : 32$&$6&$57 VGA-Cable (10 m) 72 : .$0&'% Appendix PJ Link Notice 7KLVSURMHFWRULVFRPSOLDQWZLWK3-/LQN6WDQGDUG&ODVVRI-%0,$-DSDQ%XVLQHVV0DFKLQHDQG,QIRUPDWLRQ 6\VWHP,QGXVWULHV$VVRFLDWLRQ7KLVSURMHFWRUVXSSRUWVDOOFRPPDQGVGHILQHGE\3-/LQN&ODVVDQGLVYHULILHG FRQIRUPDQFHZLWK3-/LQN6WDQGDUG&ODVV )RU3-/LQNSDVVZRUGVHHWKHRZQHU¶VPDQXDORI³1HWZRUN6HWXSDQG2SHUDWLRQ´ 3URMHFWRU,QSXW &RPSXWHU &RPSXWHU 9LGHR 3-/LQN,QSXW 3DUDPHWHU 5*% 5*% &RPSRQHQW 5*% 5*%6FDUW 5*% 6YLGHR 5*% 5*% 5*% 9LGHR 9,'(2 3-/LQNLVDUHJLVWHUHGWUDGHPDUNRI-%0,$DQGSHQGLQJWUDGHPDUNLQVRPHFRXQWULHV 73 Appendix Configurations of Terminals COMPUTER IN 1 /COMPONENT IN /MONITOR OUT (ANALOG) Terminal: Analog RGB (Mini D-sub 15 pin) 4 5 10 15 9 14 2 3 8 13 7 12 1 2 3 4 5 6 7 8 1 6 11 5HG&U6&,QSXW2XWSXW *UHHQ<6<,QSXW2XWSXW %OXH&E,QSXW2XWSXW *URXQG+RUL]V\QF *URXQG5HG *URXQG*UHHQ *URXQG%OXH LAN TERMINAL 1 2 3 4 74 7; 7;± 5; 5 6 7 8 5;± 9 10 11 12 13 14 15 93RZHU *URXQG9HUWV\QF *URXQG ''&'DWD +RUL]V\QF,QSXW2XWSXW&RPSRVLWH+9V\QF 9HUWV\QF ''&&ORFN Appendix PIN Code Number Memo :ULWHGRZQWKH3,1FRGHQXPEHULQWKHFROXPQEHORZDQGNHHSLWZLWKWKLVPDQXDOVHFXUHO\,I\RXIRUJRWRUORVW WKHQXPEHUDQGXQDEOHWRRSHUDWHWKHSURMHFWRUFRQWDFWWKHVHUYLFHVWDWLRQ PIN Code Lock No. )DFWRU\GHIDXOWVHW1R Logo PIN Code Lock No. )DFWRU\GHIDXOWVHW1R 6KRXOGWKHIRXUGLJLWQXPEHUEHFKDQJHG WKHIDFWRU\VHWQXPEHUZLOOEHLQYDOLG :KLOHWKHSURMHFWRULVORFNHGZLWKWKH3,1FRGH 3XWWKHODEHOEHORZVXSSOLHGRQLQDSURPLQHQWSODFHRIWKH SURMHFWRU VERG\ZKLOHLWLVORFNHGZLWKD3,1FRGH 75 Appendix Dimensions 8QLWPPLQFK 6FUHZ+ROHVIRU&HLOLQJ0RXQW 6FUHZ0 'HSWK 1 1 1 1 1 1 1 1 º 1 6 1 1 1 76 /5$' SANYO Electric Co., Ltd. Owner’s Manual Network Set-up and Operation Wired Setting Projector Set-up and Operation This is the manual for the Network function. Read this manual thoroughly to operate the Network function. First, read the owner's manual of the projector to understand the basic operation of the projector and the safety instructions. The safety instructions in the owner's manuals should be followed strictly. Compliance Federal Communications Commission Notice This equipment has been tested and found to comply with the limits for a Class B digital device, pursuant to part 15 of the FCC Rules. These limits are designed to provide reasonable protection against harmful interference in a residential installation. This equipment generates, uses and can radiate radio frequency energy and, if not installed and used in accordance with the instructions, may cause harmful interference to radio communications. However, there is no guarantee that interference will not occur in a particular installation. If this equipment causes harmful interference to radio or television reception which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures: - Reorient or relocate the receiving antenna. - Increase the separation between the equipment and receiver. - Connect the equipment into an outlet on a circuit different from that to which the receiver is connected. - Consult the dealer or an experienced radio/TV technician for help. Use of shielded cable is required to comply with class B limits in Subpart B of Part 15 of FCC Rules. Do not make any changes or modifications to the equipment unless otherwise specified in the instructions. If such changes or modifications should be made, you could be required to stop operation of the equipment. Model Numbers Trade Name Responsible party Address Telephone No. 2 : PLC-XR201, PLC-XR251 : Sanyo : SANYO FISHER COMPANY : 21605 Plummer Street, Chatsworth, California 91311 : (818)998-7322 Safety instructions CAUTION IN USING THE PROJECTOR VIA NETWORKS L When you find a problem with the projector, remove the power cable immediately and inspect the unit. Using the projector with failure may cause fire or other accidents. L If you remotely use the projector via networks, carry out a safety check regularly and take particular care to its environment. Incorrect installation may cause fire or other accidents. CAUTION IN USING NETWORK FUNCTION ENGLISH L SANYO Electric Co., Ltd. assumes no responsibility for the loss or damage of data, or damage of the computer caused by using this projector. Making backup copies of valuable data in your computer is recommended. 3 Table of contents Compliance ..........................................................................................................................................................................2 Federal Communications Commission Notice ....................................................................................2 Safety instructions ...........................................................................................................................................................3 Table of contents ..............................................................................................................................................................4 Chapter 1 Preparation ................................................................................................5 Features...................................................................................................................................................................................6 Required operating environment for computers ........................................................................................7 Network specifications of the projector............................................................................................................7 Flow of installation...........................................................................................................................................................9 Notice about installing Software CD-ROM.............................................................................................9 Chapter 2 Setup Procedures.................................................................................. 11 Connecting to the LAN line.................................................................................................................................... 12 Network configuration............................................................................................................................................... 12 Network PIN code ......................................................................................................................................................... 14 Network information................................................................................................................................................... 14 Network factory default............................................................................................................................................ 15 Wired LAN factory default settings.................................................................................................................... 16 Chapter 3 Basic Setting and Operation............................................................. 17 Login the setting page of the projector......................................................................................................... 18 [1] Enter the IP address...................................................................................................................................... 18 [2] Login ..................................................................................................................................................................... 18 [3] Display of main setting page ................................................................................................................ 19 How to use the setting page .................................................................................................................................20 Initial setting .....................................................................................................................................................................22 Network PIN code setting ..............................................................................................................................23 PJLink and password setting.........................................................................................................................23 Network configuration............................................................................................................................................... 24 E-mail setting ...................................................................................................................................................................25 Examples: Type and contents of alert mail..........................................................................................27 SNMP setting....................................................................................................................................................................29 Chapter 4 Controlling the Projector ................................................................... 31 Power control and status check...........................................................................................................................32 Control..................................................................................................................................................................................34 Input.............................................................................................................................................................................34 System.........................................................................................................................................................................35 Sound .........................................................................................................................................................................36 Image adjustment..............................................................................................................................................37 PC adjustment.................................................................................................................................................................38 Setting up the projector ...........................................................................................................................................39 Screen setting .......................................................................................................................................................39 Setting 1.....................................................................................................................................................................40 Setting 2.....................................................................................................................................................................40 Setting 3..................................................................................................................................................................... 41 Information........................................................................................................................................................................42 Chapter 5 Appendix ................................................................................................ 43 Examples of connection ...........................................................................................................................................44 Use of telnet......................................................................................................................................................................46 Web browser setting...................................................................................................................................................48 Examples: OS/Browsers .............................................................................................................................................49 Q&A ........................................................................................................................................................................................53 4 Chapter 1 Preparation 1 ENGLISH Describes features and operating environment of this projector. 5 Chapter 1 Preparation Features Web Management function (p.31) With this func tion, you can monitor projector functions such as power status, lamp s t at us , inp u t m o d e, si gna l condition, lamp-use time, etc. through the network by using the web browser installed on your computer. PC1 PC2 PC3 PC4 PJ2 PJ1 PC6 PC5 Turn ON PJ2 E-Mail Alert function (p.25) T h e p r o j e c to r s e n d s m e s sages to the registered e-mail addresses when a lamp abnormality or power failure occurs with the projector. This message describes how to solve the cause of the problems. You can take efficient action for quick recovery. PC1 PC2 PC3 PC4 PJ2 PJ1 PC6 PC5 You’ve got Mail. SNMP Agent function (p.29) To send the information of the projector to the SNMP manager. Enables you to manage the projector condition with the supplied SNMP manager software. SNMP Manager function A function to manage the condition of projectors in the network by using the SNMP protocol. The managing computer needs to provide an SNMP managing software. Refer to the owner's manual of the "PJ Net work Manager" sup plied separately for further details. 6 PJ1 PJ2 PJ3 PJ4 Trap PC6 PC5 PC4 You received a Trap. Trap SNMP Manager Features Required operating environment for computers When operating the projector via networks, computers should meet the operating environment below. Operating System Windows 98, Windows Me, Windows NT4.0 Windows 2000, Windows XP, Windows Vista (32bit version) Mac OS X v 10.4 or later Computer environment Recommended CPU Windows: Higher than Pentium III 900MHz Macintosh : 800 MHz PowerPC G4 or faster,or 1.8 GHz Intel Core Processor or faster Memory Windows : 64MB (Minimum)/ 128MB or more (Recommended) 128MB or more for Windows XP 1GB or more for Windows Vista Macintosh : 256MB or more (512MB is recommended) HDD free area 100MB or more Drive equipment CD-ROM drive Display setting of computer Support one of following resolutions; VGA (640 x 480), SVGA(800 x 600), XGA(1,024 x 768) Number of colors: Either of 16 bit (65,536 color 24/32 bit (16.77 million colors)) Network card The computer must provide a 10Base-T or 100Base-TX network card. Web Browser* Internet Explorer version 5.0, 5.5, 6.0 or 7.0 Netscape Navigator version 7.1 or 9.0 Safari 3.0 or later * Used to control and set up the projector. The layout of pages in the browser may slightly differ from each type of application or operating system you use. Internet Mailer* - Microsoft Outlook - Microsoft Outlook Express - Netscape Mail * Required the internet e-mail application software to receive an e-mail alert sent from this projector. If you do not use the function E-mail Alert, this application is not required. Network specifications of the projector LAN Terminal Protocol 100Base-TX (100Mbps)/10Base-T (10Mbps) ENGLISH Data communication speed TCP/IP 7 Chapter 1 Preparation The limitation*1 of connection between the projector and hub or computer Suitable LAN cables are limited by length and type as follows; Connection Type of usable LAN cable Maximum length Projector - Hub UTP Straight Cable with category 3 or 5 *2 100m Projector - Computer UTP Cross Cable with category 3 or 5*2 100m *1 There may be other limitations depending on your network environment or LAN specification. Please consult your network administrator for further details. *2 Category of LAN cable indicates the cable quality. Normally, a cable with category 3 or 5 is used for 10Base-T network, and a cable with category 5 is used for 100Base-TX network. Notice Expression/Abbreviation The OS of the computer and the Web browser described in this manual is Windows XP Professional and Internet Explorer 6.0. In case of another OS or Web browser, some instruction procedures may differ from the actual operation depending on your computer environment. Use of this manual This manual does not provide the description of basic operation and functions for computer, web browser, projector and network. For instructions about each piece of equipment or application software, please refer to the respective booklet. Trademarks Ethernet is a registered trademark of Xerox Corporation. Microsoft, Windows, Windows NT, Windows XP and Windows Vista are registered trademarks of Microsoft Corporation. Internet Explorer is a registered trademark of Microsoft Corporation. Netscape Navigator and Netscape Communicator are trademarks or registered trademarks of Netscape Communications Corporation. JavaScript is a registered trademark of Sun Microsystems, Inc. Macintosh is a registered trademark of Apple, Inc. in the USA and other countries. PowerPC is a registered trademark of IBM Corporation. Intel Core is a registered trademark of Intel Corporation in the USA and other countries. Other product or brand names in this manual are registered trademarks or trademarks of their respective owners. * Unauthorized use of a part or whole of the contents in this manual is prohibited. * The contents of this manual are subject to change without notice. 8 Flow of installation Flow of installation To use the projector via the networks, follow the setup procedures below. STEP 1 Connect the LAN and set the configuration. Decide depending on the LAN environment. “2. Setup Procedures” (pp.11–16). Detailed LAN configurations need to be done with a browser later. First, complete the Wired LAN connection between computers and projectors, then start browser configurations. STEP 2 “3. Basic setting and operation” (pp.17–30). Network Configuration has completed. Follow each chapter to operate the projector. NOperate and manage the projector “4. Controlling the projector”(pp.31-42) “Power Control and status check”(p.32) “Control”(p.34) “PC adjustment”(p.38) “Setting up the projector”(p.39) “Projector information”(p.42) STEP 3 Install the Software on computers. Install the software recorded in CD-ROM on each computer which will be operated. Refer to the owner's manual of PJ Network Manager. ENGLISH Notice about installing Software CD-ROM It is available for controlling and setting of the projector by using the web browser without installing any software. So it is not required to install the software into your computer. For PJ Network Manager function, it is required to install the software. Please see the owner's manual of "PJ Network Manager Function". 9 Chapter 1 Preparation 10 Chapter 2 Setup Procedures 2 ENGLISH Describes how to configure the network. 11 Chapter 2 Setup Procedures Setting procedures and contents differ depending on the LAN installation location. When installing, consult your system administrator to set up the LAN appropriately. Connecting to the LAN line Connect the LAN cable to the LAN connection terminal of the projector. LAN Connection Terminal ACT Lamp (Orange) Blink orange when the projector is sending or receiving the data. LINK Lamp (Green) Light green when the projector is connected to the network correctly. LAN Cable Network configuration Set the Wired LAN network through the projector menu. Detailed network settings will be made with browser. Refer to “3. Basic setting and operation” (p.17-30). First, complete the settings described in this chapter before performing steps in “3. Basic setting and operation.” Setting Procedure 1. Select “LAN mode select” in the Network menu, and press Point or SELECT button. 2. Select similar LAN environment among LAN1, LAN2 and LAN3 with the Point ! buttons. Then the Menu will disappear, the “Please wait...” message will appear, and switching operation will start. Switching will take a while and the projector’s LINK/ACT Lamp will be on or blink, and after completing the operation, the “Please wait...” message will disappear. 12 Network configuration 3. Select "Network setting" in the Network menu and press SELECT button, and then the LAN setting screen will appear and selected LAN settings will be displayed. Adjust each item to the setting environment. Consult your system administrator about the detailed settings. Press SELECT button in a row where you want to adjust, and adjust the figures with the Point ! buttons and move among the items with the Point buttons, and then press SELECT button to fix. Move to the next row with the Point ! buttons to adjust. 4. After completing all the settings, select “Set” and press SELECT button. Now, all procedures have been done. To cancel the adjusted settings, select "Cancel" and press SELECT button. You can confirm the LAN settings you have made from “Network information” (p.14). In such cases that the LAN cannot be connected, see this screen. Network setting DHCP: On Description DHCP....................Sets DHCP function On or Off. When you setup the network setting manually, select "Off". When it is set On, IP address, Subnet, Gateway and DNS are automatically set according to your network environment *1. IP address .............Sets IP address of the projector Subnet ....................Sets Subnet mask. Normally sets 255.255.255.0 Gateway*2 .............Sets IP address of the default gateway (Router) DNS*3 .......................Sets IP address of the DNS server. *1 Set "On" only when the DHCP server is available on your network environment. *2 Set [255.255.255.255] if the network does not provide the gateway (router). *3 Set [255.255.255.255] if you do not use the function E-mail alert. ENGLISH Item DHCP: Off 13 Chapter 2 Setup Procedures Network PIN code The Network PIN code is to restrict the access from the networks to the projector. After setting the Network PIN code, you need to enter it to operate the projector via the networks. 1. Select "Network PIN code" in the Network menu, and press SELECT button. The Network PIN code screen will appear. 2. Set the Network PIN code. Set the figures with the Point ! buttons and move to the next items with the Point buttons. Select “Set” and press SELECT button to set. To cancel the preset Network PIN code, select “Cancel”. When you do not want to set the Network PIN code, set "0000". It is recommended to set the Network PIN code if you use the projector via the networks. The Network PIN code can be set also through the networks. See “3. Basic setting and operation” “Initial setting” “Network PIN code setting” (p.23). Network PIN code Network PIN code screen Network information Select "Network information" in the Network menu and press Point or SELECT button to show LAN setting environment of the currently selected projector. (The description below is an example and different from what will be shown.) 14 Network factory default Network factory default ENGLISH 1. Select “Network factory default” in the Network menu and press SELECT button. 2. A confirmation box appears and select "Yes" and then press SELECT button. 3. Another confirmation box appears and select "Yes" and then press SELECT button. 4. All the wired LAN settings will go back to the factory default settings. For details, refer to “Wired LAN factory default settings” (p.16). 15 Chapter 2 Setup Procedures Wired LAN factory default settings SELECTED LAN Parameter 16 LAN 1 LAN 2 LAN 3 IP CONFIGURATION MANUAL DHCP MANUAL IP ADDRESS 169.254.100.100 192.168.100.100 192.168.100.100 SUBNET MASK 255.255.0.0 255.255.255.0 255.255.255.0 GATEWAY ADDRESS 255.255.255.255 255.255.255.255 255.255.255.255 DNS ADDRESS 255.255.255.255 255.255.255.255 255.255.255.255 Chapter 3 Basic Setting and Operation 3 ENGLISH Describes basic operations and settings for controlling the projector by using the web browser. It is required that computer and projector is connected to the network and the network address is properly configured. 17 Chapter 3 Basic Setting and Operation Login the setting page of the projector [1] Enter the IP address Launch the web browser installed in your computer, enter the IP address into the "Address" on the browser and then press "Enter" key. Enter the address that you configured in item "Network configuration" ( p.12). [2] Login If the setting page has set the password, the authentication window will appear. In this case type "user" onto the User Name text area and the login Network PIN code onto the Password text area and then click OK (Log in) button. * The entering User Name must be "user" and it can not be changed. [Note] When accessing the projector for the first time or the Network PIN code "0000" is set, the auto-login will be performed and the next main setting page is displayed. 18 Login the setting page of the projector [3] Display of main setting page The following main setting page will be displayed according to your display mode selection. Perform various kinds of settings through this page. Click on the menus to display the control and setting pages. Main setting page in the display Sub menu tab Switches the sub menu tab. Setting page Displays the control and setting items according to the selected menu. ENGLISH Main menu For selection of control and setting items of the projector. 19 Chapter 3 Basic Setting and Operation How to use the setting page To control and set up the projector, use the setting menus on the web browser. Describes the basic operation and procedures commonly used on this manual. Example of the setting page The setting menu appears when clicking the sub menu tab. * Each item has a valid setting range respectively. Types of setting Text box setting Enter a number or text and then click Set button. or Change a value with – or + button. Pull-down menu setting Select an item with pull-down menu button and then click Set button. The value in the text box indicates current value. Each item has a valid setting range. The setting value exceeding this becomes invalid. Some con- trol items can not be used depending on the selecting input mode or functions of the projector you use. In this case, the values of those items are indicated with "---". 20 How to use the setting page Radio button setting Select an item by selecting a radio button. Check box setting ENGLISH Select items by ticking on check boxes. 21 Chapter 3 Basic Setting and Operation Initial setting After installing the projector, perform the following basic initial setting. Click Initial Setting on the main menu to display the initial setting page. Item Description Language..............Switches display language on the setting page. English or Japanese. Model name .......Indicates the model name of the projector Network PIN code ......Sets the Network PIN code to login the setting page (p.23) PJLink.......................Switches PJLink password authentication on or off (p.23) Password...............Password for PJLink function (p.23) 22 Initial setting Network PIN code setting This is to set the Network PIN code to restrict the access from an unauthorized person through the network. Enter a 4-digit number as the Network PIN code onto the text box and click Set button. The projector begins restarting and it takes about 10 seconds. Close (Quit) the web browser and access to the login page again in 10 seconds. This is to perform the login authentication firmly. The default Network PIN code [0000] means no Network PIN code is set. When you connect the projector to the network, it is recommended to set a new Network PIN code. Only a four-digit number is valid for the Network PIN code. PJLink and password setting This is to set the PJLink password authentication on or off. If set "On" with the PJLink pulldown menu, the password must be required. Enter a password* onto the text box and click Set button. 1 to 32 alphanumeric characters can be used for the password. What's PJLink? The projectors equipped with PJLink function can be used together on the same network, regardless of model or brand, for centralized control and monitoring. This standard was established by the Japan Business Machine and Information System Industries Association (JBMIA). Please visit the Website at http://pjlink.jbmia.or.jp/english/. PJLink Notice Projector Input Computer 2 Computer 1 Video RGB RGB Component S-video RGB (Scart) Video PJLink Input RGB 1 RGB 2 RGB 3 RGB 4 RGB 5 VIDEO 2 Parameter 11 12 13 14 15 22 ENGLISH The projector is compliant with PJLink Standard Class 1 of JBMIA, and it supports all commands defined by PJLink Class 1 and is verified conformance with PJLink Standard Class 1. 23 Chapter 3 Basic Setting and Operation Network configuration Click Network on the main menu. The following setting page is displayed. The IP Address, Subnet Mask, Default Gateway, DNS (Domain Name Server) and projector name are set up on this menu. The IP address and Subnet Mask have been configured already in chapter "Installation". If you want to change them or configure default gateway or DNS, perform them in this page. If you change them, the projector begins restarting and it takes about 10 seconds. Close (Quit) the web browser and access to the login page again in 10 seconds. Item Description LAN mode ............Displays the selected LAN mode IP configuration ...Sets DHCP or Manual IP address .............Sets IP address of the projector Subnet mask.......Sets Subnet mask. Normally sets 255.255.255.0 Default gateway*1 .....Sets IP address of the default gateway (Router) DNS*2 .......................Sets IP address of the DNS server. Must be set when using the e-mail function Projector name*3 .Sets name of the projector. (64 characters maximum) You must use the number specified by your administrator. The address must be entered as a group with four numbers split by a dot like [192.168.001.101]. *1 Set [0.0.0.0] if the network does not provide the gateway (router). *2 Set [0.0.0.0] if you do not use the function E-Mail alert. *3 If you use the DNS server, register the host name registered to the DNS server as a projector name. You can access with this projector name from any computers in your network. If you do not use the DNS server, access with the assigned IP address to the projector. * All the network setting will reset to the default when setting [0.0.0.0] of the IP Address. * If you make incorrect settings, you cannot find out the new network settings. Be careful to set up them correctly, otherwise you cannot connect to the projector. It is recommended to make a note of them. 24 E-mail setting E-mail setting This projector has an E-mail function which can send an alert message to users or an administrator if it detects an abnormality on the projector or run out of the life span of the lamp. Click E-mail Setting on the main menu and follow the below steps. Item .................................Description SMTP server*1........................Sets server name or IP address of the SMTP server Administrator address....Sets e-mail address of administrator Add address...........................Sets e-mail address of the user to send mail when the projector has an abnormality. 1 Setting SMTP server and administrator address Set the server name or IP address of the SMTP server*1 and administrator address. The administrator address is set to "Reply-To" address of the message sent from the projector. If the projector sends an alert message due to the abnormality on the projector but the SMTP server is down in some other reason, the message will not be sent. In this case, the message "Unable to connect to server." will be displayed on the setting page. To clear this message, set up SMTP server address again. To use the E-Mail function, it must be set the DNS address on the Network setting page correctly. You cannot use this E-mail function if the DNS server and SMTP server cannot be used in your network environment. The projector does not send message to the address set in "Administrator address" text box. If you want to send e-mails to the administrator address, enter the administrator address into "Add address" text box. ENGLISH *1 The SMTP server is a server for sending E-Mail. Please contact your network administrator to have this SMTP server address. 25 Chapter 3 Basic Setting and Operation 2 Registering and deleting E-mail addresses Click "Add address" and type the e-mail address onto the text box and click Set button. To check the registered addresses, click Check/Delete sub menu tab. The addresses are listed as the figure on the right. Up to 10 E-mail addresses can be registered. Check / Delete To delete the registered addresses, check the address you want to delete and click Delete button. 3 Option selection for sending alert mail Option Click Option sub menu tab. Check the condition items under which alert mail will be sent and click Set button. Please refer to item "Examples :Type and contents of alert mail" described on the next page. 26 "When PJ lamp is off" signifies the lamp goes out without user operation. "When PJ is turned into Standby in proper user operation" signifies that the projector is turned on by using the web browser and then it is turned into standby with ON/STANDBY button on the top control or the remote control. Up to 99,999 hours can be set for use time. E-mail setting Examples: Type and contents of alert mail When the projector has an abnormality, the following alert messages are sent to the registered E-mail address according to your selected condition. Administrator or user can take an efficient action quickly by receiving this message. This is very useful to maintain and service the projector. The following are examples of received messages. L When internal PJ temperature is too high: TITLE: Message from projector Projector Model Name: model name TCP/IP: 192.168.1.201 Projector Name: Proj05 It sends you following message. *The Projector lamp is turned off, because internal projector temperature is too high. Wait for the completion of the cooling process and make sure the projector has been turned into Standby. Then turn the projector on again. If the Indicator continues flashing, check the air filter for dust accumulation. L When internal PJ power circuit is failed: TITLE: Message from projector Projector Model Name: model name TCP/IP: 192.168.1.201 Projector Name: Proj05 It sends you following message. The projector lamp was turned off, because the projector power circuit failed. Unplug the AC power cord and plug it, and then turn on the projector once again to verify operation. If the problem still persists, unplug the AC power cord and ask servicing to a qualified service personnel with the error information. ENGLISH *The Projector lamp is turned off, because Projector power circuit is failed. Unplug the Projector from AC outlet and ask servicing to qualified service personnel. MCI 3.3V OK MAIN ALL NG Error information 27 Chapter 3 Basic Setting and Operation L When PJ lamp replacement time is reached: TITLE: Message from projector Projector Model Name: model name TCP/IP: 192.168.1.201 Projector Name: Proj05 It sends you following message. *The projector lamp has reached replacement time. Lamp ON 2000 h Replace it with a new lamp immediately and reset the lamp counter. If the projector is used without resetting the lamp counter, the alert mail is sent to users in every poweron of the projector. This alert mail will not be sent when unchecking the mail sending condition "When PJ lamp replacement time is reached". L When lamp corres. value reaches preselect use time: TITLE: Message from projector Projector Model Name: model name TCP/IP: 192.168.1.201 Projector Name: Proj05 It sends you following message. *The accumulated lamp use time has reached 2000 hours. 28 SNMP setting SNMP setting This projector provides a SNMP (Simple Network Management Protocol) agent function. The SNMP consists of a manager and agents. The group which communicates information each other with SNMP is called "Community". There are two access modes in a community, Refer (read only) and Set (readwrite). This projector allows to use Refer (read only) only. The SNMP message informs the projector status called "Trap" to an administrator. Click SNMP Setting on the main menu and set up each item. PJ information Item ........................................ Description Contact ...............................................Enter user name of the projector etc. (optional) Place .....................................................Enter place of the projector (optional) Community name(refer).......Enter community name (read only). Default name is "public". Trap Item ........................................ Description ENGLISH Community name......................Enter community name to send "Trap". Default name is "public". Add address....................................Enter IP address of the SNMP manager computer to receive "Trap". The SNMP agent provided with this projector is based upon MIB-2 defined by RFC1213. For private MIB information, refer to file "Mibinfo/XUPjNet.mib" in the CD-ROM. 29 Chapter 3 Basic Setting and Operation Trap check/delete Check and delete the trap address Checking the registered trap address and deleting the address. To delete the address, tick check box in front of the IP address and click Delete button. Up to 10 trap addresses can be registered. Trap option Trap option setting Tick check boxes in front of the condition item to send the trap. Click Set button if you tick or un-tick the check box on a page. 30 "When PJ lamp is off" signifies the lamp goes out without user operation. "When PJ is turned into Standby in proper user operation" signifies that the projector is turned on by using the web browser and then it is turned into standby with ON/STANDBY button on the top control or the remote control. Up to 99,999 hours can be set for the time setting. Chapter 4 Controlling the Projector 4 ENGLISH Describes controlling and setting of the projector by using the web browser. 31 Chapter 4 Controlling the Projector Power control and status check Click Power & Status on the main menu. The control page will be displayed. By clicking ON or Standby button on the page, the power of the projector can be controlled. Confirmation window as shown in the below appears when the Standby button is pressed. Popup confirmation window Item Description PJ status Power .........................Displays the status of the lamp. (ON, OFF, On starting up, On cooling down) Status ..........................Displays the status of the projector's power. (Refer to next page.) Power control ........Controls the projector power by clicking the "ON" or "Standby" button. The projector cannot be turned on while the projector is on cooling down. The web browser checks and updates the projector's condition every 30 seconds automatically. 32 Power control and status check About projector condition Status Description Normal............................................................... Projector is operating normally. Power management in operation........... Power management is operating Lamp failure................................................... Lamp failure is occurring Abnormal Temperature......................... The temperature of the projector became too high Standby after Abnormal Temp......... Projector detects abnormal temp. and sets into standby mode. Power failure ................................................ Power failure has occurred inside the projector. Projector is turned off. Unplug the AC cord and ask servicing to a qualified service personnel. Caution about turning on/off the projector via the networks When turning on/off the projector via the networks, preset the projector as follows: 1. Select “Setting” from the Projector menu. 2. Select “Standby mode” from the Setting menu and set it as “Network”. If you set this function as Network, the network part of the projector is constantly provided with power even if the projector is turned off. If you set this as Eco, then the network part will be turned off when you turn off the projector. Consequently, you cannot turn on/off the projector via the networks. ENGLISH When a security (PIN code lock) has been set on the projector, you also cannot control it through the network. To control the projector through the network, unlock the security on the projector using with the projector's menu control. 33 Chapter 4 Controlling the Projector Control Click Control on the main menu. The setting method differs depending on the contents of the page. Click on the page number to change pages and select desired setting items. Please see the owner's manual of the projector to have the further information of each control item. Input This function is to select the input mode and source mode of the projector. Click Set button after selecting the input and source mode. Item Description Input.........................Selects input mode of the projector. Source.....................Selects signal source of the input. Computer1 : RGB Component RGB(Scart) S-video Computer2 : RGB Video The control page displays valid control items depending on the selected input mode, signal or functions of the projector you use, therefore, there may be different controls between the described items and actual control items on the page display. For further information , refer to the projector's owner's manual. When the projector is in standby, all the controlling items are inactive. 34 Control System This function is to select the system of signal input to the projector. The available system mode are listed on the pull-down menu button according to the input signal. Select a system and then click Set button. Available selection at the RGB input Item Description XGA1 ........................It automatically switches to the proper computer system of the input signal. * The computer system modes (VGA, SVGA, XGA. SXGA, UXGA, WXGA...) which meet the input signal are listed. Available selection at the Video/S-video/Scart input Item Description AUTO........................It automatically switches to the proper color system of the input signal. * The selectable color systems are PAL, SECAM, NTSC, NTSC4.43, PAL-M and PAL-N. * AUTO is fixed at the Scart input. Available selection at the Component input Item Description ENGLISH AUTO........................It automatically switches to the proper scanning system of the input signal. * The selectable scanning systems are 480i, 575i, 480p, 575p, 720p, 1035i and 1080i. If the mode (Mode1 to Mode5, ExMode6 to ExMode50) which is stored in the item "PC Adjustment" ( p.38) is available, they are also listed together with the above mode. 35 Chapter 4 Controlling the Projector Sound This function is to adjust the sound of the projector. The values in the text box represent the current control value or status. Item Description Volume ...................Adjusts the sound volume from the speaker. (0 ~ 31) Mute.........................Suppresses the sound. (ON, OFF) 36 Control Image adjustment This function is to adjust the projected picture image and save the image mode. To store the adjusted value, click Store button, and to load the adjusted value, click Load button. Item Description Contrast .............................. Adjusts picture contrast (0~ 63) Brightness ......................... Adjusts picture brightness (0~ 63) Color...................................... Adjusts picture color saturation (0~ 63) Tint ......................................... Adjusts picture hue (0~ 63) Color temp........................ Sets a color temperature mode. {High, Mid, Low, XLow, User, Colorboard, Blackboard(Green)} White Balance Red, Green, Blue ..... Adjusts each white balance respectively. (0~ 63) * When changing the value of the white balance, the color temp. indicates "Adj." Sharpness................................Adjusts picture sharpness. (0~ 15) Gamma.......................................... Adjusts brightness of darker part of the picture. (0~ 15) Noise reduction ................ Switches noise reduction mode (OFF, L1, L2) Progressive............................ Switches progressive mode (OFF, L1, L2, Film) Reset............................................Resets the Image adjustment to previous levels. Store............................................Stores the Image adjustment values. Select an item [Image1 - Image4] from the pull-down menu and click Store button. Load.............................................Loads the Image mode. Select an image mode from the pull-down menu and click Load button. There may not be available mode depending on the input mode as shown in the table left. Input source Dynamic Standard Cinema Real Blackboard(Green) Colorboard Image1 - 4 * * The mark " " means that the available image mode in the selected input source. The error message appears when selecting the disabled image mode indicated with "*". ENGLISH Image mode Video Computer 37 Chapter 4 Controlling the Projector PC adjustment Click PC Adj. on the main menu. This function is to adjust the signal from the computer connected to the projector to obtain the proper picture image on the screen. Item Description Current mode......Displays a current mode like VGA, SVGA, XGA. SXGA, UXGA, WXGA, etc. or Mode1 - Mode5 which are the customized mode created by using the "Mode Store" function described below. Auto PC adj..........Performs automatic adjustment. Fine sync. ..............Performs Fine Sync adjustment. (0 ~ 31) Total dots..............Adjust the number of total dots in the horizontal period. Clamp .........................Adjusts the phase of the clamp. (1 ~ 127) Display area Horizontal..........Adjusts the image area horizontally. Vertical ..............Adjusts the image area vertically. Position Horizontal .......Adjusts the horizontal position of the screen. Vertical ..............Adjusts the vertical position of the screen. Reset.........................Resets the PC adjustments to the previous levels. Mode Store..........Stores the PC adjustment values. Select a mode no. [Mode1 - Mode5] from the pulldown menu. Mode Free ............Clear the PC adjustment values. Select a mode no. [Mode1 - Mode5] from the pulldown menu. 38 Setting up the projector Setting up the projector Click Setting on the main menu. This function is to set up the projector. Select the sub menu [Screen setting] or [Setting] and then set up each setting. Screen setting This function is to adjust the screen mode of the projector. The values in the text box represent the current screen status. Item Description Screen .....................Switches the screen mode. (Normal, True, Wide, Full, Custom) There may not be available mode depending on the input mode as shown in the table below. Normal True Wide Full Custom * * The mark " " means that the available screen mode in the selected input source system. The error message appears when selecting the disabled screen mode indicated with "*". ENGLISH Input source Screen mode Video Computer 39 Chapter 4 Controlling the Projector Setting 1 Item Description Language..............Sets the language display of projector's on-screen display menu. Auto setup ...........Executes the Auto PC Adj, and Input Search function below according to the each setting after clicking Start button. Auto PC Adj. .....Sets Auto PC Adjustment mode. (ON, OFF) Input search .....Sets the auto-input signal detection mode. (ON1, ON2, OFF) Auto keystone ....Sets Auto Keystone mode. (Auto, Manual, OFF) Background.........Sets the screen background when no signal input. (Blue, User, Black) Display....................Switches on or off the on-screen menu display on the screen. (OFF, Countdown Off, ON) Countdown off .......Displays image during the starting up. Logo .........................Sets on or off the logo display on the screen during the startup. (OFF, Default, User) Setting 2 Item Description Ceiling.....................Sets the image top/bottom and left/ right reversed. (ON, OFF) Rear...........................Sets the image left/right reversed. (ON, OFF) Terminal.................Sets the COMPUTER IN 2/MONITOR OUT terminal to COMPUTER 2 or Monitor Out. Power management .....Sets into the selected power management mode (Ready, Shutdown, OFF) if the input signal is interrupted and no control key is pressed for the specified period of time. *The specified time can be set 1 to 30 min. On start ..................Sets the power-on mode when the AC cord is connected to the outlet. Lamp control......Selects lamp control mode. (High, Normal, Eco) Lamp life control ....................Selects lamp life control mode (Mode1, Mode2) when the total use time exceeds the recommended total hours of use. 40 Setting up the projector Setting 3 Item Description ENGLISH Key lock..................Sets the prohibition of controls either Projector or Remote control. (OFF, Projector keys, Remote control) Fan control ............. Sets the fan control speed. OFF Normal mode ON1 Highland mode 1 ON2 Highland mode 2 Lamp Corres. Value(h)..................Displays the lamp use time (Corresponding value) . Reset the time after lamp replacement. Click "Reset", a confirmation display appears, and then click "OK", the time will be reset. Filter counter......Displays the filter counter. Reset the time after filter clean-up. Click "Reset", a confirmation display appears, and then click "OK", the time will be reset. Filter warning.....Sets the time to indicate the filter warning message on the screen. (OFF, 100H, 200H, 300H) Factory default..........Sets all of the projector control items to the factory default setting except the following items. Lamp Corres. Value, PJ time, Network PIN code, Network setting * This function is not effective for the settings of Network address settings, e-mail settings, etc. No show.................Sets the black out image temporarily. (ON, OFF) Freeze......................Sets the image to freeze mode. (ON, OFF) Closed caption..Sets the closed caption function. Closed caption...Sets the closed caption mode. (OFF, CC1, CC2, CC3, CC4) Color .....................Sets the color of the contents. (Color, White) 41 Chapter 4 Controlling the Projector Information This page is to display the basic information of the projector status. Click Information on the main menu. Click this button to update the information. Items Description Input System Signal Screen Lamp status Security PJ time(h) Lamp Corres. Value(h) Filter time(h) Displays selected input and source. Displays selected signal system. Input signal status (Yes, No) Displays screen mode. Displays lamp status with an animation. Refer to the table as shown below. Displays the security (PIN code lock) status (Yes, No) Displays the accumulated use time of the projector. Displays the use time (Corresponding value) of the lamp. Displays the accumulated use time of the filter. Indication of the lamp status Icon display/background Status 42 White-Yellow/Blue Lamp on (Normal) White-Yellow/Red Lamp on (Lamp is being used over a specified use time, replace lamp immediately) Gray/Blue Lamp off (Normal) Gray/Red Lamp off (Lamp is being used over a specified use time, replace lamp immediately) Red/Blue with X Lamp failure (Lamp failure, check lamp condition) Red/Red with X Lamp failure (Lamp failure and lamp is being used over a specified use time, replace lamp immediately) Chapter 5 Appendix 5 Connection examples Use of telnet Web browser setting Technical data ENGLISH Q&A 43 Chapter 5 Appendix Examples of connection Peer-To-Peer connection Connecting the projector (PJ01) to the control computer (PC05) directly. * UTP cross cable Computer Name: PC05 IP Address : 192.168.0.5 Subnet Mask : 255.255.255.0 Default Gateway : DNS : Projector Name: PJ01 IP Address : 192.168.0.2 Subnet Mask : 255.255.255.0 Default Gateway : 0.0.0.0 DNS : 0.0.0.0 Connecting the projector (PJ01) to the control computer (PC05) via the hub. Hub To another network Computer Name: PC05 IP Address : 192.168.0.5 Subnet Mask : 255.255.255.0 Default Gateway : DNS : Projector Name: PJ01 IP Address : 192.168.0.2 Subnet Mask : 255.255.255.0 Default Gateway : 0.0.0.0 DNS : 0.0.0.0 Computer Name: PC10 IP Address : 192.168.0.10 Subnet Mask : 255.255.255.0 Default Gateway : DNS : When the projector is connected to the computer directly without hub, the UTP cross cable should be used. 44 Examples of connection The gateway (Router) installed in the network Connecting the projector (PJ01) to the control computer (PC05) via the gateway. Entrance hall Computer Name IP Address Subnet Mask Default Gateway DNS : PC205 : 192.168.200.5 : 255.255.255.0 : 192.168.200.1 : 192.168.201.1 Projector Name: PJ01 IP Address Subnet Mask Default Gateway DNS : 192.168.200.15 : 255.255.255.0 : 192.168.200.1 : 192.168.201.1 Hub Network Group: 192.168.200.x Gateway (Router) To another network IP Address : 192.168.200.1 IP Address : 192.168.100.1 IP Address : 192.168.10.1 Office Hub Computer Name: PC05 IP Address Subnet Mask Default Gateway DNS : 192.168.10.5 : 255.255.255.0 : 192.168.10.1 : 192.168.201.1 Computer Name IP Address Subnet Mask Default Gateway DNS : PC10 : 192.168.10.10 : 255.255.255.0 : 192.168.10.1 : 192.168.201.1 Computer Name IP Address Subnet Mask Default Gateway DNS : PC51 : 192.168.10.51 : 255.255.255.0 : 192.168.10.1 : 192.168.201.1 Computer Name IP Address Subnet Mask Default Gateway DNS : PC61 : 192.168.10.61 : 255.255.255.0 : 192.168.10.1 : 192.168.201.1 ENGLISH Hub Network Group: 192.168.10.x 45 Chapter 5 Appendix Use of telnet You can control the projector by using the telnet application*1 installed on your computer. Normally, the telnet application is available on your computer. * The telnet 10000 port is used to control the projector. Control (For example, in case of using the telnet application of Windows XP Professional.) 1. Select Run... submenu from Start menu on the computer. Type "telnet" onto the Open text area on the displayed window and press OK button. (For example, in case of using the telnet application of Mac OS X v 10.4) 1. Select Terminal from Applications -->Utilities. Type as below on the displayed window. > telnet [return] 2. The telnet application will start and the following window will be displayed. Type as below to connect the projector. > open 192.168.1.201 10000 [return] * Use the IP address assigned to the projector. 46 Use of telnet 3. When communication is established correctly, the word "PASSWORD:" appears on the window. Type the login password (Network PIN code*2) for the projector and then press "Enter" key on the keyboard. If you do not set up the Network PIN code, just press "Enter" key. When the word "Hello" is replied, login has been succeeded. * The password "1234" is used for the example. 4. Type the commands, refer to below table, to control the projector and then press "Enter" key for termination. For example, type "C00" which is a command to turn on the projector, and press "Enter" key. Confirm the projector is turning on. * Enter with ASCII 64-byte capital characters and one-byte characters. To disconnect the communication, press "Ctrl" key and "]" key at the same time, type "close" and then press "Enter" key on the Keyboard. > close [return] The table below shows the typical command lists for controlling this projector and please consult your local dealer for further information of another commands. Command list table C00 C02 C09 C0A C0B C0C C1C C1D Function Power on Power off Volume up Volume down Audio Mute on Audio Mute off Menu display on menu display off *1 Further instructions about the telnet application, please see the on-line guide on your computer. *2 The password is a Network PIN code decided item "Network PIN code setting" (pp.14, 23). If the authentication of the entered password is failed 4 times continuously, the communication will be disconnected automatically. Please try again for the connection. If the password or any command is not entered for more than 30 seconds, the communication will be disconnected automatically. Please try again for the connection. ENGLISH Command 47 Chapter 5 Appendix Web browser setting This projector is designed to be set up and controlled from an Internet web browser. Depending on the preference settings of the web browser, some control functions may not be available. Please make sure that the following functions are set up properly in the web browser. Active Script/JavaScript enable There are some control items used with the JavaScript function in the setting pages. If the web browser is set not to use this JavaScript function, it may not control the projector properly. In this case, the warning message "Make sure JavaScript is ON." will be displayed on the top of the page. To enable the JavaScript, please see further instructions on the next page. Proxy setting In some cases, your web browser is set up to use the proxy server for the internet or intranet connection. In this case, when you install this projector into the local network, you should set up the proxy setting of web browser preference correctly. Especially when connecting the projector and computer with a UTP cross cable directly, or when the network does not provide the proxy server, make sure that "not use proxy server" is set up in your web browser preference. Please see item "Examples: OS/Browsers" in the next page for further setting up procedure. There are various ways to change your browser preferences depending on the version or applications. Please see the setting instructions on next page for example and also refer to on-line help of your web browser. 48 Web browser setting Examples: OS/Browsers Windows XP Professional Internet Explorer v.6.0 ActiveScript setting ENGLISH Select Internet Options from Tools menu on the web browser and then select Security tab and click Customize Level… button. On the security setting window, scroll down and find the Scripting item, make sure that "Enable" is selected in item Active Scripting. 49 Chapter 5 Appendix Proxy setting Select Internet Options from Tools menu on the web browser and then select Connection tab and click LAN Settings button. Properly set up your web browser's the proxy server settings according to the local area network environment to which the projector is connected. - Using proxy server To use an external internet connection from the local area network, check the item Use a proxy server and enter the proxy server address and port correctly in the proxy settings window. For further instruction please consult your network administrator. - Not using proxy server Uncheck the item Use a proxy server. If you connect the projector to the computer directly with UTP cross cable, this must be unchecked. To designate proxy settings that will not use the proxy server when accessing the projector installed in the local area network, enter the IP address or domain name here. 50 Web browser setting Netscape Navigator v.7.1 JavaScript Setting Select Preference from Edit menu on the web browser and then selec t the item Advanced/Scripts & Plugins in the Category column. Make sure that the Enable JavaScript for Navigator is checked. Proxy setting Select Preference from Edit menu on the web browser and then select the item Advanced/ Proxies in the Category column. Properly set up your web browser's the proxy server settings according to the local area network environment to which the projector is connected. - Using proxy server When you use an external internet connection from the local area network, select the item Manual proxy configuration. Enter the proxy server address and port number correctly on HTTP Proxy item. For further instruction please consult your network administrator. - Not using proxy server Selec t the item Direct connection to the Internet in the proxy setting window. To designate proxy settings that will not use the proxy server when accessing the projector installed in the local area network, enter the IP address or domain name here. ENGLISH If you connect the projector to the computer directly with UTP cross cable, this must be selected. 51 Chapter 5 Appendix MAC OS X v 10.4 Safari v.3.2.1 JavaScript enable setting Selec t Preferences... from Safari on the web browser and then select Security tab and check Enable JavaScript. Proxy setting 1 Open Preferences... from Safari menu on the web browser Safari. The preference menu appears. 2 Select Advanced icon and then click Proxies: Change Settings .... 3 Select Proxies tab and properly set up your web browser Safari's the proxy server settings according to the local area network environment to which the projector is connected. - Using proxy server To use an external internet connection from the local area network, check the items Web Proxy (HTTP) and Secure Web Proxy (HTTPS) of Select a proxy server to configure window and enter the proxy server address and port correctly in Web Proxy Server window. For further instruction please consult your network administrator. - Not using proxy server Uncheck the items Web Proxy (HTTP) and Secure Web Proxy (HTTPS) of Select a proxy server to configure. If you connect the projector to the computer directly with UTP cross cable, they must be unchecked. To designate proxy settings that will not use the proxy server when accessing the projector installed in the local area network, enter the IP address or domain name here. 52 Q&A Q&A Installation/Access Q Why doesn’t the setting page appear in my web browser? A Following causes are possible. Please check them. 1. The projector does not connect to the network. Check LED indicators status ( p.12). - Check the connection of LAN cable if the LINK Lamp does not light green. - Check the network configuration of the projector if the ACT Lamp does not blink orange. 2. Wrong network configuration of the computer. Check the network configuration of the computer. 3. The proxy setting of the web browser is not set correctly (p.50). 4. The computer does not provide TCP/IP protocol. Q How can I restrict access from the computer. A 1. Please use the password authentication function on the login page (p.23). 2. Please use the IP filtering function provided with the gateway (router) to restrict the accessing from the computer. For further information please consult your network administrator. Q Can I access the projector installed on the company’s local area network A There are some ways to access to the projector in the LAN, but you must consult your network administrator for security reason. Use of modem (Connect to the company’s network from your home or some other places by using modem.) Use of private line (Connect to the company’s network from the branch office or maintenance office by using private line.) Use of internet (Connect to the company’s network from your home, branch office or some other places by using the internet.) ENGLISH from a remote location? 53 Chapter 5 Appendix Q We use the DHCP/BOOTP server to assign the IP address. Is it possible to use the projector in this network environment? A Possible. This projector supports the DHCP/BOOTP server. To use this projector in this network environment, set it up so that the DHCP/BOOTP server does not assign the IP address configured to this projector for another device on the network. Please consult your network administrator ( pp.13, 24). Q How can I install several projectors? A Install and configure network one by one to avoid the IP address collision each other. To configure the IP address please see item "Network configuration" ( pp.12-13, 24). Password/Login Q What should I do when I forget the IP address of the projector? A You can check the IP address in the "Network information" menu. Q What should I do when I forget the password (Network PIN code)? A Please set the new network PIN code in the "Network PIN code" menu. Q Can I register the setting page as a web browser "Favorites" or "Bookmarks"? A 54 Please add "Login" page to your "Favorites" or "Bookmarks". Do not add the specified setting page because it will not be able to perform the password authentication correctly. Q&A Operation Q Why can't be turned on/off with web browser? A Please make sure the settings of the projector are correct to use the projector. Please set the Standby mode of the projector's Setting menu to "Normal". Refer to "4. Controlling the Projector" "Power control and status check" (pp.32 - 33). Q Why can't I change the controls in the setting page with web browser? A Please make sure the projector is turned on. If it is in the standby mode, the setting is not effective to the projector. To control the projector with a web browser, the projector must be in the powered-on condition. Q Why does it sometimes take a lot of time to complete the page display? A The display speed of the page depends on the network environment in which both the projector and computer are placed. It may take much time to complete the page display if network traffic is heavy. Please consult your network administrator. Q How many numbers of the E-mail address can I register in the E-mail setting page. A You can register up to 10 addresses. A Make sure that the registered E-mail address and SMTP server address are correct. If the SMTP server is located in your LAN (Local Area Network), the address should be set to the SMTP server in your LAN. The SMTP server located outside of your LAN may not be available for security reason. For further information please contact your network administrator (p.25). It may be required for the authentication depending on the SMTP server. This projector does not support this kind of SMTP server. ENGLISH Q Why am I not receiving E-mail alert messages? 55 Chapter 5 Appendix Others Q What are the rules for IP address assignment? A If the network is constructed with TCP/IP protocol, a unique IP address is required for each piece of network equipment. The following are basic rules of the assignment. Rule1 Do not configure the same IP address to the network equipment in the same network group. Each piece of equipment must be assigned a unique IP address. If the IP address is set [192.168.x.x], the Subnet Mask should be set [255.255.255.0] for example. Rule2 The start address [xxx.xxx.xxx.0] and the last address [xxx.xxx.xxx.255] of the IP address must not be assigned to any other equipment. These address numbers are reserved. Rule3 The IP address must correlate to a network number. If network numbers are different between the equipment, they cannot establish communications each other. In this case, the router is placed in the networks to make the routing. Q Can I control the projector by using the telnet application? A Possible. Please refer to the item "Use of telnet" (p.46 - 47). Q What is the MAC address assigned to the projector? A 56 The MAC address is displayed in "Network information" menu (p.14). Q&A Q Can I update the firmware of the projector. It is possible to update the firmware through the network. It is required to have a special tool for the updating. For further information please consult your local dealer. The version number of the firmware is indicated on the lower part of the "Initial setting" page. Version of the firmware ENGLISH A 57 NETWORK OWNER'S MANUAL SO-KR5AC SANYO Electric Co., Ltd. Owner's Manual PJ Network Manager for Windows This is the manual for the PJ Network Manager software. This software is Windows-compliant, but non-Mac-compliant. Read this manual thoroughly to operate the PJ Network Manager software. First, read the owner's manual of the projector to understand the basic operation of the projector and the safety instructions. The safety instructions in the owner's manuals should be followed strictly. SNMP Manager Software Contents Chapter 1 Introducing .......................................................... 3 Introducing......................................................................................................................................................3 SNMP ...................................................................................................................................................................3 Trademarks.......................................................................................................................................................3 Operating Environment...........................................................................................................................4 Chapter 2 Set up .................................................................... 5 PJ Network Manager installation........................................................................................................6 PJ Network Manager un-installation................................................................................................6 Chapter 3 Basic Operation................................................... 7 Launching and quitting PJ Network Manager...........................................................................8 Name of status window...........................................................................................................................8 Quitting PJ Network Manager..............................................................................................................9 Menu tree .........................................................................................................................................................9 What's Target ..................................................................................................................................................9 Name of the button on the tool bar.............................................................................................10 Icon display for the target....................................................................................................................10 Addition of the target ............................................................................................................................11 Editing the target......................................................................................................................................11 Deletion of the target.............................................................................................................................11 Setting up the warning value ...........................................................................................................12 Starting target monitoring..................................................................................................................12 When happens the alert on the target .......................................................................................13 When happens the trap event on the target..........................................................................13 What's Trap....................................................................................................................................................13 Stopping monitoring the target......................................................................................................14 Displaying all the status information of the target ..............................................................14 Setting the target group ......................................................................................................................14 Setting up the password of Telnet.................................................................................................15 Setting commands batch processing for multiple targets.............................................15 Setting timer for targets........................................................................................................................16 Setting up default setting....................................................................................................................17 Customizing the status list..................................................................................................................19 Viewing the alert information...........................................................................................................22 Viewing the event log............................................................................................................................23 Description of Event, Type, Warning column, Warning value ......................................24 About event treatment.........................................................................................................................26 Viewing the command history.........................................................................................................27 Storing the management file............................................................................................................28 Information saved to the registry ..................................................................................................28 Registering the target information from the defined file at once..............................29 Format of the defined file....................................................................................................................30 Example of the defined file.................................................................................................................30 Login to the target equipment ........................................................................................................31 2 Chapter 1 Introducing Introducing This PJ Network Manager is a SNMP manager software for the network equipment which supports the private MIB (Management Information Base). By installing the PJ Network Manager to the computer, you can monitor the equipment simply such as the projector, the projection monitor and the flat display monitor connected to the network. * The PJ Network Manager can handle our products which has a SNMP agent function. SNMP SNMP is an abbreviation for Simple Network Management Protocol. On the TCP/IP network, it is the protocol to monitor and control the equipment connected to the network. SNMP realizes the management function by reading and changing the management information called MIB with SNMP protocol between the manager (management equipment) and agent (controlled equipment) which are connected with TCP/IP network. PJ1 PJ4 PJ3 PJ2 Trap PC6 PC5 PC4 You received a trap. Trap SNMP Manager Trademarks Microsoft, Windows, Windows 2000, Windows XP, Windows Vista are registered trademarks of Microsoft Corporation. Macintosh is a registered trademark of Apple, Inc. in the USA and other countries. Other products or brand names in this manual are registered trademarks or trademarks of their respective owners. * Unauthorized use of a part or whole of the contents in this manual is prohibited. * The contents of this manual are subject to change without notice. PJ NETWORK MANAGER OWNER'S MANUAL 3 Chapter 1 Introducing Operating Environment Item Minimum Recommended CPU Pentium III 400MHz or higher Pentium 4 2.0GHz or higher for Windows XP Pentium 4 3.0GHz or higher for Windows Vista Memory 128MB or higher 256MB or higher for Windows XP 1GB or higher for Windows Vista HDD More than 20MB of free disk space Screen resolution SVGA (16 colors or more) XGA True color or more LAN 10Mbps or more 100Mbps or more OS Windows 2000 Windows XP Windows XP Professional Windows Vista (32bit version) Limited condition The number of agents monitored is up to 200. Expression/Abbreviation The OS of the computer and the Web browser described in this manual is Windows XP Professional and Internet Explorer 6.0. In case of another OS or Web browser, some instruction procedures may differ from the actual operation depending on your computer environment. Use of this manual This manual does not provide the description of basic operation and functions for computer, web browser, projector and network. For instructions about each piece of equipment or application software, please refer to the respective manual. 4 Chapter 2 Set up 2 PJ NETWORK MANAGER OWNER'S MANUAL 5 Chapter 2 Set up PJ Network Manager installation 1 Set the supplied CD-ROM into the CD-ROM drive of your computer. Double click SetupTool. exe icon in the "PJ Network Manager" folder in the CD-ROM. 2 Select "[English [United States]" from the pull- down menu on the "Choose Setup Language" window and click OK button to start installing and then follow the installation wizards. As the "Software License Agreement" will appear, read contents carefully and click Yes button if you agree with the license agreement to proceed with installing. Note: To install the software into the computer with Windows 2000, Windows XP or Windows Vista you should logon as administrator. Before installation, make sure that the other applications are closed, otherwise proper installation cannot be made. PJ Network Manager un-installation To remove the PJ Network Manager software from your computer, perform it with "Add & Remove Programs" on the control panel. 6 Chapter 3 Basic Operation 3 PJ NETWORK MANAGER OWNER'S MANUAL 7 Chapter 3 Basic Operation Launching and quitting PJ Network Manager To launch PJ Network Manager, take one of the following. - Select "PJ Network Manager" from the menu "Start" - "All programs". - Double click a management file*1. Name of status window Tool bar Menu Status column Target Polling times indication Status bar Event indication Status list * With double clicking the target name, the web browser is launching and displays login window of the target.(p.31) Items Description Menu..................................... Executes a command with menu selection Tool bar ............................... Executes a command assigned to a button. Target ................................... Network equipment for monitoring. Status bar........................... Indicates the status of PJ Network Manager and explaining the command selected with cursor. Status list............................ Indicates the status of targets monitoring. When some errors are detected, the target name, icon and error items are indicated with red. Status column ................ Column of status list. Polling times indication......... Indicates the times of polling during the monitoring. Event indication............ Indicates the event (ALERT, TRAP, SYSERR) when the event happened. *1 The file in which the Monitor target information and event log information are stored. Refer to item "Storing the management file" (p.28) for further details. 8 Quitting PJ Network Manager [Note] * The PJ Network Manager cannot open multiple status windows at the same time. Quitting PJ Network Manager To quit the PJ Network Manager, click the close box on top right of the status window, or select "Exit" from the "File" menu Menu tree Menu Sub menu Operation File New Open Save Save As Exit Creates a new management file. Opens an existing management file. Saves the active management file. Saves the active management file with a new file name. Quits the application. Target Target monitoring Target addition Target editing Target deletion Group setting Warning value setting Telnet setting Commands batch processing Timer setting Starts or stops target monitoring. Adds a new target. Target information window will appear. Edits selected target information. Deletes the selected target. Groups the selected targets. Sets up the warning value of the selected target. Sets up the password of telnet. Sets commands batch processing for multiple selected targets. Sets up the timer for the selected target. System Target batch registration System default setting Column selection Font setting Imports target information defined with the external file. Sets up the default setting (monitoring information, e-mail information). Selects display items on the status list. Sets up display font type and size on the status list. Display Update Target display Alert display Event log display Command history display Tool bar Updates the information on the status list display. Displays selected target information. Displays all of alert information on the status list. Displays all the event logs. Displays all of command history. Switches tool bar on or off. Help Version information Displays version of software. What's Target Target indicates the network equipment which provides an SNMP agent function . PJ NETWORK MANAGER OWNER'S MANUAL 9 Chapter 3 Basic Operation Name of the button on the tool bar The following commands are assigned to the buttons on the tool bar. New Save Open Button Target display Target monitoring Start/Stop Event log display Alert display Command history display Operation New.................................................. Creates a new management file. Open ............................................... Opens an existing management file. Save ................................................. Saves the active management file. Target monitoring................. Starts or stops target monitoring. Target display ........................... Displays selected target information. Alert display............................... Displays all of alert information on the status list. Event log display.................... Displays all the event logs. Command history display .. Displays all of the command history. To switch the tool bar display on or off, select "Tool bar" from "Display" menu. Icon display for the target Displays icon according to the target condition. Icon Condition Flat display type Projector type Normal Abnormal condition (One of the abnormalities, Alert, Trap or System error is happening on the target.) Connection error (Target has been disconnected from the network) Acquisition error (Target has been disconnected from the network, or does not provide SNMP function.) Unknown (Target monitoring is not operating) 10 Addition of the target Addition of the target 1 Select Target Addition from Target menu. The target information registering window appears. Items Description Name ......................... Enter a management name of the target equipment. IP address ............... Enter IP address of the target equipment. Community ........... Enter a community name in the network. Default name is "public". System information..... Displays information set on the network equipment 2 Enter target setup information and click Update button. The information set on the target equipment are displayed on the system information items. When the target equipment is not operating, or it is not the monitoring equipment, the error dialog "Cannot obtain information" will appear. 3 Click OK to close the window. Repeat the above steps to register for other equipment which is to be managed. Editing the target 1 Select a target name to edit on the status list with right click. 2 Select Target editing on the popup menu. The target information window will appear and edit the contents, then click OK button. The system information cannot be edited. Target editing can be executed by selecting Target editing from Target menu. Deletion of the target 1 Select a target name to delete on the status list with right click. 2 Select Target deletion on the popup menu. The confirmation dialog will appear and click Yes button to execute deleting. Target deletion can be executed by selecting Target deletion from Target menu. It cannot perform the target addition, editing and deletion during the target monitoring. Up to 200 targets can be registered. Up to 255 characters can be used for target name and community. PJ NETWORK MANAGER OWNER'S MANUAL 11 Chapter 3 Basic Operation Setting up the warning value PJ Network Manager provides a function to display the alert when the use time of the setting item reaches a specified setting time. The available setting items (use time) are depending on the target equipment. 1 Select a target on the status list with right click. When setting multiple targets together, select targets with pressing "Shift" or "Control" key. 2 Select Warning value setting on the popup menu. The setting window will appear as the right figure. 3 Check Warning time check box. The setting items are activated. Select a setting item and click Edit button. Another setting window appears. 4 Enter the threshold value of selected item and then click OK button. The setting window will disappear. 5 Set up warning value for remaining items if available and then click OK button. The setting window will disappear. (Example of the set up window) To disable the warning value, clear Warning time check box. When selecting multiple targets, the value set to the lowest target on the status list is displayed as the current setting time. Up to 99,999 hours can be set for the use time. The warning value is stored in the management file. Starting target monitoring 1 Click button on the tool bar to start monitoring the target. 2 PJ Network Manager starts polling the target in a sequential from the top of the status list and displays the results on the status list. 12 When happens the alert on the target When happens the alert on the target If the abnormality or connection error happens on the target, PJ Network Manager indicates target name, icon and status column item with red color to let you know the abnormality. When PJ Network Manager cannot acquire the MIB information of the target equipment, it indicates as Connection Error. The interval of target monitoring is according to the setting of Monitoring interval on System default setting from System menu. (p.17) When happens the trap event on the target During the target monitoring, if the predefined event (trap) happens on the target equipment, the target sends the trap information to PJ Network Manager. This trap information is displayed on the status list immediately. The notification of the trap information is set up in the SNMP setting items of the target equipment. Projector has items such as "When PJ lamp is off", "When the life span of lamp is reached", "When internal PJ power circuit is failed" etc. For further trap information, refer to SNMP trap information in the separated network owner's manual. What's Trap Trap is the event predefined by the SNMP agent. If the predefined event ( "When PJ lamp is off", "When internal PJ power circuit is failed" etc. ) happens, target sends trap information to the SNMP manager. PJ NETWORK MANAGER OWNER'S MANUAL 13 Chapter 3 Basic Operation Stopping monitoring the target To stop monitoring the target, click button again on the tool bar. Displaying all the status information of the target Select a target and click button on the tool bar. The following status window appears and displays all the available status information of the target. The target name and item which have an abnormality or connection error happening are indicated with red. When PJ Network Manager cannot acquire the value of column information, "---" is displayed. The above procedure can perform by selecting Target display from Display menu. Setting the target group The target group can be set up by the procedure below. When you set a command in the same group, you set it. 1 Select targets which you want to set from the status list. Select Group setting from Target menu, the dialog box will appear as the below figure. 2 Select a group, and then click OK button. "---" will not set the group. The projectors setting different network passwords cannot be set to the same group. It is 14 necessary for the projectors in the same group to set to the same password. Setting up the password of Telnet Setting up the password of Telnet The password of telnet can be set up by the procedure below. It is necessary to make a password, same as the network password. 1 Select a target which you want to set up the password of telnet from the status list. You can select multiple targets. 2 Select Telnet setting from Target menu, Telnet setting dialog box will appear as the below figure. Set a password and click OK button. When multiple targets are selected, all the selected targets are set as the same password. The initial setting is "0000". Setting commands batch processing for multiple targets The commands batch processing for multiple targets can be set up by the procedure below. 1 Select a target belonging to the batch processing group which you want to set, and select Commands batch processing from Target menu. Commands batch processing dialog box will appear as the below figure. 2 Select a command which you want to set, click Edit button. Parameter editing dialog box will appear. Select a parameter, and then click OK button. The check box of Commands batch processing dialog box will be checked. 3 Click OK button. The commands are carried out to all the targets of the same group. The commands also work for the target which is not set to a group. PJ NETWORK MANAGER OWNER'S MANUAL 15 Chapter 3 Basic Operation Commands batch processing : Available Command Items Description Power ON/OFF .........................Sets up the Power ON or Power OFF. Input,Source .............................. Sets up the Input and Source. Selects Input and Source. Screen.......................................Sets up the screen size. Resizes the picture screen. Background ............................... Sets up the background. Selects the background screen for when no input signal is detected. Display ........................................ Sets up the Display. Decides whether to display On-Screen Displays or not. Shutter(No show) .................... Sets up the Shutter (No show). Sets black out the image. Lamp control ............................. Sets up the Lamp control. Changes brightness of the screen. Fan control ................................. Sets up the Fan control. Chooses the running speed of cooling fans. Setting timer for targets The timer information for targets can be set up by the procedure below. 1 Choose a target which you want to set the timer. 2 Select Timer setting from Target menu. Timer selection dialog box will appear as the below figure. Check in a check box of an event to carry out. 3 When you want to add events, click Add button. Input timer informations in Timer setting dialog box, and click OK button. 4 Click OK button of Timer selection dialog box, timers are set to the selected target. When selecting multiple targets, timers are set to all the selected targets. Timer Items Description Execution date.........................Sets up the Timer execution date. (everyday or a day) Execution time.......................... Sets up the Timer execution time. (hh:mm:ss) Action .......................................Sets up the events. 16 Setting up default setting Setting up default setting The monitoring information and e-mail information can be set up by the procedure below. 1 Select System default setting from System menu. The setting window will appear. 2 Switch by clicking Monitoring information or E-mail information tab for each setting. Monitoring information Monitoring information Items Description Monitoring interval ................Sets up the interval of the polling in minute unit. (1 to 99 minutes can be set) Temperature unit ..................... Sets up the display temperature unit Centigrade or Fahrenheit. Event reception process..........Sets up the treatment when the event (ALERT, TRAP, SYSERR) happens on the target. For further information, refer to the item "About event treatment" (p.26). P Sound warning alarm P Send e-mail P Display warning dialog PJ NETWORK MANAGER OWNER'S MANUAL 17 Chapter 3 Basic Operation E-mail information E-mail information Items Description SMTP server .....................Sets up the IP address of SMTP mail server or server host name. Administrator's mail address...................... Sets up the e-mail address of administrator Destination mail address................................Sets up the destination mail address when the event (ALERT, TRAP, SYSERR) happens on the target. The mail address entering window appears when clicking Add button. If Send e-mail check box of Event reception process on Monitoring information is un-checked, the alert e-mail will not be sent even if you set up the e-mail address. Up to 10 addresses can be set up for the destination mail address. 18 For the contents of the mail, refer to item "About event treatment" (p.26). Customizing the status list Customizing the status list Changing the status column indication 1 Select Column selection from System menu. The column selection window will appear. 2 On the window, check the column name to be indicated on the status list. The mark [*] next to the column name indicates alert item. 3 To change the order of the display column on the status list, select a column you intend to change the order and click To up or To down button. 4 Click OK to close setting. Specifies column width When specifying the column width by numeric value, enter number (0 to 9999) onto "Column width" text box. Column Description *Target name ............................Name of the network equipment *Group...........................................Group name *Connect......................................Status of connection to the network (Connected, Un-connected) *Drive time .................................Accumulated use time of the equipment *Power status............................Power status of the equipment (Normal(Power-on), Normal(Standby), Power Management, Power failure, lamp failure, etc.) *Input status..............................Input signal status (Signal, No signal, Signal interrupted) *Inside Temperature A status....................................Status of inside temperature A (Normal, Warning, Error) *Inside Temperature B status ....................................Status of inside temperature B (Normal, Warning, Error) *Inside Temperature C status....................................Status of inside temperature C (Normal, Error) *External Temperature status.........................................Status of external temperature (Normal, Warning, Error) *Lamp1 status ..........................Status of Lamp1 (Off, On, Error, Replace) *Lamp2 status ..........................Status of Lamp2 (Off, On, Error, Replace) *Lamp3 status ..........................Status of Lamp3 (Off, On, Error, Replace) *Lamp4 status ..........................Status of Lamp4 (Off, On, Error, Replace) *Lamp1 time..............................Used time of Lamp1 *Lamp2 time..............................Used time of Lamp2 *Lamp3 time..............................Used time of Lamp3 *Lamp4 time..............................Used time of Lamp4 *Filter status...............................Status of airfilter (Normal, Clogged) *Option Box filter status ............................Status of option box filter (Normal, Error, Clogged) *Filter time..................................Use time of airfilter *Option Box filter time................................Use time of option box filter The values in parentheses are typical value and they differ depending on the connected equipment. The [*] next to the column name indicates alert items. PJ NETWORK MANAGER OWNER'S MANUAL 19 Chapter 3 Basic Operation Column Description *Error info....................................Error information (Not available for the projector) IP address ....................................IP address of the network equipment Community ................................Community name of the network equipment (public) Introduction date*1...............Date of the network equipment installed Timer...............................................Timer information Product info...............................Name of the network equipment System name ............................System name of the network equipment (Proj_05) Contact..........................................Contact information of the network equipment Location........................................Installed location of the network equipment Input signal ................................Information of the input mode (Input1, Input2, etc.) Input select ................................Information of the input source (RGB, VIDEO, S-VIDEO, NETWORK, etc.) Network status.........................Condition of the network mode (Off line, Network Viewer, Network Capture) Audio system ............................Displays audio system mode (NORMAL, PERSONAL, MUSIC, TALK) Volume ..........................................Sound Volume of the network equipment Treble..............................................Sound treble of the network equipment Bass..................................................Sound bass of the network equipment Balance..........................................Sound balance of the network equipment Mute................................................Sound mute status of the network equipment (ON, OFF) Power management............Power management status of the network equipment (OFF, READY, SHUTDOWN) Monitor out................................Monitor out status of the network equipment (ON, OFF) Shutter...........................................Shutter status of the network equipment (OFF, High-Contrast, Normal) Shutter management .........Shutter management status of the network equipment (Shutdown) Fan control..................................Fan control status of the network equipment (Normal, Maximum, OFF, On1, etc. ) Inside Temperature A..........Displays inside temperature A of the equipment (in Centigrade or Fahrenheit) Inside Temperature B ..........Displays inside temperature B of the equipment (in Centigrade or Fahrenheit) Inside Temperature C..........Displays inside temperature C of the equipment (in Centigrade or Fahrenheit) External Temperature .........Displays external temperature of the equipment (in Centigrade or Fahrenheit) Lamp mode................................Displays lamp mode (1: 1-lamp mode, 2: 2-lamp mode, 4: 4-lamp mode, etc.) Lamp control.............................Displays lamp control mode (Auto, Normal, Eco, etc.) Model name ..............................Model name of the network equipment *1 Set up the installed date when the PJ Network Manager is newly introduced. There are some un-available columns depending on the products. The value of un-available column is displayed in blank or with "---". 20 Customizing the status list To change order or width of the column Drag the status column name you want to change the order and move it on a new place and drop it. To change column width, set a mouse cursor onto the right edge of the column to change, drag the mouse on it and adjust the column width. Sorting the status list The order of the targets on the status list can be changed by clicking the column name which you want to sort. It switches ascending or descending order by clicking the column name each time. Sort by clicking Drag to move column Drag to change column width Changing font Select Font setting from System menu. The font setup window will appear. Select your desired type face, style and size on the window. Customized font property is applied to all the windows of the setting. PJ NETWORK MANAGER OWNER'S MANUAL 21 Chapter 3 Basic Operation Viewing the alert information 1 Click button on the tool bar. The alert display window appears and the alert information of all the targets which are having an alert is listed on this window as the below. 2 To export the alert information as text file (CSV file), click Export button. Column width can be changed with dragging the right edge of the column. The column order can be changed with drag and drop the column. Column can not be deleted. 22 Viewing the event log Viewing the event log 1 Click button on the tool bar. The event log display window appears and the events which have been happened on the targets are listed on this window as the below. 2 To export these events as text file (CSV file), click Export button. 3 To delete the event log, select the accrual date item you intend to delete by clicking and then click Delete button. On the confirmation dialog, click Yes to execute deletion. Event log information items Items Description Accrual date ......... Accrual date of the event Target name......... Name of the network equipment IP address............... IP address of the network equipment Event ......................... Type of the Event (ALERT, TRAP, SYSERR ) (See table on the next page) Type ........................... Type of the Event (See table on the next page) Warning column.......... Warning column of the Event (See table on the next page) Warning value .... Warning value of the Event (See table on the next page) Unit............................. Displays unit of the warning value. The listed items are fixed. The order of the event log list can be changed temporarily by clicking the column name which you want to sort. It switches ascending or descending order by clicking the column name each time. Column width can be changed by dragging the right edge of the column. The column order can be changed with drag and drop the column. Column cannot be deleted. PJ NETWORK MANAGER OWNER'S MANUAL 23 Chapter 3 Basic Operation Description of Event, Type, Warning column, Warning value Event ALERT Type ON : Abnormality has happened OFF : Abnormality has been cleared Warning Column Warning Value Connect Un-connected Connected Acquisition error Power status PowerFailure TemperatureError Normal (AfterTempError) RS232CFailure Power management Shutter management LampFailure Input status SignalsInterrupted SignalsInputted Description Inside Temperature status (A to C) Abnormal External Temperature status Failure Lamp status (1 to 4) Replace Lamp time (1 to 4) Filter time LampFailure LampReplace TRAP (setting time) Failure * Refer to the next page Replace Normal(Standby) Normal(OnCoolingDown) PowerFailure Power management PowerOFF PowreFailure PowerManagement Power status TemperatureError Inside Temperature status (A to C) Abnormal External Temperature status SignalIsInterrupted Input status SignalIsInterrupted LampReplacementTime Lamp time (1-4) (lamp time) FilterReplacementTime Filter time (filter time) AutoPlayError n/a Error n/a *1 n/a *1 Transfer SYSERR *Mail *MemoryError 24 Lamp status (1 to 4) (setting time) *1 When PJ Network Manager could not send mail or acquire the memory, no message is displayed in "Warning column" and "Warning value". For further details of each warning column and value, refer to the next page. Description of Event, Type, Warning column, Warning value Description of warning value Warning Column Warning Value Description Connect Un-connected Connected * Acquisition error Power status Power failure TemperatureError Normal (AfterTempError) RS232CFailure Power management LampFailure Normal(Standby) * Normal(OnCoolingDown) * Projector has been disconnected from the network Projector has been connected to the network PJ Network Manager could not acquire the MIB information from the equipment Projector turned off due to the power failure of the projector The projector turned off due to temperature error occurred Normal after temperature error occurred The RS-232C communication error occurred The power management function turned projector lamp off The lamp failure occurred Projector turned into standby normally On cooling down normally due to projector turned off Input signal status SignalsInterrupted SignalsInputted * The signal was interrupted The signal was inputted again Inside Temperature status (A to C] Abnormal External Temperature status Lamp status ON * Failure Replace Lamp time Filter time (Auto play error) (lamp time) (filter time) Error The projector turned off when the temperature was abnormally high When the lamp is on When the lamp failed to ignite. It reached lamp replacing time. It reached user setting lamp replacing time It reached user setting filter time The error occurred during the auto image display The warning value with "*" in the above table shows the event when the alert has cleared, alert type is "OFF". The column order and width of the event log window are saved to the registry of the computer. Up to 1000 of events can be stored. If it exceeds 1000 events, the oldest event is deleted and the latest event is added. The event log can be saved to the management file. This Warning column is not available for some projector's model types. PJ NETWORK MANAGER OWNER'S MANUAL 25 Chapter 3 Basic Operation About event treatment If the PJ Network Manager receives an event, it executes following event treatment items which are selected in the system default setting. P Sound warning alarm P Send e-mail P Display warning dialog Sound warning alarm If the PJ Network Manager receives an event, the computer beeps an alarm sound. The alarm sound is depending on your computer sound setting. The alarm sound is not made when your computer does not provide any speaker or the sound volume is muted. Send e-mail Following example message is sent to the e-mail address you set up as the destination mail address. From: Test1<[email protected]> (management file name) Date : 2004/10/29 21:30 To : [email protected] Subject : Alert message ---------------------------------------------------------Alert has occurred * Accrual date : 2004/10/29 21:13:42 * Target name : Proj_10 * IP address : 192.168.1.101 * Event : ALERT * Type : ON * Warning column : Power status * Warning value : Power failure For the further information of event, type, warning column and warning value, see the item "Viewing the event log" (p.23). The setting of event treatment, refer to item "Setting up default setting" (p.17). Notes on using Windows XP Service Pack 2 (SP2) / Windows Vista Windows Firewall is turned on by default in Windows XP SP2 and Windows Vista. Due to this Windows Firewall, the send e-mail function is not available. When using this mail function, you need to cancel the block for PJ Network Manager application. For the further details of Windows Firewall, see Windows help on your computer. 26 About event treatment Display warning dialog Following dialog window appears on the screen if event occurs. Viewing the command history 1 Click button on the tool bar. Command history window appears and the command history is listed on the window as shown below. 2 To export the command history as text file (CSV file), click Export button. 3 To delete the command history, select the item of Executed date/time which you want to delete, and then click Delete button. On the confirmation dialog box, click Yes button to execute deletion. Command history Items Description Executed date/time .... Exrcuted date and time of the command Target name......... Name of the network equipment IP address............... IP address of the network equipment Command.............. Type of the Command Detailed data....... Contents of the Command Result ........................ Results of the Command The listed items are fixed. Column width can be changed by dragging the right edge of the column. The column order can be changed with drag and drop the column. Column cannot be deleted. Up to 1000 of events can be stored. If it exceeds 1000 events, the oldest event is deleted and the latest event is added. PJ NETWORK MANAGER OWNER'S MANUAL 27 Chapter 3 Basic Operation Storing the management file When you monitor the network equipment with the PJ Network Manager, you can save the registered target information, system setting and event log information into the management file with a free file name. It is useful if you manage multiple equipment in the network. Click button on the tool bar and save it with free file name. The extension is ".pnm". The management file contains following information. Items Description Header .................................................Management file section, file version System default setting .............Default value of the system setting - Monitoring interval - Event reception process - Temperature unit - E-mail information Target information.....................Information of the registered target - Target information (target name, IP address, Community, Introduction date) - target MIB information - Warning value set up Event log information...............Event log information (ALERT, TRAP, SYSERR) The maximum volume of a management file is required about 1MB. (Number of registrable targets is 200, number of events is 1000) Information saved to the registry Following application setting information is saved to the registry of your computer. So the setting condition is memorized even after quitting the application. Items Description Status window information................. Display position and size of the status list window Status list information ............ Display status column, column width and column order Event log list information..... Column width and order of the event log list Font set up...................................... Font setting value (Type face, size and style) 28 Registering the target information from the defined file at once Registering the target information from the defined file at once The PJ Network Manager provides a function to import the target information from the defined file at once. Prepare the defined file (CSV data format) in which the target information is written along the format shown below. 1 Select Target batch registration from System menu. The target batch registration window appears. 2 Click Reference button and select a defined file to import the target information. The imported target information will be listed on the target batch registration window. * If there is an error in the imported defined file, the error information will be indicated on the Result column. Retry importing after correcting the defined file. 3 Click OK button to execute the registration. Target batch registration is not available during Target monitoring. PJ NETWORK MANAGER OWNER'S MANUAL 29 Chapter 3 Basic Operation Format of the defined file The defined file is a CSV data file created by the spreadsheet application and is defined as follows; Column Description (example) Target name.......... Name of target equipment (Proj_01, Proj_03, PDP_01, etc.) IP address ............... IP address (192.168.0.1, etc.) Community ........... Name of SNMP community. Default value of our network products is "public" Example of the defined file The table below shows the example of the defined file provided with the target information. Save this file as the CSV file. Target name 30 IP address Community Proj_01 192.168.0.1 public Proj_02 192.168.0.2 public Proj_03 192.168.0.3 public Proj_04 192.168.0.6 public Proj_05 192.168.0.7 public PDP_01 192.168.0.8 public FPD_10 192.168.0.9 public Login to the target equipment Login to the target equipment After double clicking the target name on the status list, the computer launches web browser and displays the login window of the target equipment. You can control and set up the projector remotely by using the web browser. For the further information of instruction, see the separated network owner's manual. Login by double clicking An example of the login page. PJ NETWORK MANAGER OWNER'S MANUAL 31 PM-KF5AC PJ NETWORK MANAGER OWNER'S MANUAL FOR WINDOWS SANYO Electric Co., Ltd.