Download Astria MontebelloDLX45TEP Specifications
Transcript
INSTALLATION INSTRUCTIONS Montebello DLX 40 and 45 in. Direct Vent Gas Fireplaces Intertek Report No. 100513650 P/N 506023-22 Rev. NC 12/2013 This manual is one of a set of two supporting this product. Refer to P/N 506025-14 for Care and Operation Instructions. Ce manuel est disponible en francais, simplement en faire la demande. Numéro de la pièce 506023-23. INSTALLER: Leave this manual with the appliance. CONSUMER: Retain this manual for future reference. INSTALLATEUR : Laissez cette notice avec l'appareil. CONSOMMATEUR : Conservez cette notice pour consultation ultérieure. MODELS MontebelloDLX40TEN MontebelloDLX40TEP MontebelloDLXCD40TEN MontebelloDLXCD40TEP MontebelloDLX45TEN MontebelloDLX45TEP MontebelloDLXCD45TEN MontebelloDLXCD45TEP Decorative Product: Not for use as a heating appliance. NOTICE: Fireplace is not to be operated by a thermostat. This appliance may be installed in an aftermarket permanently located, manufactured home (USA only) or mobile home, where not prohibited by local codes. This appliance is only for use with the type of gas indicated on the rating plate. This appliance is not convertible for use with other gases unless a certified kit is used. WARNING / AVERTISSEMENT/ AVISO HOT GLASS WILL CAUSE BURNS. DO NOT TOUCH GLASS UNTIL COOLED NEVER ALLOW CHILDREN TO TOUCH GLASS. UNE SURFACE VITRÉE CHAUDE PEUT CAUSER DES BRÛLURES. LAISSER REFROIDIR LA SURFACE VITRÉE AVANT D'Y TOUCHER. NE PERMETTEZ JAMAIS À UN ENFANT DE TOUCHER LA SURFACE VITRÉE. WARNING: If the information in these instructions is not followed exactly, a fire or explosion may result, causing property damage, personal injury, or death. - Do not store or use gasoline or other flammable vapors and liquids in the vicinity of this or any other appliance. - WHAT TO DO IF YOU SMELL GAS: s$ONOTTry to light any appliance. s$ONOTTOUCHANYELECTRICALSWITCHDONOTUSEANY phone in your building. s)MMEDIATELYCALLYOURGASSUPPLIERFROMA neighbor’s phone. Follow the gas supplier’s instructions. s)FYOUCANNOTREACHYOURGASSUPPLIERCALLTHEFIRE department. - Installation and service must be performed by a qualified installer, service agency or the gas supplier. EL VIDRIO CALIENTE CAUSARÁ QUEMADURAS. USTED DEBE NUNCA TOCAR EL VIDRIO CALIENTE. LOS NIÑOS DEBEN NUNCA TOCAR EL VIDRIO. AVERTISSEMENT : Assurez-vous de bien suivre les instructions données dans cette notice pour réduire au minimum le risque d’incindie ou d’explosion ou pour éviter tout dommage matériel, toute blessure ou la mort. - Ne pas entreposer ni utilizer d’essence ni d’autres vapeurs ou liquides inflammables dans le voisinage de cet appareil ou de tout autre appareil. - QUE FAIRE SI VOUS SENTEZ UNE ODEUR DE GAZ : s.EPASTENTERDALLUMERDAPPAREIL s.ETOUCHEZÜAUCANINTERRUPTEUr. Ne pas vous servir des téléphones se trouvant dans le bâtiment où vous trouvez. s!PPELEZIMM£DIATEMENTVOTREFOURNISSEURDEGAZDEPUIS un voisin. Suivez les instructions du fournisseur. s3IVOUSNEPOUVEZREJOINDRELEFOURNISSEURDEGAZ appelez le service des incindies. - L’installation et l’entretien doivent être assurés par un installateur ou un service d’entretien qualifié ou par le fournisseur de gaz. )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 TABLE OF CONTENTS 0ACKAGING . . . . . . . . . . . . . . . . . . . . . . . . . 2 Introduction . . . . . . . . . . . . . . . . . . . . . . . . 2 'ENERAL)NFORMATION . . . . . . . . . . . . . . . . . . -ASSACHUSETTS2EQUIREMENTS . . . . . . . . . . 4 Cold Climate Insulation . . . . . . . . . . . . . . . 5 -ANUFACTURED(OME2EQUIREMENTS . . . . . . 5 ,OCATION. . . . . . . . . . . . . . . . . . . . . . . . . . . 5 Vent Termination Clearances . . . . . . . . . . . 6 -INIMUM#LEARANCESTO#OMBUSTIBLES . . . . . Detailed Installation Steps . . . . . . . . . . . . . 4YPICAL)NSTALLATION3EQUENCE . . . . . . . . . . 3TEP &RAMING . . . . . . . . . . . . . . . . . . . . &IREPLACEAND&RAMING3PECIlCATIONS . . . . . . 10 3TEP 2OUTING'AS,INE . . . . . . . . . . . . . 11 0ROPER3IZINGOF'AS,INE. . . . . . . . . . . . . . 11 3TEP )NSTALLTHE6ENT3YSTEM . . . . . . . . 12 Vertical Termination Systems . . . . . . . . . . . 6ENT3ECTION,ENGTH#HART . . . . . . . . . . . . . 6ERTICAL6ENT4ABLESAND&IGURES. . . . . . . . . 16 Horizontal Termination System . . . . . . . . . (ORIZONTAL6ENT4ABLESAND&IGURES . . . . . . 3TEP &IELD7IRING . . . . . . . . . . . . . . . . . 21 3TEP 2EMOVING'LASS$OOR &RAME!SSEMBLY . . . . . . . . . . . . . . . . . . 3TEP #ONNECTING'AS,INE . . . . . . . . . . 3TEP #HECKING!PPLIANCE Operation . . . . . . . . . . . . . . . . . . . . . . . . 3TEP )NSTALLING,OGSAND0ANELS . . . . . . 24 3TEP )NSTALLING'LASS$OOR . . . . . . . . . . 26 3TEP "URNER!DJUSTMENTS . . . . . . . . . . . 26 &INISHING2EQUIREMENTS . . . . . . . . . . . . . . . Step 11. Attaching Safety-in/PERATION7ARNINGS . . . . . . . . . . . . . . . . Installation Accessories . . . . . . . . . . . . . . . 'AS#ONVERSION+ITS . . . . . . . . . . . . . . . . . . Please read and understand these instructions before beginning your installation. 2 PACKAGING INTRODUCTION 4HEASSEMBLEDlREPLACEISPACKAGEDWITHTHE following: The Signature Series direct-vent, sealedCOMBUSTIONGASlREPLACESOPERATEONNATURAL or propane gas. These appliances feature a remotely controlled electronic intermittent pilot IGNITIONSYSTEMMANUALADJUSTMENTOFTHEGAS VALVESETTINGSISNOTPOSSIBLE s Literature Kit PLASTIC BAG SHIPPED INSIDE lREBOX CONTAINING Care and Operation Instructions, Installation Instructions THIS MANUAL 3AFETYIN/PERATION 7ARNING ,ABELSAND7ARRANTY s /NEBAGGlowing Embers s /NEBAGPlatinum Embers s /NEBAGVolcanic Stone s Pull Screen Kit s Remote Control and Wall Receiver Switch Kit s Door Modesty Shield s Log Grate NOTE: For use with fireplace as shipped from factory only. Not for use with Contemporary Burner/ Floor Kit. REQUIRED ACCESSORIES One of the following Firebox Liner Kits: a. Ceramic Firebox Liner Kit– Buff Rustic B Ceramic Firebox Liner Kit– Red Rustic c. Porcelain Firebox Liner Kit– Black d. Ceramic Firebox Liner Kit– Red Herringbone e. Ceramic Firebox Liner Kit– Buff Herringbone NOTE: Porcelain kits include side and back panels. Optional for use with log sets. Required when using the contemporary burner/floor kit. 4HE3IGNATURE3ERIESISADECORATIVElREPLACE ANDMAYNOTBEINSTALLEDANDOPERATEDASTHE primary heat source in a dwelling. %LECTRICALPOWER120 VACLINEVOLTAGEISRECOMMENDEDTOOPERATETHElREPLACEHOWEVER FOUR!!BATTERIESCANBEUSEDFORFULLTIME OPERATION OR AS A BACKUP IN CASE OF A POWER outage. Approved Vent Components 4HESE lREPLACES ARE DESIGNED TESTED AND listed for operation and installation with Secure Vent®DIRECTVENTSYSTEMCOMPONENTSINNER OUTERMANUFACTUREDBY3ECURITY#HIMNEYS International. These approved vent system components ARE LABELED FOR IDENTIlCATION USE ONLY APPROVED VENT COMPONENTS. Do NOT use any other manufacturer’s vent components with these appliances. Codes and Standards These appliances comply with National Safety 3TANDARDSANDARETESTEDANDLISTEDBY)NTERTEK 2EPORT.OTO:IN#ANADA #3! AND #!.#'!- IN BOTH 53!AND#ANADAASVENTEDGASlREPLACES These appliances are listed by Intertek for installation in bedrooms and mobile homes. Installation must conform to local codes. In THEABSENCEOFLOCALCODESINSTALLATIONMUST COMPLY WITH THE CURRENT .ATIONAL &UEL 'AS #ODE !.3) : IN #ANADA THE CURRENT #!.#'!"INSTALLATIONCODE 4HEAPPLIANCEWHENINSTALLEDMUSTBEELECTRIcally grounded in accordance with local codes OR IN THE ABSENCE OF LOCAL CODES WITH THE .ATIONAL%LECTRICAL#ODE!.3).&0!LATEST EDITIONORTHE#ANADIAN%LECTRICAL#ODE#3! #LATESTEDITION )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 GENERAL INFORMATION WARNING Young children should be carefully supervised when they are in the same room as the appliance. Toddlers, young children and others may be susceptible to accidental contact burns. A physical barrier is recommended if there are at risk individuals in the house. To restrict access to a fireplace or stove, install an adjustable safety gate to keep toddlers, young children and other at risk individuals out of the room and away from hot surfaces. AVERTISSEMENT Les jeunes enfants devraient être surveillés étroitement lorsqu’ils se trouvent dans la même pièce que l’appareil. Les tout petits, les jeunes enfants ou les adultes peuvent subir des brûlures s’ils viennent en contact avec la surface chaude. Il est recommandé d’installer une barrière physique si des personnes à risques habitent la maison. Pour empêcher l’accès à un foyer ou à un poêle, installez une barrière de sécurité; cette mesure empêchera les tout petits, les jeunes enfants et toute autre personne à risque d’avoir accès à la pièce et aux surfaces chaudes. Children and adults should be alerted to the hazards of high surface temperature and should stay away to avoid burns or clothing ignition. Les enfants et les adultes devraient être infor-més des dangers que posent les températures de surface élevées et se tenir à distance afin d’éviter des brûlures ou que leurs vêtements ne s’enflamment. DO NOT ATTEMPT TO ALTER OR MODIFY THE CONSTRUCTION OF THE APPLIANCE OR ITS COMPONENTS. ANY MODIFICATION OR ALTERATION MAY VOID THE WARRANTY, CERTIFICATION AND LISTINGS OF THIS UNIT. WARNING Improper installation, adjustment, alteration, service or maintenance can cause injury or property damage. Refer to this manual. For assistance or additional information consult a qualified installer, service agency or the gas supplier. WARNING Failure to comply with these installation instructions will result in an improperly installed and operating appliance, voiding its warranty. Any change to this appliance and/or its operating controls is dangerous. WARNING Clothing or other flammable material should not be placed on or near the appliance. AVERTISSEMENT On ne devrait pas placer de vêtements ni d’autres matières inflammables sur l’appareil ni à proximité. WARNING Any safety screen or guard removed for servicing the appliance must be replaced prior to operating the appliance. AVERTISSEMENT Tout écran ou protecteur retiré pour permettre l’entretien de l’appareil doit être remis en place avant de mettre l’appareil en marche. WARNING Improper installation or use of this appliance can cause serious injury or death from fire, burns, explosion or carbon monoxide poisoning. Installation and repair should be done by a qualified service person. The appliance should be inspected before use and at least annually by a professional service person. More frequent cleaning may be required due to excessive lint from carpeting, bedding material, etcetera. It is imperative that control compartments, burners and circulating air passageways of the appliance be kept clean. L’installation et la réparation devrait être confiées à un technicien qualifié. L’appareil devrait faire l’objet d’une inspection par un technicien professionnel avant d’être utilisé et au moins une fois l’an par la suite. Des nettoyages plus fréquents peuvent être nécessaires si les tapis, la literie, et cetera produisent une quantité importante de pous-sière. Il est essentiel que les compartiments abritant les commandes, les brûleurs et les conduits de circulation d’air de l’appareil soient tenus propres. Do not use this appliance if any part has been under water. Immediately call a qualified service technician to inspect the appliance and to replace any parts of the control system and any gas control which have been under water. Ne pas se servir de cet appareil s'il a été plongé dans l'eau, complètement ou en partie. Appeler un technicien qualifié pour inspecter l'appareil et remplacer toute partie du système de contrôle et toute commande qui ont été plongés dans l'eau. Only trim kit(s) supplied by the manufacturer shall be used in the installation of this appliance. Seules les trousses de garniture fournies par le fabricant doivent être utilisées pour l’installation de cet appareil. 0ROVIDEADEQUATECLEARANCESAROUNDAIROPENINGSANDADEQUATEACCESSIBILITYCLEARANCEFOR SERVICEANDPROPEROPERATION.EVEROBSTRUCT the front openings of the appliance. These appliances are designed to operate on natural or propane gas only. The use of other fuels or combination of fuels will degrade the performance of this system and may be dangerous. 4HESEAPPLIANCESMUSTNOTBECONNECTEDTOA chimney or flue serving a separate solid fuel BURNINGAPPLIANCE 3 )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 These electronic appliances are remotely controlled and feature an electronic intermittent pilot ignition system or standing pilot. %XTERNALELECTRICALPOWERISREQUIREDTOOPERATE these units. These electronic models come standard with a REMOTELYMODULATEDGASVALVEmAMEAPPEARANCEANDHEATOUTPUTCANNOTBECONTROLLEDAT THEGASVALVE4HE"45)NPUTFORTHESEAPPLIances is shown in Table 1. Input (BTU/HR) Model Input (BTU/Hr) Natural Gas 40 in. 45 in. 32,000 to 50,000 38,500 to 60,000 Propane Gas 40 in. 45 in. 32,000 to 50,000 38,500 to 60,000 Table 1 Gas Pressure—All Models Appliance inlet and manifold gas pressure REQUIREMENTSARELISTEDINTables 2 and 3. Inlet Gas Supply Pressure Minimum Maximum 5.5" WC 10.5" WC Natural (1.37 kPa) (2.61 kPa) Gas Fuel # Propane 11.0" WC (2.74 kPa) 13.0" WC (3.23 kPa) Table 2 Manifold Gas Supply Pressure Fuel # Low High Natural 1.6" WC 3.5" WC Gas (.4 kPa) (.87 kPa) 6.3" WC 10.0" WC Propane (1.57 kPa) (2.49 kPa) Table 3 Orifice Sizes—Sea Level To High Altitude (All Models) These appliances are tested and approved for installation at elevations of 0–4500 feet n METERS ABOVE SEA LEVEL USING THE STANDARDBURNERORIlCESIZESMARKEDWITHAN ASTERISK INTable 4)&ORELEVATIONSABOVE FEETCONTACTYOURGASSUPPLIERORQUALIlED service technician. Deration—At higher elevations, the amount OF"45FUELVALUEDELIVEREDMUSTBEREDUCED BYEITHER s USINGGASTHATHASBEENDERATEDBYTHEGAS COMPANYOR s CHANGINGTHEBURNERORIlCETOASMALLERSIZE ASREGULATEDBYTHELOCALAUTHORITIESHAVING JURISDICTIONANDBYTHE53!.ATIONAL&UEL 'AS #ODE .&0! !.3) :LATEST EDITIONORIN#ANADATHE#!.#'!" CODESLATESTEDITION Install the appliance according to the regulations OFTHELOCALAUTHORITIESHAVINGJURISDICTIONAND INTHE53!THE.ATIONAL&UEL'AS#ODE.&0! !.3):LATESTEDITIONORIN#ANADA THE#!.#'!"LATESTEDITION NOTE: Flame appearance will diminish 4% per thousand feet of altitude. Burner Orifice Sizes Elevation 0–4500 ft ( 0–1372 m) Model Nat.Gas drill size (inches) 40 in. 0.1405" (#28)* 0.086" (#44)* 45 in. 0.154" (#23)* 0.093" (#42)* s( s( Table 4 The appliance and its appliance main gas VALVE MUST BE DISCONNECTED FROM THE GAS supply piping system during any pressure testing of that system at test pressures in excess ofPSIK0A 4HEAPPLIANCEMUSTBEISOLATEDFROMTHEGAS SUPPLYPIPINGSYSTEMBYCLOSINGITSEQUIPMENT shutoff valve during any pressure testing of the gas supply piping system at test pressures equal to or less thanPSIK0A 4 s( s( * Standard size installed at factory s0ART#AT.UMBER Gas Valve Diagram The SIT Proflame gas valve is shown in Figure 1. Test gauge connections are provided on the FRONTOFTHEGASCONTROLVALVEIDENTIlED).FOR THEINLETAND/54FORTHEMANIFOLDSIDE 0ROPANETANKSAREATPRESSURESTHATWILLCAUSE damage to valve components. Verify that the TANKSHAVESTEPDOWNREGULATORSTOREDUCETHE pressure to safe levels. Propane drill size (inches) Green Wire (From DFC Wire Harness) Manifold (Out) Test Port Inlet (In) Test Port Wire (From DFC Wire Harness) Main Gas Inlet 3/8" NPT Figure 1—SIT Proflame Valve ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% REQUIREMENTS FOR THE COMMONWEALTH OF MASSACHUSETTS 4HESElREPLACESAREAPPROVEDFORINSTALLATIONIN THE53STATEOF-ASSACHUSETTSIFTHEFOLLOWING ADDITIONALREQUIREMENTSAREMET s )NSTALL THIS APPLIANCE IN ACCORDANCE WITH -ASSACHUSETTS2ULESAND2EGULATIONS #-2 s )NSTALLATIONANDREPAIRMUSTBEDONEBYA PLUMBERORGASlTTERLICENSEDINTHE#OMMONWEALTHOF-ASSACHUSETTS s 4HE mEXIBLE GAS LINE CONNECTOR USED SHALL NOT EXCEED INCHES CENTIMETERS IN length. s 4HE INDIVIDUAL MANUAL SHUTOFF MUST BE A T-handle type valve. Massachusetts Horizontal Vent Requirements In the Commonwealth of Massachusetts, horizontal terminations installed less than seven (7) feet above the finished grade must comply with the following additional requirements: s ! HARD WIRED CARBON MONOXIDE DETECTOR WITHANALARMANDBATTERYBACKUPMUSTBE installed on the floor level where the gas lREPLACEISINSTALLED4HECARBONMONOXIDE DETECTOR MUST COMPLY WITH .&0! BE !.3)5,LISTEDANDBE)3!CERTIlED s !METALORPLASTICIDENTIlCATIONPLATEMUST BEPERMANENTLYMOUNTEDTOTHEEXTERIOROF THEBUILDINGATAMINIMUMHEIGHTOFEIGHT FEETABOVEGRADEANDBEDIRECTLYINLINEWITH the horizontal termination. The sign must READINPRINTSIZENOLESSTHANONEHALF INCHINSIZE'!36%.4$)2%#4,9"%,/7 +%%0#,%!2/&!,,/"3425#4)/.3 Connect GTMS Wire Harness Pressure Regulator Tower Yellow Ground Wire (From DFC Wire Harness) )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 Cet appareil peut être installé cómme du matéri-el d'origine dans une maison PR£FABRIQU£E »5 SEULEMENT OU MOBILE et doit être installé selon les instructions DUFABRICANTETCONFORM£MENTÜLANORME -ANUFACTURED (OME #ONSTRUCTIONS AND 3AFETY 4ITLE #&2 0ART AUX 5NIS OU Ü LA NORME #AN#3!: 3£RIE -- -AISONSMOBILESAU#ANADA This appliance is only for use with the type of gas indicated on the rating plate. This appliance ISNOTCONVERTIBLEFORUSEWITHOTHERGASESUNLESSACERTIlEDKITISUSED #ET APPAREIL DOIT äTRE UTILIS£ UNIQUEMENT AVEC LE TYPE DE GAZ INDIQU£ SUR LA PLAQUE SIGNAL£TIQUE#ETAPPAREILNEPEUTäTRECONVERTIÜDgAUTRESGAZSAUFSIUNETROUSSEDE conversion est utilisée. CAUTION: Ensure that the cross members are not cut or weakened during installation. The structural integrity of the manufactured home floor, wall, and ceiling / roof must be maintained. Flat on Wall Application Island Application FLAT APPLICATION Top Of Fireplace Opening HORIZONTA Non-Combustible When the unit is installed with one side flush with a wall, the DIVIDER wall on the other side of the unit must ROOM APPLICATION not extend beyond the front edge of the unit. RECESSED Figure 2—Typical Installation APPLICATION HORIZONTAL VENT VERTICAL VENT FLAT ON WALL APPLICATION 4HISAPPLIANCEMAYBEINSTALLEDINANAFTERMARKET permanently located, manufactured home and MUSTBEINSTALLEDINACCORDANCEWITHTHEMANUFACTURERgS INSTRUCTIONS AND THE -ANUFACTURED Home Construction and Safety Standard, Title #&20ARTINTHE5NITED3TATESORTHE 3TANDARDFOR)NSTALLATIONIN-OBILE(OMES#!. #3!:-(3ERIESIN#ANADA Recessed Application Drywall ISLAND APPLICATION MANUFACTURED HOME REQUIREMENTS Room Divider Application CR AP OS PL S C IC OR AT N IO ER N )FTHElREPLACEISBEINGINSTALLEDONACEMENT SLAB IN COLD CLIMATES A SHEET OF PLYWOOD OR OTHERRAISEDPLATFORMCANBEPLACEDUNDERNEATH TO PREVENT COLD TRANSFER TO THE lREPLACE AND INTOTHEROOM)TALSOHELPSTOSHEETROCKINSIDE SURFACESANDTAPEFORMAXIMUMAIRTIGHTNESS ANDCAULKlRESTOPS Cr Ap oss pl Co ic rn at e io r n &OR COLD CLIMATE INSTALLATIONS SEAL ALL CRACKS AROUND YOUR APPLIANCE WITH NONCOMBUSTIBLE material and wherever cold air could enter the room. It is especially important to insulate OUTSIDECHASECAVITYBETWEENSTUDSANDUNDER mOORONWHICHAPPLIANCERESTSIFmOORISABOVE GROUNDLEVEL'ASLINEHOLESANDOTHEROPENINGS SHOULD BE CAULKED OR STUFFED WITH UNFACED lBERGLASSINSULATION Flat Application COLD CLIMATE INSULATION LOCATION In selecting the location, the aesthetic and functional use of the appliance are primary concerns. However, vent system routing to THEEXTERIORANDACCESSTOTHEFUELSUPPLYARE also important. Due to high temperatures, the appliance should be located out of traffic and away from furniture and draperies (Figure 2). En raison des températures élevées, l’appareil devrait être installé dans un endroit où il y a peu de circulation et loin du mobilier et des tentures (Figure 2). 4HELOCATIONSHOULDALSOBEFREEOFELECTRICAL PLUMBING OR OTHER HEATINGAIR CONDITIONING ducting. 4HESE DIRECTVENT APPLIANCES ARE UNIQUELY SUITEDFORINSTALLATIONSREQUIRINGAUTILITYSHELF POSITIONEDDIRECTLYABOVETHElREPLACE5TILITY SHELVES LIKE THESE ARE COMMONLY USED FOR locating television sets and decorative plants. Be aware that this is a heat producing appliance. Objects placed above the unit are exposed to elevated temperatures. Do not insulate the space between the appliance and the area above itsee Figure 7 on Page 8). 4HE MINIMUM HEIGHT FROM THE BASE OF THE APPLIANCE TO THE UNDERSIDE OF COMBUSTIBLE materials used to construct a utility shelf in this fashion is shown in Figure 7 on Page 8. 4HE APPLIANCE MUST BE MOUNTED ON A FULLY SUPPORTED BASE EXTENDING THE FULL WIDTH ANDDEPTHOFTHEUNIT4HEAPPLIANCEMAYBE located on or near conventional construction MATERIALS(OWEVERIFINSTALLEDONCOMBUSTIBLE materials, such as carpeting, vinyl tile, or other COMBUSTIBLEMATERIALOTHERTHANWOODmOORING THEAPPLIANCESHALLBEINSTALLEDONAMETALOR WOODPANELEXTENDINGTHEFULLWIDTHANDDEPTH of the appliance. CAUTION: This appliance must be grounded to the chassis of the manufactured home in accordance with local codes or in the absence of local codes, with the National Electrical Code ANSI / NFPA 70— latest edition or the Canadian Electrical Code CSA C22.1—latest edition. 5 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 VENT TERMINATION CLEARANCES These instructions should be used as a guideline and do not supersede local codes in any way. Install vent according to local codes, these instructions, the current National Fuel Gas Code (ANSI-Z223.1) in the USA or the current standards of CAN/CGA-B149.1 in Canada. Vertical Vent Termination Clearances Terminate multiple vent terminations according TOTHEINSTALLATIONCODESLISTEDABOVE!LSOSEE Figure 3. Vertical Vent Termination Clearances TERMINATION HEIGHTS FOR VENTS ABOVE FLAT OR SLOPED ROOFS Horizontal Overhang 2 FT MIN. 2 FT MIN. Lowest Discharge Opening Vent Termination H* Storm Collar X 12 Flashing Roof Pitch is X/12 4ERMINATESINGLEVENTCAPSRELATIVETOBUILDING components according to Figures 3 and 4. 1” (25.4 mm) Minimum Clearance to Combustibles Concentric Vent Pipe 12” (305mm) Minimum Vertical Wall *H = MINIMUM HEIGHT FROM ROOF TO LOWEST DISCHARGE OPENING OF VENT 4HEVENTAIRINTAKETERMINATIONCLEARANCES ABOVETHEHIGHSIDEOFANANGLEDROOFISAS shown in the following chart: Termination Heights For Vents Above Flat Or Sloped Roofs Ref. NFPA 54 / ANSI Z223.1 Roof Pitch * Feet * Meters &LATTO 1.0 TO 1.25 TO 1.5 0.46 TO 2.0 0.61 TO 2.5 10/12 to 11/12 11/12 to 12/12 4.0 1.22 12/12 to 14/12 5.0 1.52 14/12 to 16/12 6.0 TO TO 20/12 to 21/12 2.44 Figure 4 Horizontal Vent Termination Clearances Figure 3—Multiple Terminations 4HEHORIZONTALVENTTERMINATIONMUSTHAVEAMINIMUMOFMMCLEARANCETOANYOVERHEAD COMBUSTIBLEPROJECTIONOFMMORLESSSEEFigure 5). &ORPROJECTIONSEXCEEDING MMSEEFigure 5&ORADDITIONALVENTLOCATIONRESTRICTIONSREFERTOFigure 6 on Page 7. Horizontal Vent Termination Clearances Combustible Projection 2-1/2” or less in length Combustible Projection greater than 2-1/2” in length Ventilated Or Unventilated Soffit 3" (76 mm) 24" (610 mm) Termination Kit Figure 5—Side Elevation View 6 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% See Figure 28 on Page 18 for the recess allowances, into exterior walls, of the square horizontal terminations. )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 NOTE: Local Codes Or Regulations May Require Different Clearances. * See Item D in the Text Below. Center Line Exterior Wall of Termination Inside Corner Detail *18” 24" Horizontal Termination NOTE: Location Of The Vent Termination Must Not Interfere With Access To The Electrical Service. G 18” 36" V Ventilated Soffit A Inside Corner = 9" in U.S. ! A =12" in Canada DETAIL D H 3 ft. B L V C V F V C C ! A Operable Window V C V B Fixed Closed Window X D A ! V 3 ft. J B M B B X V I A X = Air Supply Inlet E V = Vent Terminal K = Area where Terminal is NOT permitted Minimum Clearances Canadian Installation * US Installation ** ! #LEARANCE ABOVE GRADE VERANDA PORCH DECK CM ORBALCONY CM "#LEARANCETOWINDOWORDOORTHATMAYBEOPENED CMFORAPPLIANCES"45HRK7 CM FOR APPLIANCES "45HR K7 AND "45HRK7CMFORAPPLIANCES "45HRK7 CMFORAPPLIANCES"45HRK7 CMFORAPPLIANCES"45HRK7AND "45HRK7CMFORAPPLIANCES "45HRK7 C = Clearance to permanently closed window MMRECOMMENDEDTOPREVENTWINDOWCONDENsation MM RECOMMENDED TO PREVENT WINDOW CONdensation $6ERTICAL CLEARANCE TO VENTILATED SOFlT LOCATED CM ABOVETHETERMINALWITHINAHORIZONTALDISTANCEOF CMFROMTHECENTERLINEOFTHETERMINAL CM %#LEARANCETOUNVENTILATEDSOFlT CM CM &#LEARANCETOOUTSIDECORNER CM CM '#LEARANCETOINSIDECORNER CM CM (#LEARANCETOEACHINSIDEOFCENTERLINEEXTENDED FEETCMWITHINAHEIGHTOFFEETABOVETHEMETER FEETCMWITHINAHEIGHTOFFEETABOVETHEMETER ABOVEMETERREGULATORASSEMBLY REGULATORASSEMBLY REGULATORASSEMBLY I = Clearance to service regulator vent outlet FEETCM FEETCM J = Clearance to non-mechanical air supply inlet CMFORAPPLIANCES"45HRK7 CMFORAPPLIANCES"45HRK7 TOBUILDINGORTHECOMBUSTIONAIRINLETTOANYOTHER CMFORAPPLIANCES"45HRK7AND CMFORAPPLIANCES"45HRK7AND appliance "45HRK7CMFORAPPLIANCES"45 "45HR K7 CM FOR APPLIANCES HRK7 "45HRK7 +#LEARANCETOMECHANICALAIRSUPPLYINLET FEETMETERS FEETCMABOVEIFWITHINFEETMHORIZONTALLY , #LEARANCE ABOVE PAVED SIDEWALK OR PAVED FEETMp DRIVEWAYLOCATEDONPUBLICPROPERTY FEETMp - #LEARANCE UNDER VERANDA PORCH DECK OR CM p BALCONY CM p )NACCORDANCEWITHTHECURRENT#!.#'!".ATIONAL'ASAND"0ROPANE)NSTALLATION#ODE,ATEST%DITIONS )NACCORDANCEWITHTHECURRENT!.3):.&0!.ATIONAL&UEL#ODES,ATEST%DITION p!VENTSHALLNOTTERMINATEDIRECTLYABOVEASIDEWALKORPAVEDDRIVEWAYWHICHISLOCATEDBETWEENTWOSINGLEFAMILYDWELLINGSANDSERVESBOTHDWELLINGS p/NLYPERMITTEDIFVERANDAPORCHDECKORBALCONYISFULLYOPENONAMINIMUMSIDESBENEATHTHEmOOR Figure 6—Exterior Horizontal Vent Termination Clearance Requirements 7 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 MINIMUM CLEARANCES TO COMBUSTIBLES 4HEAPPLIANCEISAPPROVEDWITHZEROCLEARANCETOCOMBUSTIBLEMATERIALS ONALLSIDESASDETAILEDINTable 5)WITHTHEFOLLOWINGEXCEPTIONWhen the unit is installed with one side flush with a wall, the wall on the other side of the unit must not extend beyond the front edge of the unit. In addition, when the unit is recessed, the side walls surrounding THEUNITMUSTNOTEXTENDBEYONDTHEFRONTEDGEOFTHEUNITSEEFigure 2). Combustible Shelf Height—Inches (millimeters) Top Vent—with 2 Feet Vertical Vent and One 90 Degree Elbow Model Secure Vent® 40 in. *84-1/16 (2135) 45 in. *89-1/16 (2252) * Includes 3" clearance to combustibles (required above vent components) APPLIANCE MINIMUM CLEARANCES* Inches (millimeters) Sides 1/2 (13), 0 (0) Spacers ** Top Spacers 0 (0) Floor 0 (0) Back 1/2 (13), 0 (0) Spacers Bottom of Appliance To Ceiling 69 (1743) Vent 3 (76) Top* / 1 (25.4) Sides & Bottom Do not insulate the space between the appliance and the area above it. 2-1/2 ft (to centerline) Vertical Vent (minimum) Shelf Height (see table) SERVICE CLEARANCES Feet (meters) Front 3 feet (0.9 meters) Table 5 Figure 7 Shelf Above Fireplace With Top Venting *NOTE: 3" (75 mm) above any horizontal/inclined vent component. **NOTE: See Page 9, Step 1 for clearance requirements to the nailing flange located at each side of the unit and any screw heads adjacent to it. See Page 28 for hearth extension requirements. 12 (305) MANTEL 10 (254) MANTEL 8 (203) MANTEL Shelf Height 4OPROVIDEFORTHELOWESTPOSSIBLESHELFSURFACETHEVENTINGATTACHEDTO THETOPVENTSHOULDBEROUTEDINAWAYTOMINIMIZEOBSTRUCTIONSTOTHE SPACEABOVETHEAPPLIANCEDo not insulate the space between the appliance and the area above itSEEFigure 7). The minimum height from THEBASEOFTHEAPPLIANCETOTHEUNDERSIDEOFCOMBUSTIBLEMATERIALSUSED to construct a utility shelf in this fashion is shown in Figure 7. 17 (432) 6 (152) MANTEL 15 (381) 13 (330) 4 (102) MANTEL 11 (279) 2 (51) 9 (229) NOTE: Combustible wall finish materials and/or surround materials must not be allowed to encroach the area defined by the appliance front face (black sheet metal). Never allow combustible materials to be positioned in front of or overlapping the appliance face. See Figure 9 and Figure 51 on Page 28. Top of Appliance Combustible Materials Allowed In Shaded Area "Safe Zone" Fireplace (side view) Top View of Fireplace 12 in. (305 mm) .ONCOMBUSTIBLEMATERIALSSUCHASSURROUNDSANDOTHERAPPLIANCETRIM MAYBEINSTALLEDONTHEAPPLIANCEFRONTFACEWITHTHESEEXCEPTIONSTHEY MUSTNOTCOVERANYPORTIONOFTHEREMOVABLEGLASSPANEL 6ERTICALINSTALLATIONCLEARANCESTOCOMBUSTIBLEMANTELSVARYACCORDING to the depth of the mantel. See Figure 8-ANTELSCONSTRUCTEDOFNON COMBUSTIBLEMATERIALSMAYBEINSTALLEDATANYHEIGHTABOVETHEAPPLIANCE OPENING-INIMUMCLEARANCEREQUIREMENTSINCLUDEANYPROJECTIONSSUCH ASSHELVESWINDOWSILLSMANTELSETCABOVETHEAPPLIANCE MANTEL 7 (178) Figure 8 Wall Finishes / Surrounds / Mantels MANTEL CLEARANCES Inches (mm) 45° 5 in. (127 mm) 17 in. (432 mm) 8-1/4 in. (210 mm) NOTE: We recommend the use of high temperature paint (rated 175° F or higher) on the underside of the mantel. Side Wall Minimum Distance to Protected Side Wall Side Wall 14 in. (356 mm) Figure 9 8 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% Minimum Distance to Unprotected Side Wall )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 WARNING Failure to position the parts in accordance with these diagrams or failure to use only parts specifically approved with this appliance may result in property damage or personal injury. AVERTISSEMENT Risque de dommages ou de blessures si les pièces ne sont pas installées conformément à ces schémas et ou si des pièces autres que celles spécifiquement approuvées avec cet appareil sont utilisées. DETAILED INSTALLATION STEPS The appliance is shipped with all gas controls and components installed and prewired. 2EMOVETHESHIPPINGCARTONEXPOSINGTHE front glass door on the valve access side. 2. Using a Phillips screwdriver, unfasten two SCREWSLOCATEDATTHETOPOFTHEGLASS FRAMEsee Figure 46 on page 26). Tilt the top of the glass frame away from the unit. ,IFTITCAREFULLYOFFTHEBOTTOMDOORTRACK and set the door aside, protecting it from inadvertent damage. TYPICAL INSTALLATION SEQUENCE Step 1. FRAMING 4HETYPICALSEQUENCEOFINSTALLATIONISOUTLINED BELOW(OWEVEREACHINSTALLATIONISUNIQUEAND MAYRESULTINVARIATIONSTOTHESTEPSDESCRIBED &RAMETHESEAPPLIANCESASILLUSTRATEDINFigure 11 on Page 10, UNLESSTHEAPPLIANCEISTOBE installed in a corner. See Figure 12 on Page 11 for corner framing installations. All framing details must allow for a minimum clearance to COMBUSTIBLE FRAMING MEMBERS AS SHOWN IN Table 5 on Page 8. 3EETHE0AGENUMBERSREFERENCESINTHEFOLLOWing steps for detailed procedures. Step 1. (Page 9) Construct the appliance framing. Position the appliance within the framing and secure with nailing BRACKETS Step 2. (Page 11) Route gas supply line to the right side. Step 3. (Page 12) Install the vent system and EXTERIORTERMINATION Step 4. (Page 21) Connect 120 VAC electrical power to the appliance receptacle. Step 5. (Page 23) Remove glass door assemBLY Step 6. (Page 23) -AKE CONNECTION TO GAS supply. )FTHEAPPLIANCEISTOBEELEVATEDABOVEmOOR LEVEL A SOLID CONTINUOUS PLATFORM MUST BE CONSTRUCTEDBELOWTHEAPPLIANCE (EADERS MAY BE IN DIRECT CONTACT WITH THE APPLIANCE TOP SPACERS BUT MUST NOT BE SUPPORTEDBYTHEMORNOTCHEDTOlTAROUNDTHEM !LLCONSTRUCTIONABOVETHEAPPLIANCEMUSTBE self-supporting, DO NOT use the appliance for structural support. 4HE lREPLACE SHOULD BE SECURED TO THE SIDE FRAMING MEMBERS USING THE UNITgS NAILING mANGESONETOPANDBOTTOMONEACHSIDEOF THElREPLACEFRONTSEEFigure 10). 5SEDNAILS ORTHEIREQUIVALENT Step 7. (Page 23) Verifying appliance operation. Use Top Flange For 1/2” Thick Drywall Step 8. (Page 24))NSTALLlREBOXLINERPANELS LOGSANDGLOWINGEMBERS Front Of Fireplace OR Use Center Flange For Flush Mount CONTEMPORARYBURNERmOORKITPORCElain panels, and media. Use Bottom Flange For 5/8” Thick Drywall Step 9. (Page 26))NSTALLGLASSDOORASSEMBLY Step 10. (Page 26) !DJUST BURNER TO ENSURE proper flame appearance. Step 11. (Page 29) Attach safety in operation warnings. Left LeftSide SideFront FrontCorner CornerofofFireplace Fireplace Shown Shown (Right Side Requirements the Same) (Right Side Requirements the Same) Unit Being Secured By Its Nailing Flanges Unit Being Secured By Its Nailing Flanges To The Framing To The Framing Note: The nailing flanges, combustible members NOTE: Theheads nailinglocated flanges,incombustible members and adjacent areas directly screw and heads flanges, located are in areas directly the 1/2” to fromadjacent EXEMPT the nailing toscrew the nailingtoflanges, are EXEMPT from thefor 1/2” theclearrequirements combustible clearance ance to combustible for the may firebox be Combustible framing wrapper. requirements outer firebox wrapper. framing may be direct andinmay flanges inouter with the nailing contactCombustible direct contact the nailing flanges mayheads be located and screw from and than 1/2” closer locatedwith be to the nailing in areas firebox the closer thanwrapper 1/2” from screwadjacent heads and firebox dimensions opening totothe the adjacent flanges. wrapperFrame in areas theexact nailing flanges. this manual. details the framing in opening specified Frame the to the exactofdimensions specified in the framing details of this manual. Unit Being Secured by Its Nailing UnitFlanges Being Secured by Its Nailing to the Framing Flanges to the Framing Figure 10 9 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 Framing Dimensions Model 40 in. 45 in. A B C in. 50-3/4 43 75-1/8 mm 1289 1092 1908 in. 56-7/8 48 80-1/16 mm 1445 1219 2034 Framing should be constructed of 2x4 or larger lumber. VENT FRAMING TOP VENT WITH 2 FEET VERTICAL VENT AND ONE 90° ELBOWVENT FRAMING TOP VENT WITH 2 FEET VERTICAL VENT AND ONE 90° ELBOW PIPE CENTERLINE 13 (330) 13 (330) PIPE CENTERLINE Propane Model P4 P4 40 in. 35.8 TBD 45 in. 51.2 TBD 8-1/2 (216) 6-1/2 (165) Thermal Efficiency (%) Natural Gas Framing should be constructed of 2x4 or larger lumber. 15 6-1/2 (165) 8-1/2) (381 (216) 15 (381) C B C B 25-1/4 (641) 1/2 A E 25-1/4 A D (641) 1/2 A Inches (mm) A Inches (mm) 5-1/4” (133) 14-1/8 (359) 8-1/2” (216) 26-15/32 (672) 25-29/32 (658) Top View 25-1/2 (648) J 8-3/8 (213) 5-3/32 (129) 2-1/2 (64) Gas Inlet (This Side Only) 7 (178) G B H Diagrams, illustrations and photographs are not to scale — consult installation instructions. Product designs, materials, dimensions, specifications, colors and prices are subject to change or discontinuance without notice. Electrical Inlet 19-5/8 (498) A Notes C Right Side View F Vent Size Coaxial DV Vent Size Front View 8" Inner 11" Outer Fireplace Dimensions Model 40 in. 45 in. A B C D E F G H J in. 50-5/8 37-1/4 42-7/8 25-5/16 34 37-5/8 33-3/32 29-9/32 34-3/4 mm 1286 946 1089 643 864 956 840 744 883 in. 56-11/16 42-1/4 47-7/8 28-3/8 40-1/8 43-5/8 38-3/32 34-1/2 40-59/64 mm 1440 1073 1216 721 1019 1108 968 876 1039 Figure 11—Fireplace and Framing Specifications 10 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 Model 40 in. 45 in. A B C D in. 50-5/8 83-5/8 59-1/8 41-7/8 mm 1286 2124 1502 1064 in. 56-3/4 89-7/8 63-1/2 44-7/8 mm 1441 2283 1613 1140 C D A B Back wall of chase/enclosure (including any finishing materials) Figure 12—Corner Framing with Square Termination (SV8HTS) Step 2. ROUTING GAS LINE 2OUTEAMMGASLINEALONGTHEINSIDE of the right side framing as shown in Figure 13'ASLINESMUSTBEROUTEDCONSTRUCTEDAND made of materials that are in strict accordance with local codes and regulations. !LL APPLIANCES ARE FACTORYEQUIPPED WITH A mEXIBLE GAS LINE CONNECTOR AND SHUTOFF valve. (See Step 6 on Page 22). 4HEINCOMINGGASLINESHOULDBEPIPEDINTOTHE valve compartment and connected in one of the two methods as shown in Figure 36 on Page 23. Right Side Front Corner Of Fireplace Framing Never use galvanized or plastic pipe. Refer to Table 6 for proper sizing of the gas supply LINEIFBLACKIRONPIPEISBEINGUSED'ASLINES MUST BE ROUTED CONSTRUCTED AND MADE OF materials that are in strict accordance with LOCAL CODESANDREGULATIONS7ERECOMMEND THATAQUALIlEDINDIVIDUALSUCHASAPLUMBER ORGASlTTERBEHIREDTOCORRECTLYSIZEANDROUTE the gas supply line to the appliance. Installing a gas supply line from the fuel supply to the appliance involves numerous considerations of materials, protection, sizing, locations, controls, pressure, sediment, and more. Certainly no one UNFAMILIARANDUNQUALIlEDSHOULDATTEMPTSIZING or installing gas piping. Schedule 40—Black Iron Pipe Inside Diameter (Inches) 19-5/8” (498 mm) 6-1/4” (159 mm) Figure 13 Schedule 40 Pipe Length (feet) Natural Gas Propane Gas 0–10 10–40 40–100 100–150 150–200 Table 6 Proper Sizing of Gas Line NOTES: s !LLAPPLIANCESAREFACTORYEQUIPPEDWITHA mEXIBLEGASLINECONNECTORANDSHUTOFF VALVESEEFigure 36 on Page 23). s 3EEMassachusetts Requirements on Page 4FORADDITIONALREQUIREMENTSFORINSTALLATIONS INTHESTATEOF-ASSACHUSETTSINTHE53! s 4HEGASSUPPLYLINESHOULD.OTBECONNECTED to the appliance until Step 6Page 23). s !PIPEJOINTCOMPOUNDRATEDFORGASSHOULDBE USEDONTHETHREADEDJOINTS Ensure propane resistant compounds are used in propane applications"EVERYCAREFULTHATTHEPIPE compound does not get inside the pipe. s )TISRECOMMENDEDTOINSTALLASEDIMENTTRAP INTHESUPPLYLINEASCLOSEASPOSSIBLETOTHE APPLIANCESEEFigure 36 on Page 23). s #HECK WITH LOCAL BUILDING OFlCIAL FOR LOCAL CODEREQUIREMENTS IMPORTANT: If propane is used, be aware that if tank size is too small (i.e. under 100 lbs, if this is the only gas appliance in the dwelling. Ref. NPFA 58), there may be loss of pressure, resulting in insufficient fuel delivery (which can result in sooting, severe delayed ignition or other malfunctions). Any damage resulting from an improper installation, such as this, is not covered under the limited warranty. Properly size and route the gas supply line from the supply regulator to the area WHERE THE APPLIANCE IS TO BE INSTALLED PER REQUIREMENTSOUTLINEDINTHE.ATIONAL&UEL'AS #ODE.&0!LATESTEDITION53!OR#!. #'!"LATESTEDITION#ANADA 11 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 Step 3. INSTALL THE VENT SYSTEM Installation of Vent Restrictor Select Venting System—Horizontal or Vertical General Information ! VENT RESTRICTOR MAY BE NEEDED WITH THIS appliance. The restrictor is installed in the appliance top flue outlet as shown in Figure 14, 7ITH THE APPLIANCE SECURED IN FRAMING DETERMINEVENTROUTINGANDIDENTIFYTHEEXTERIOR termination location. The following sections DESCRIBEVERTICALROOFANDHORIZONTALEXTERIOR WALL VENT APPLICATIONS 2EFER TO THE SECTION relating to your installation. A list of approved venting components is shown on Page 30. These instructions should be used as a guideline and do not supersede local codes in any way. Install vent according to local codes, these instructions, the current National Fuel Gas Code (ANSI-Z223.1) in the USA or the current standards of CAN/CGA-B149.1 and -B149.2 in Canada. Ensure clearances are in accordance with local installation codes and the requirements of the gas supplier. Dégagement conforme aux codes d'installation locaux et aux exigences du foumisseunde gaz. Use only approved venting components. See Approved Vent Components on Page 2. For vertical venting from 6 feet to 12 feet or more, from the top of the fireplace to the top of the termination, the installation of a vent restrictor is required. If necessary, install a vent restrictor in the appliance flue outlet as shown in Figure 14. The VENTRESTRICTORISHELDINPLACEBYFRICTIONONLY NOTE: The restrictor is included within the firebox. When vertically terminating the vent system above the roof, install a vent restrictor in the top vent of the fireplace outlet. Install the restrictor as shown from inside the unit, in the inner fireplace collar These fireplaces must be vented directly to the outside. The vent system may not service multiple APPLIANCESANDMUSTNEVERBECONNECTEDTOA mUESERVINGASEPARATESOLIDFUELBURNINGAPPLIANCE4HEVENTPIPEISTESTEDTOBERUNINSIDE ANENCLOSINGWALLSUCHASACHASE4HEREIS NOREQUIREMENTFORINSPECTIONOPENINGSINTHE ENCLOSINGWALLATANYOFTHEJOINTSINTHEVENTPIPE RESTRICTOR APPLIANCE VENT OUTLET Figure 14—Vent Restrictor Installation 12 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 VERTICAL TERMINATION SYSTEMS (ROOF) See Figure 15 and Figures 23 through 25 on Page 16 and their associated Vertical Vent 4ABLESWHICHILLUSTRATETHEVARIOUSVERTICALVENTING CONlGURATIONSTHATAREPOSSIBLEFORUSEWITHTHESE appliances. Secure Vent® pipe applications ARE SHOWN IN THESE lGURES A Vertical Vent 4ABLESUMMARIZESEACHSYSTEMSMINIMUMAND MAXIMUMVERTICALANDHORIZONTALLENGTHVALUES THATCANBEUSEDTODESIGNANDINSTALLTHEVENT components in a variety of applications. The vertical vent system terminates through THEROOF4HEMINIMUMVENTHEIGHTABOVETHE ROOFANDORADJACENTWALLSISSPECIlEDIN!.3) :LATESTEDITION)N#ANADATHECURRENT #!.#'!"INSTALLATIONCODEBYMAJOR BUILDING CODES !LWAYS CONSULT YOUR LOCAL CODES FOR SPECIlC REQUIREMENTS ! GENERAL GUIDETOFOLLOWISTHE'AS6ENT2ULEREFERTO Figure 4 on Page 6). Vertical (Straight) Installation (Figure 15) $ETERMINETHENUMBEROFSTRAIGHTVENTSECTIONS REQUIREDMMMM MM MM AND MM NET SECTION LENGTHS ARE AVAILABLESEETables on this page and Page 30—Vent Sections0LANTHEVENTLENGTHSSO THATAJOINTDOESNOTOCCURATTHEINTERSECTIONOF CEILINGORROOFJOISTS2EFERTOTHE6ENT3ECTION ,ENGTH#HART Termination Flashing And Storm Collar 1" (25 mm) Minimum Clearance to Combustibles Firestop/Spacer Nominal Section Length 6 12 24 36 48 (inches) Net Section 4-1/2 10-1/2 22-1/2 34-1/2 46-1/2 Length (inches) Height of Vent Number of Vent Sections T O T A L T O T A L Nominal Section 6 12 24 36 48 Length (inches) Net Section 4 1 / 2 1 0 1 / 2 2 2 1 / 2 3 4 1 / 2 4 6 -1/2 Length (inches) inches 144 12 1 0 0 0 3 Q T Y 4 15 0 12.5 0 1 0 0 3 4 inches ft 4.5 0.375 1 0 0 0 0 Q T Y 1 9 0.75 2 0 0 0 0 2 10.5 0.875 0 1 0 0 0 1 15 1.25 1 1 0 0 2 19.5 1.625 2 1 0 0 0 0 3 21 1 . 75 0 2 0 0 0 2 Height of Vent Number of Vent Sections ft 154.5 12.875 1 1 0 0 3 5 160.5 13.375 0 2 0 0 3 5 172.5 14.375 0 0 0 5 0 5 17 7 14.75 1 0 0 5 0 6 22.5 1.875 0 0 1 0 0 1 25.5 2.125 1 2 0 0 0 3 18 3 15.25 0 1 0 5 0 6 31.5 2.625 0 3 0 0 0 3 186 15.5 0 0 0 0 4 4 34.5 2.875 0 0 0 1 0 1 37.5 3.125 1 1 1 0 0 3 43.5 3.625 0 2 1 0 0 3 45 3.75 0 0 2 0 0 2 46.5 3.875 0 0 0 0 1 1 49.5 4.125 1 0 2 0 0 3 51 4.25 1 0 0 0 1 2 55.5 4.625 0 1 2 0 0 3 57 4 . 75 0 0 1 1 0 2 66 5.25 0 2 2 0 0 4 67.5 5.625 0 0 3 0 0 3 69 5.75 0 0 0 2 0 2 72 6 1 0 3 0 0 4 73.5 6.125 1 0 0 2 0 3 79.5 6.625 0 1 0 2 0 3 81 6.75 0 0 0 1 1 2 90 7.5 0 2 1 0 1 4 91.5 7.625 0 0 2 0 1 3 93 7.75 0 0 0 0 2 2 96 8 1 0 1 2 0 4 97.5 8.125 1 0 0 0 2 3 102 103.5 108 8.5 8.625 9 2 0 1 0 0 0 0 0 0 0 3 3 2 0 0 4 3 4 190.5 15.875 1 0 0 0 4 5 196.5 16.375 0 1 0 0 4 5 205.5 17.125 0 1 1 5 0 7 207 17.25 0 0 0 6 0 6 211.5 17.625 1 0 0 6 0 7 217.5 18.125 0 1 0 6 0 7 229.5 19.125 0 0 1 6 0 7 232.5 19.375 0 0 0 0 5 5 237 19.75 1 0 0 0 5 6 2 41. 5 20.125 0 0 0 7 0 7 246 20 . 5 1 0 0 7 0 8 252 21 0 1 0 7 0 8 26 4 22 0 0 1 7 0 8 27 6 23 0 0 0 8 0 8 279 23.25 0 0 0 0 6 6 280.5 23.375 1 0 0 8 0 9 283.5 23.625 1 0 0 0 6 7 289.5 24.125 0 1 0 0 6 7 301.5 25.125 0 0 1 0 6 7 310.5 25.875 0 0 0 9 0 9 10 315 26.5 1 0 0 9 0 325.5 27.125 0 0 0 0 7 7 330 27 . 5 1 0 0 0 7 8 114 9.5 0 2 0 0 2 4 336 28 0 1 0 0 7 8 117 9.75 1 0 5 0 0 6 345 28.75 0 0 0 10 0 10 118.5 9.875 1 1 0 3 0 5 349.5 29.125 1 0 0 10 0 11 126 10.5 0 0 1 3 0 4 372 31 0 0 0 0 8 8 1 0 1 3 0 5 376.5 31.375 1 0 0 0 8 9 11 130.5 10.875 135 11.25 0 0 6 0 0 6 379.5 31.625 0 0 0 11 0 138 11.5 0 0 0 4 0 4 4 18. 5 34.875 0 0 0 0 9 9 139.5 11.625 0 0 0 0 3 3 42 3 35.25 1 0 0 0 9 10 142.5 11.875 1 0 0 4 0 5 46 5 38.75 0 0 0 0 10 10 Table 7: Vent Section Length Chart 40' Max (12.2 M) 6' Min (1.8 M) Model SV8 6/12/24/36/48 Vent Sections NOTE: Convert inches into metric equivalent measurement, as follows: Millimeters (mm) = Inches x 25.4 Centimeters (cm) = Inches x 2.54 Meters (M) = Inches x .0254 Effective Length SV8L6 4-1/2" SV8L12 10-1/2" SV8L24 22-1/2" SV8L36 34-1/2" SV8L48 46-1/2" Table 8—Effective Vent Length Figure 15 13 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 Vertical (Offset) Installation Analyze the vent routing and determine the QUANTITIESOFVENTSECTIONSANDNUMBEROFELBOWS REQUIRED2EFERTOVertical Vent Figures and Tables on Page 16 to select the type of vertical INSTALLATIONDESIRED6ENTSECTIONSAREAVAILABLE INNETLENGTHSOFMM MMMMMMAND MM2EFERTOTHEVent Section Length Chart on Page 13 for an aid in selectINGLENGTHCOMBINATIONS%LBOWSAREAVAILABLE INANDCONlGURATIONS2EFERTOFigure 20 on Page 15 FORTHE36%AND36% ELBOWDIMENSIONALSPECIlCATIONS 7HERE REQUIRED A telescopic vent section (SV8LA)MAYBEUSEDTOPROVIDETHEINSTALLER WITHANOPTIONININSTALLINGINTIGHTANDCONlNED SPACESORWHERETHEVENTRUNMADEUPOFlXED LENGTHPIECESDEVELOPSAJOINTINAUNDESIRABLE LOCATION OR WILL NOT BUILD UP TO THE REQUIRED LENGTH4HE36,!4ELESCOPIC6ENT3ECTIONHAS ANEFFECTIVELENGTHOFFROMMMTO MM4HE36,!ISlTTEDWITHA DIMPLEDENDIDENTICALTOANORMALVENTSECTION COMPONENTANDAPLAINENDWITHPILOTHOLES 3LIPTHEDIMPLEDENDOVERTHELOCKINGCHANNEL END OF A STANDARD 36 VENT COMPONENT THE REQUIREDDISTANCEANDSECUREWITHTHREESCREWS Maintain a minimum 1" (25 mm) clearance to combustible materials for all vertical elements. Clearances for all horizontal elements are 3" (76 mm) on top, 1" (25 mm) on sides and 1" (25 mm) on the bottom. A. Frame ceiling opening—5SEAPLUMBLINE FROMTHECEILINGABOVETHEAPPLIANCETOLOCATE center of the vertical run. Cut and/or frame an OPENINGXMMXMMINSIDE DIMENSIONSABOUTTHISCENTERMARK(Figure 16). Minimum 13” (330 mm) Roof Framing Ceiling Framing Figure 16 Minimum 13” (330 mm) Plumb Bob B. Attach vent components to appliance—Secure Vent®36DIRECTVENTSYSTEMCOMPONENTS are unitized concentric pipe components FEATURINGPOSITIVETWISTLOCKCONNECTIONSsee Figure 17). All of the appliances covered in this document ARElTTEDWITHCOLLARSHAVINGLOCKINGINCLINED channels. The dimpled end of the vent compoNENTSlTOVERTHEAPPLIANCECOLLARTOCREATETHE POSITIVETWISTLOCKCONNECTION Arrow Align the dimple (four places) of the upper vent section with the opening of the locking incline channel on the lower vent section or appliance collar. Twist vent component clockwise to engage and seal until arrow and dimple align. Dimple Locking Incline Channel Connected Vent Sections Appliance Collar or Vent Section Arrow Figure 17 To attach a vent component to the appliance collar, align the dimpled end over the collar, ADJUSTING THE RADIAL ALIGNMENT UNTIL THE FOUR LOCKING DIMPLES ARE ALIGNED WITH THE INLET OF THEFOURINCLINEDCHANNELSONTHECOLLARrefer to Figure 17). Push the vent component against the collar until it fully engages, then twist the COMPONENT CLOCKWISE RUNNING THE DIMPLES down and along the incline channels until they seat at the end of the channels. The unitized design of the Secure Vent components will ENGAGEANDSEALBOTHTHEINNERANDOUTERPIPE without the need for sealant or screws. If desired AXSCREWMAYBEUSEDATTHEJOINTBUT ITISNOTREQUIREDASTHEPIPEWILLSECURELYLOCK when twisted. C. Attach vent components to each other— /THER VENT SECTIONS MAY BE ADDED TO THE previously installed section in accordance with THE REQUIREMENTS OF THE VERTICAL VENT lGURES AND TABLES 4O ADD ANOTHER VENT COMPONENT to a length of vent run, align the dimpled end over the inclined channel end of the previously INSTALLEDSECTIONADJUSTINGTHERADIALALIGNMENT UNTILTHEFOURLOCKINGDIMPLESAREALIGNEDWITH the inlets of the four incline channels of the previous section. 14 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% Push the vent component against the previous section until it fully engages, then twist the COMPONENTCLOCKWISERUNNINGTHEDIMPLESDOWN and along the incline channels until they seat at the end of the channels. This seating position is indicated by the alignment of the arrow and dimple as shown in Figure 17. D. Install firestop/spacer at ceiling—7HEN USING3ECURE6ENTUSE36"&lRESTOPSPACER ATCEILINGJOISTS)FTHEREISLIVINGSPACEABOVE THE CEILING LEVEL THE lRESTOPSPACER MUST BE INSTALLEDONTHEBOTTOMSIDEOFTHECEILING)FATTIC SPACEISABOVETHECEILINGTHElRESTOPSPACER MUSTBEINSTALLEDONTHETOPSIDEOFTHEJOIST Route the vent sections through the framed OPENING AND SECURE THE lRESTOPSPACER WITH DNAILSOROTHERAPPROPRIATEFASTENERSATEACH corner. Remember to maintain 1" (25 mm) clearance to combustibles, framing members, and attic or ceiling insulation when running vertical chimney sections. Attic insulation shield (H3908) may be used to obtain the required clearances indicated here. See installation accessories on Page 30. The gap BETWEENTHEVENTPIPEANDAVERTICALlRESTOP CANBESEALEDWITHNONCOMBUSTIBLECAULKING E. Support the vertical vent run sections— NOTE: Proper venting support is very important. The weight of the vent must not be supported by the fireplace in any degree. Support the vertical portion of the venting SYSTEMEVERYFEETMABOVETHElREPLACE vent outlet. Blocking Support Straps (Plumber's tape) 8 feet (2.4 m) Maximum 1" (25.4 mm) minimum clearance to combustibles Figure 18 )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 /NEMETHODOFSUPPORTISBYUTILIZINGlELDPROVIDEDSUPPORTSTRAPSCONVENTIONALPLUMBERgS TAPE3ECURETHEPLUMBERgSTAPETOTHEFRAMING MEMBERSWITHNAILSORSCREWS Strap the tape around the vent, securing the ends of the tape to the framing. If desired, sheet metal screws X LENGTH MAY BE USED TO SECURE THE support straps to the vent pipe. See Figure 18 on Page 14. F. Change vent direction to horizontal/inclined run—At transition from or to a horizontal/ INCLINEDRUNINSTALLTHE36%AND36% ELBOWSINTHESAMEMANNERASTHESTRAIGHTVENT SECTIONS4HEELBOWSFEATUREATWISTSECTIONTO ALLOWTHEMTOBEROUTEDABOUTTHECENTERAXIS of their initial collar section to align with the REQUIREDDIRECTIONOFTHENEXTVENTRUNELEMENT Twist elbow sections in a clockwise direction only so as to avoid the possibility of unlocking any of the previously connected vent sections. See Figure 17 on Page 14 and Figure 19. C D Framing Dimensions for Roof Inches (millimeters) Pitch C D 0/12 13" (330 mm) 13" (330 mm) 6/12 13" (330 mm) 15-1/2" (394 mm) 12/12 13" (330 mm) 20-1/2" (541 mm) K. Install the vertical termination—4HElNAL step involves installation of the Vertical TerminaTION%XTENDTHEVENTSECTIONSTOTHEHEIGHTAS SHOWNINTHE6ERTICALVENTTERMINATIONSECTION on Page 64HE366426ERTICAL4ERMINATION Figure 22)CANBEINSTALLEDINTHEEXACTSAME fashion as any other Secure Vent® section. Align the termination over the end of the previously INSTALLEDSECTIONADJUSTINGTHERADIALALIGNMENT UNTILTHEFOURLOCKINGDIMPLESOFTHETERMINATION are aligned with the inlets of the four incline channels of the last vent section. Push the termination down until it fully engages, then twist THETERMINATIONCLOCKWISERUNNINGTHEDIMPLES down and along the incline channels until they seat at the end of the channels. Figure 20—Roof Framing 10" (254mm) 6" (153mm) Swivel Joint (360° swivel) SV8E45 (45° Elbow) Swivel Joint (360° swivel) SV8E90 (90° Elbow) Figure 19 G. Continue installation of horizontal/inclined sections—Continue with the installation of the straight vent sections in horizontal/inclined run ASDESCRIBEDINStep C. Install support straps EVERYFTMMALONGHORIZONTALINCLINED VENTRUNSUSINGCONVENTIONALPLUMBERSTAPE See Page 17, Figure 26. It is very important that the horizontal/inclined RUNBEMAINTAINEDIN ASTRAIGHTNODIPSSLIGHTLYELEVATEDPLANE4HE RECOMMENDEDINCLINEISAPPROXIMATELYPER FOOTMMPERMETERHORIZONTALINADIRECTION AWAYFROMTHElREPLACE4HERISEPERFOOTRUN RATIOSTHATARESMALLERAREACCEPTABLEALLTHEWAY DOWNTOATORNEARLEVEL5SEACARPENTERSLEVEL TOMEASUREFROMACONSTANTSURFACEANDADJUST the support straps as necessary. I. Install the roof flashing—%XTEND THE VENT sections through the roof structure. Install the roof flashing over the vent section and position such that the vent column rises vertically USECARPENTERSLEVEL(Figure 21). Nail along PERIMETERTOSECUREmASHINGORADJUSTROOlNGTO overlap the flashing edges at top and sides only ANDTRIMWHERENECESSARY3EALTHETOPANDBOTH SIDESOFTHEmASHINGWITHWATERPROOFCAULKING J. Install the storm collar—Install the storm collar, supplied with the flashing, over the vent/ mASHINGJOINTSEEFigure 21). ,OOSENTHESTORM collar screw. Slide collar down until it meets THETOPOFTHEmASHING4IGHTENTHEADJUSTING SCREW !PPLY NONCOMBUSTIBLE CAULKING OR MASTICAROUNDTHECIRCUMFERENCEOFTHEJOINT to provide a water tight seal. Flashing Figure 22 )FTHEVENTSYSTEMEXTENDSMORETHANFEET MABOVETHEROOFmASHINGSTABILIZERSMAYBE NECESSARY!DDITIONALSCREWSMAYBEUSEDAT SECTIONJOINTSFORADDEDSTABILITY'UIDEWIRES MAYBEATTACHEDTOTHEJOINTFORADDITIONALSUPPORTONMULTIPLEJOINTCONlGURATIONS Storm Storm Collar Collar It is important to maintain the required clearances to combustibles: 1" (25 mm) at all sides for all vertical runs; and 3" (76 mm) at the top, 1" (25 mm) at sides, and 1" (25 mm) at the bottom for all horizontal/inclined runs. H. Frame roof opening—Identify location for vent at the roof. Cut and/or frame opening per 2OOF&RAMING#HART(Figure 20). Figure 21 15 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 VERTICAL VENT FIGURES/TABLES NOTES: s 3ECURE6ENT® (rigid vent pipe) is shown in the figures. s )T IS VERY IMPORTANT THAT THE HORIZONTAL inclined run be maintained in a straight (no dips), slightly elevated plane. The recommended incline is approximately 1/4" per foot (20 mm per meter) horizontal, in a direction away from the fireplace. The rise per foot run ratios that are smaller are acceptable all the way down to at or near level. s SV8BF (Secure Vent) firestop/spacer must be used anytime vent pipe passes through a combustible floor or ceiling. SV8HF (Secure Vent) firestop/spacer must be used anytime vent pipe passes through a combustible wall. s Two 45º elbows may be used in place of one 90º elbow. The same rise to run ratios, as shown in the venting figures for 90º elbows, must be followed if 45º elbows are used. Table A V Minimum H Maximum H Ceiling Firestop/Spacer (SV8BF) feet (meter) feet (meter) 10 (3.1) 2.5 (0.762) 15 (4.65) 3.5 (1.07) 20 (6.2) 4.5 (1.37) V + V1 + H = 40 feet (12.4 meters) Max. V + V1 = 11 feet (3.3 meters) Minimum for 40 in. units V + V1 = 10.5 feet (3.2 meters) Minimum for 45 in. units V1 V Example: If 20 feet of (H) horizontal vent run is needed, then 4-1/2 feet minimum of (V) vertical vent will be required. A Vent Restrictor, as shown in Figure 14 on Page 12, must be used in this application. Figure 24—Top Vent—Two 90 Degree Elbows (Corner Framing with Square Termination (SV8HTS)) Ceiling Firestop/Spacer (SV8BF) 40 feet (12.2 meters) Maximum 6 feet (1.8 meters) Minimum Ceiling Firestop/Spacer (SV8BF) V1 Wall Firestop/Spacer (SV8HF) H H1 V A Vent Restrictor, as shown in Figure 15 on Page 12, may need to be used in this application Figure 23—Top Vent—Straight Table B V Minimum H + H1 Maximum feet (meter) feet (meter) 10 (3.1) 2.5 (0.762) 15 (4.65) 3.5 (1.06) 20 (6.2) 4.5 (1.37) H + H1 = 20 feet (6.2 m) Max. V + V1 + H + H1 = 40 ft. (12.4 m) Max. V + V1 = 11 feet (3.3 meters) Min. for 40 in. units V + V1 = 10.5 feet (3.2 meters) Min. for 45 in. units Figure 25—Top Vent—Three Elbows 16 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% A Vent Restrictor, as shown in Figure 14 on Page 12, must be used in this application. Example: If 20 feet of (H+ H1) horizontal vent run is needed, then 4-1/2 feet minimum of (V) vertical vent will be required. )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 HORIZONTAL (OUTSIDE WALL) TERMINATION SYSTEM See Figures 26–31 and their associated (ORIZONTAL6ENTTABLESTHATILLUSTRATETHEVARIOUSHORIZONTALVENTINGCONlGURATIONSTHATARE POSSIBLEFORUSEWITHTHESEAPPLIANCESSecure Vent® pipe applications are shown in these &IGURES ! (ORIZONTAL 6ENT TABLE SUMMARIZES EACHSYSTEMSMINIMUMANDMAXIMUMVERTICAL ANDHORIZONTALLENGTHVALUESTHATCANBEUSED to design and install the vent components in a variety of applications. Support Brackets Building Support Framing Horizontal / Inclined Run SV8E90 Elbow SV8 L6/12/24/36/48 Vent Sections Ceiling Vertical Rise Firestop/Spacer Support Bracket Spacing Every 3 ft (914 mm) A. Plan the vent run. Analyze the vent routing and determine the TYPES AND QUANTITIES OF SECTIONS REQUIRED MMMM MMMMANDMMNET SECTIONLENGTHSAREAVAILABLE)TISRECOMMENDED THATYOUPLANTHEVENTINGSOTHATAJOINTDOESNOT OCCURINTHECEILINGORROOFJOISTS!LLOWFORELBOWS as indicated in Figure 20 on Page 15. Maintain a minimum 1" (25 mm) clearance to combustibles on the vertical sections. Clearances for the horizontal runs are; 3" (76 mm) on top, 1" (25 mm) on sides, and 1" (25 mm) at the bottom. B. Frame exterior wall opening—,OCATETHE CENTER OF THE VENT OUTLET ON THE EXTERIOR WALL according to the dimensions shown in Figure 11 on Page 10. Cut and/or frame an opening, XMMXMMINSIDEDIMENSIONSWITHABOVECENTERANDBELOWCENTER C. Frame ceiling opening—If the vertical ROUTEISTOPENETRATEACEILINGUSEPLUMBLINE TOLOCATETHECENTERABOVETHEAPPLIANCE#UT ANDORFRAMEANOPENINGXMMX MMINSIDEDIMENSIONSABOUTTHISCENTER REFERTOFigure 17 on Page 14). D. Attach vent components to appliance—To attach a vent component to the appliance collar, ALIGNTHEDIMPLEDENDOVERTHECOLLARADJUSTINGTHERADIALALIGNMENTUNTILTHEFOURLOCKING dimples are aligned with the inlets of the four INCLINECHANNELSONTHECOLLARrefer to Figure 16 on Page 14). Exterior Wall SV8HTS Termination Shown 2-1/2 Foot Vertical Vent (min.) The horizontal vent system terminates through ANOUTSIDEWALL"UILDING#ODESLIMITORPROHIBIT TERMINATINGINSPECIlCAREAS2EFERTOFigure 6 on Page 7 for location guidelines. Secure Vent36DIRECTVENTSYSTEMCOMPOnents are unitized concentric pipe components FEATURINGPOSITIVETWISTLOCKCONNECTIONrefer to Figure 17 on Page 14). All of the appliANCESCOVEREDINTHISDOCUMENTARElTTEDWITH COLLARSHAVINGLOCKINGINCLINEDCHANNELS4HE DIMPLEDENDOFTHEVENTCOMPONENTSlTOVER the appliance collar to create the positive twist LOCKCONNECTION SV8HTS Termination Shown Fireplace Exterior Wall Support the vertical portion of the venting system every 8 feet (2.4m) above the fireplace vent outlet. Figure 26—Typical Horizontal Vent Installation Push the vent component against the collar until it fully engages, then twist the component CLOCKWISERUNNINGTHEDIMPLESDOWNANDALONG the incline channels until they seat at the end of the channels. The unitized design of the Secure VentCOMPONENTSWILLENGAGEANDSEALBOTHTHE inner and outer pipe elements with the same procedure. Sealant and securing screws are NOTREQUIRED E. Attach vent components to each other— /THERVENTSECTIONSMAYBEADDEDTOTHEPREVIously installed section in accordance with the REQUIREMENTSOFTHEVENTTABLES4OADDANOTHER vent component to a length of vent run, align the dimpled end of the component over the inclined channel end of the previously installed SECTIONADJUSTINGTHERADIALALIGNMENTUNTILTHE FOURLOCKINGDIMPLESAREALIGNEDWITHTHEINLETS of the four incline channels of the previous section. Push the vent component against the previous section until it fully engages, then TWIST THE COMPONENT CLOCKWISE RUNNING THE dimples down and along the incline channels until they seat at the end of the channels. This seating position is indicated by the alignment of the arrow and dimple as shown in Figure 17 on Page 14. F. Install firestop/spacer at ceiling—7HEN using Secure VentUSE36"&lRESTOPSPACER ATCEILINGJOISTS)FTHEREISLIVINGSPACEABOVE THECEILINGLEVELTHElRESTOPSPACERMUSTBE INSTALLEDONTHEBOTTOMSIDEOFTHECEILING)F ATTIC SPACE IS ABOVE THE CEILING THE lRESTOP SPACER MUST BE INSTALLED ON THE TOP SIDE OF THEJOIST2OUTETHEVENTSECTIONSTHROUGHTHE FRAMEDOPENINGANDSECURETHElRESTOPSPACER WITHDNAILSOROTHERAPPROPRIATEFASTENERSAT each corner. Remember to maintain 1" (25 mm) clearance to combustibles, framing members, and attic or ceiling insulation when running vertical chimney sections. ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% G. Support the vertical run sections—See Step E on Page 14. H. Change vent direction—At transition from or TOAHORIZONTALINCLINEDRUNINSTALLTHE36% AND36%ELBOWSINTHESAMEMANNERASTHE STRAIGHTVENTSECTIONS4HEELBOWSFEATUREATWIST SECTIONTOALLOWTHEMTOBEROUTEDABOUTTHE CENTERAXISOFTHEIRINITIALCOLLARSECTIONTOALIGN WITHTHEREQUIREDDIRECTIONOFTHENEXTVENTRUN element. Twist elbow sections in a clockwise direction only so as to avoid the possibility of unlocking any of the previously connected vent sections (see Figure 17 on Page 14). I. Continue installation of horizontal/inclined sections—Continue with the installation of the straight vent sections in horizontal/inclined RUNASDESCRIBEDINStep E on Page 14. Install SUPPORTSTRAPSEVERYFEETMMALONG horizontal/inclined vent runs using conventional PLUMBERSTAPE See Figure 26, It is very important that the horizontal/inclined run be maintained in a straight (no dips), slightly elevated plane. The recommended incline is approximately 1/4" per foot (20 mm per meter) horizontal, in a direction away from the fireplace. The rise per foot run ratios that are smaller are acceptable all the way down to at or near level. It is important to maintain the required clearances to combustibles: 1" (25 mm) at all sides for all vertical runs; and 3" (76 mm) at the top, 1" (25 mm) at sides, and 1" (25 mm) at the bottom for all horizontal/inclined runs. 5SE A CARPENTERS LEVEL TO MEASURE FROM A CONSTANTSURFACEANDADJUSTTHESUPPORTSTRAPS as necessary. 17 )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 J. Assemble vent run to exterior wall—If not previously measured, locate the center of the VENTATTHEEXTERIORWALL0REPAREANOPENINGAS DESCRIBEDINStep B on Page 17!SSEMBLETHE vent system to point where the terminus of the LASTSECTIONISWITHINMMTO MMINBOARDOFTHEEXTERIORSURFACETOWHICH THE36(43TERMINATIONISTOBEATTACHEDSEE Figure 29 and Table 9 on Page 19. If the terminus of the last section is not within this distance, use the telescopic vent section SV8LA, ASTHELASTVENTSECTION&ORWALLTHICKnesses greater than that shown in Figure 28, refer to Table 9 on Page 19 4HIS TABLE LISTS THEADDITIONALVENTINGCOMPONENTSNEEDEDIN ADDITIONTOTHETERMINATIONANDADAPTORFORA PARTICULARRANGEOFWALLTHICKNESSES K. Attach termination adaptor—Attach the ADAPTORADAPTOR362#(PROVIDEDWITHTHE TERMINATIONTOTHEVENTSECTIONORTELESCOPING VENTSECTIONORELBOWASSHOWNINFigure 27 in the same manner as any SV vent component REFERTOStep E on Page 17). To help minimize water infiltration it is recommended theinfiltration Firestop/ To help minimizethat water Spacer be installed on the install(SV4.5HF) the Firestop/Spacer (SV4.5HF) exterior of the on the side exterior sidewall. of the wall. 15 in. (381 mm) 3 in. (76 mm) 1 in. (25 mm) Adaptor SV8RCH 1 in. (25 mm) 6–48 in. Vent Section, Telescopic vent section. NOTE: Centerline of Vent Piping is NOT the Same as the Centerline of the Framed Opening. See Figure 12 on Page 10 for Minimum See other side for minimum Distance to Base of Appliance distance to base of appliance. Base of Appliance Figure 27—Installing the Square Horizontal Termination (SV8HTS) Minimum wall thickness 5” (127 mm) Maximum wall thickness 8-1/2” (216 mm) Interior Surface of Finished Wall Siding 4HE&IRESTOP3PACERMAYALSOBEINSTALLEDOVER THEOPENINGATTHEINTERIORSIDEOFTHEFRAMING IMPORTANT: The vent termination is hot while in operation and for a period of time following the use of the fireplace. Young children should be carefully supervised when they are in the same area as a hot termination. 13 in. (330mm) 6-1/2 in. (165 mm) L. Install Firestop/Spacer at exterior wall —7HENUSINGTHESQUARE termination, install 36(&&IRESTOP3PACEROVERTHEOPENINGATTHE EXTERIORSIDEOFTHEFRAMINGLONGSIDEUPWITH THESPACERCLEARANCEATTHETOPASSHOWNIN Figure 27, and nail into place. M. Install the square termination (SV8HTS)— &OR THE LAST STEP FROM OUTSIDE THE EXTERIOR wall, slide the collars of the termination onto THEADAPTORTHEOUTEROVERTHEOUTERANDTHE INNER INSIDE THE INNER UNTIL THE TERMINATION SEATSAGAINSTTHEEXTERIORWALLSURFACETOWHICH IT WILL BE ATTACHED /RIENT THE HOUSING OF THE termination with the arrow pointed upwards. 3ECURETHETERMINATIONTOTHEEXTERIORWALLThe horizontal termination must not be recessed into the exterior wall or siding by more than the 1-1/4" (32 mm) as shown in Figure 28. 8-1/2 in. (216 mm) SV8HTS Termination Shown. Maximum Extent of Vent Run Sections to Exterior Surface of Framing Last Vent Section. Use Telescopic Vent Section (SV8LA), If Necessary SV8HTS Square Termination shown Exterior Surface of Siding Exterior Surface of Framing 5” to 8-1/2” (127 to 216 mm) SV8HTS Square Termination Shown Adaptor SV8RCH Stucco For wall thicknesses greater than 8-1/2", see Table 9 1-1/4” Maximum Recess of Square Termination into Exterior Finishing Material Venting Connection and Exterior Wall Recessing of the Horizontal Square Termination (SV8HTS). Figure 28—Wall Thickness and Horizontal Termination Requirements Horizontal terminations have been designed to perform in a wide range of weather conditions. Our terminations meet or exceed industry standards. When selecting the locations of your horizontal terminations, do not place the termination where water from eaves and adjoining rooflines may create a heavy flow of cascading water onto the termination cap. If the cap must be placed where the possibility of cascading water exists, it is the responsibility of the builder to direct the water away from the termination cap by using gutters or other means. Take care to carefully follow the installation instructions for the termination, including the use of silicone caulking where required. 18 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 See Table 9 as an aid in venting component selection for a particular range of exterior wall thicknesses. Venting Components Required for Various Exterior Wall Thicknesses, when using Square Termination Kit (SV8HTS—see Figure 28) Vent Components Required Exterior Wall Thickness—inches (mm) 4ERMINATION+IT/NLY TOTO 4ERMINATION +IT AND 6ENT 3ECTION36, TOTO 4ERMINATION +IT AND 4ELESCOPIC3ECTION36,! TOTO 4ERMINATION +IT AND 4ELESCOPIC3ECTION36,!AND VENTSECTION36, TOTO Table 9 Table C V Minimum H Maximum feet (meter) feet (meter) 3.5 (1.07) 2.5 (0.762) 6.5 (1.98) 3.5 (1.07) 8.5 (2.6) 4.5 (1.37) 10.5 (3.2) 5.5 (1.68) 12.5 (3.8) 6.5 (1.98) 14.5 (4.4) 7.5 (2.3) 16.5 (5.0) 8.5 (2.6) 18.5 (5.6) 9.5 (2.9) 20 (6.0) 10 (3.0) HORIZONTAL VENT FIGURES/TABLES NOTES: s 3ECURE6ENT® components (rigid vent pipe and terminal) are shown in the figures. s Two 45º elbows may be used in place of one 90º elbow. The same rise to run ratios, as shown in the venting figures for 90º elbows, must be followed if 45º elbows are used. s SV8BF (Secure Vent) firestop/spacer must be used anytime vent pipe passes through a combustible floor or ceiling. SV8HF (Secure Vent) firestop/spacer must be used anytime vent pipe passes through a combustible wall. s )TISVERYIMPORTANTTHATTHEHORIZONTALINCLINEDRUNBEMAINTAINED in a straight (no dips), slightly elevated plane. The recommended incline is approximately 1/4" per foot (20 mm per meter) horizontal, in a direction away from the fireplace. The rise per foot run ratios that are smaller are acceptable all the way down to at or near level. Example: If 20 feet of (H) horizontal vent run is needed, then 10 feet minimum of (V) vertical vent will be required. H V Wall Firestop/Spacer (SV8HF) V + H = 40 feet (12.4 m) Max. H = 20 ft. (6.2 m) Max. Ceiling Firestop/Spacer (SV8BF) Square termination (SV8HTS) shown. See Table 9 as an aid in venting component selection for APARTICULARRANGEOFEXTERIORWALLTHICKNESSES Figure 29—Top Vent—One 90 Degree Elbow (Elbow Connection Not Directly at Appliance) 19 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 HORIZONTAL VENT FIGURES/TABLES (continued) Wall Firestop/Spacer (SV8HF) Table D H + H1 Maximum H H1 V Wall Firestop/Spacer (SV8HF) Ceiling Firestop/Spacer (SV8BF) V Minimum feet (meter) feet (meter) 3.5 (1.07) 2.5 (0.762) 6.5 (1.98) 3.5 (1.07) 8.5 (2.6) 4.5 (1.37) 10.5 (3.2) 5.5 (1.68) 12.5 (3.8) 6.5 (1.98) 14.5 (4.4) 7.5 (2.3) 16.5 (5.0) 8.5 (2.6) 18.5 (5.6) 9.5 (2.9) 20 (6.0) 10 (3.0) V + H + H1 = 40 feet (12.4 m) Max. H + H1 = 20 ft. (6.2 m) Max. See Table 9 on Page 19 as an aid in venting component selection for a particular range of EXTERIORWALLTHICKNESSES Figure 30—Top Vent—Two 90 Degree Elbows Table E H + H1 = 20 feet (6.2 m) Max. V + V1+ H + H1 = 40 ft. (12.4 m) Max. H1 V = 2.5 feet Min. (0.762 m) V + V1 = 11 feet (3.35 m) Min. for 40 in. units V + V1 = 10.5 feet (3.2 m) Min. for 45 in. units Ceiling Firestop/Spacer (SV8BF) Wall Firestop/Spacer (SV8HF) H V1 V Wall Firestop/Spacer (SV8HF) Ceiling Firestop/Spacer (SV8BF) See Table 9 on Page 19ASANAIDINVENTINGCOMPONENTSELECTIONFORAPARTICULARRANGEOFEXTERIORWALLTHICKNESSES Figure 31—Top Vent—Three 90 Degree Elbows 20 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 Step 4. FIELD WIRING Verify proper operation after servicing. S’assurer que l’appareil fonctionne adéquatement une fois l’entretien terminé. CAUTION Ground supply lead must be connected to the wire attached to the green ground screw located on the outlet box. Failure to do so will result in a potential safety hazard. The appliance must be electrically grounded in accordance with local codes or, in the absence of local codes, the National Electrical Code, ANSI/NFPA 70-latest edition. (In Canada, the current CSA C22-1 Canadian Electrical Code). 6)NSTALLTHEWALLMOUNTED/./&&CONTROLAS DESCRIBED IN )NSTALLING AND INITIALIZING THE 2EMOTE#ONTROL3YSTEMONPage 22, in a CONVENIENTLOCATIONNEARTHElREPLACE 7. After the wiring is complete, replace the cover plate. Ground - Green Neutral - White 120 VAC - Black The gas valve is set in place and pre-wired at the factory. Electronic Wiring NOTE: The electronic appliance must be connected to the main power supply. 1 2OUTE A WIRE 6AC (Z PH POWER SUPPLYTOTHEAPPLIANCEJUNCTIONBOX Junction Box 2. Remove the electrical inlet cover plate from THESIDEOFTHEUNITBYREMOVINGTHEPLATEgS SECURINGSCREWSsee Figure 11 on Page 10). Black Tab Intact Hot Side of Receptacle White 3 2EMOVETHECOVERPLATEgSKNOCKOUTANDTHEN FEEDTHEPOWERSUPPLYWIRETHROUGHTHEKNOCKOUTOPENINGANDINTOTHEUNITJUNCTIONBOX CAUTION: Label all wires prior to disconnection when servicing controls. Wiring errors can cause improper and dangerous operation. ATTENTION: Au moment de l’entretien des commandes, étiquetez tous les fils avant de les débrancher. Des erreurs de cáblage peuvent entraîner un fonctionnement inadéquat et dangereux. Green 4 #ONNECTTHEBLACKPOWERSUPPLYWIRETOTHE power outlet's red pigtail lead and the white power supply wire to the common terminal of the outlet as shown in Figures 32 and 33. Neutral Side of Receptacle Tab Intact Green Ground Screw Field Wired 5. Connect the ground supply wire to the pigtail lead attached to outlet's green ground screw. Factory Wired Figure 33—J-BOX WIRING ELECTRONIC WIRING DIAGRAM Flame Sensor IPI Pilot (Schematic representation only) Spark Electrode A wiring diagram is provided here for reference purposes only. This information is also provided on schematics attached directly to the appliance on a pullout panel located within the control compartment. COLOR CODE: B = Black BB = Brown w/Black Stripe BG = Brown w/Green Stripe BL = Blue BR = Brown G = Green GY = Gray O = Orange R = Red W = White Y = Yellow J-BOX/RECEPTIACLE WIRING 120V, 60HZ, 1PH Pilot Tube B Optional Split Flow 885 Valve Main Wire Harness BR Note: On models without pressure switch, these connectors are plugged together. BatteryHolder Holder with Switch Battery w/Switch ON/Remote/OFF ON/ Remote /OFF Y B G Y B O R Battery Holder Wire Harness BL G Air Pressure Switch Power Vent Only O Ground Y G BL W R R B Reset Switch (See instructions.) Control Module B GR WH B B W G Power Vent Blower Power Vent Models Only G B W Main Power Cord 580489-01 Figure 32 Fuse ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% 21 )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 Installing and initializing the Remote Control System REQUIRED ITEMS (not provided): s3TANDARD*UNCTION"OX s0APER#LIPORSIMILAROBJECTFORREMOTE CONTROLSYSTEMINITIALIZATION Installing and Wiring the Receiver (Wall Switch) The receiver for the Total Comfort Control™ Remote Control System connects directly to the gas valve, stepper motor, and fan control MODULEWITHANUMBILICALCORDWIRINGHARNESS )NSTALL A JUNCTION BOX NOT PROVIDED ON THEWALLADJACENTTOTHEAPPLIANCEWITHIN REACHOFTHEREMOTESYSTEMUMBILICALCORD wiring harness. Position the 6-pin termiNALWITHINTHEJUNCTIONBOXINPREPARATION for attachment to the remote receiver. 7HENWALLlNISHISCOMPLETEINSTALLTHE RECEIVERINTHEPREVIOUSLYINSTALLEDJUNCTIONBOXANDCONNECTTHEPINTERMINAL TOTHEPINCONNECTORONTHEBACKOFTHE receiver. )NSTALLTHERECEIVERCOVERPLATETAKINGCARE to ensure the receiver switch is properly INDEXEDWITHTHESWITCHCOVERWHENALIGNing the components for attachments. The remote control system provides remote OPERATIONOFTHEFOLLOWINGlREPLACEFUNCTIONS s0RIMARYBURNER/./&& s&LAME HEIGHT AND HEAT OUTPUT ADJUSTMENT SIXLEVELS The receiver accepts commands via radio FREQUENCYFROMTHETRANSMITTERANDDOESNOT REQUIRELINEOFSIGHTOPERATION 4HESLIDERSWITCHONTHERECEIVERCANBESETTO one of three positions: s/.MANUALOVERRIDE s/&&MANUALOVERRIDE s2%-/4%REMOTECONTROL 3EETHElREPLACE#AREAND/PERATION)NSTRUCtions for detailed instructions on using the REMOTECONTROLSYSTEMTOOPERATETHElREPLACE Three-position slider switch in REMOTE position On Remote Off PRG Initializing the Remote Control System !FTERCOMPLETINGlREPLACEINSTALLATIONINITIALIZE THE REMOTE CONTROL SYSTEM BEFORE OPERATING THElREPLACE )NSERTTHETHREEPROVIDED!!!BATTERIES INTOTHEBATTERYBAYINTHETRANSMITTERTAKINGCARETOCORRECTLYALIGNPOLARITY+ )NSERTTHEFOURPROVIDED!!BATTERIES INTOTHERECEIVERBATTERYBAYBEHINDTHE WALLSWITCHPLATETAKINGCARETOCORRECTLY ALIGNPOLARITY+ 6. On the receiver, place the three-position SLIDER SWITCH IN THE 2%-/4% POSITION (Figure 34). /NTHERECEIVERFRONTCOVERINSERTTHEEND OFAPAPERCLIPOROTHERSIMILAROBJECTNOT PROVIDEDINTOTHEHOLEMARKEDh02'v 4HE RECEIVER WILL hBEEPv THREE TIMES TO indicate it is ready to synchronize with the transmitter. Figure 34—Receiver (Wall Switch) LCD Display ON/OFF Key ING WARN Cause e Will eplac Hot Firre Burns ren to Seve Child er Fireoth r Allow Neve Glass or h Touc Parts place ROOM TEMP. Key UP/DOWN Arrow Key MODE Key Figure 35—Transmitter (Remote Control) /NTHETRANSMITTERPRESSTHE/.BUTTON 4HE RECEIVER WILL hBEEPv FOUR TIMES TO INDICATE ACCEPTANCE OF THE TRANSMITTERS COMMAND AND SET THE RECEIVER TO THE TRANSMITTERSSPECIlCCODE4HESYSTEM is now initialized. 22 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% WARNING Fire hazard. Can cause severe injury or death. The receiver causes ignition of the appliance. The appliance can turn on suddenly. Keep away from the appliance burner when operating the remote system or activating manual bypass of the remote system. CAUTION Property damage hazard. Excessive heat can cause property damage. The appliance can stay lit for many hours. Turn off the appliance if it is not going to be attended for any length of time. Always place the transmitter where children can not reach it. )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 Step 5. REMOVE GLASS DOOR FRAME 2EMOVETHEGLASSDOORASSEMBLY3EEInstallation and Removal of Glass Door on Page 26. Step 6. CONNECTING GAS LINE A.,IGHT THE APPLIANCE REFER TO THE LIGHTING INSTRUCTIONSLABELINTHECONTROLCOMPARTMENT or in the Care and Operation Instructions MANUAL B. "RUSHALLJOINTSANDCONNECTIONSWITHTHEGAS LEAKTESTSOLUTIONTOCHECKFORLEAKS)FBUBBLES are formed, or gas odor is detected, turn the RECEIVERORREMOTECONTROLTOTHEh/&&vPOSITION %ITHERTIGHTENORREFASTENTHELEAKINGCONNECTION THENRETESTASDESCRIBEDABOVE C. 7HENTHEGASLINESARETESTEDANDLEAKFREE BESURETORINSEOFFTHELEAKTESTINGSOLUTION D. 2EINSTALLTHEACCESSPLATEMAKINGCERTAINTHE GASKETHASNOTBEENDAMAGED Right Side Modesty Panel Access Plate !LLCODESREQUIREASHUTOFFVALVEMOUNTEDINTHE supply line. The orientation of the shut-off valve should face the front. Figure 36 illustrates two methods for connecting the gas supply. A Sediment Trap is recommended to prevent moisture ANDDEBRISINGASLINEFROMDAMAGINGTHEVALVE 4HEmEXLINEMETHODISACCEPTABLEINTHE53! where local codes permit, however, Canadian REQUIREMENTSVARYDEPENDINGONLOCALITY)NSTALLATIONMUSTBEINCOMPLIANCEWITHLOCALCODES 4HESEAPPLIANCESAREEQUIPPEDWITHAGASmEX line for use in connecting the unit to the gas line. See Figure 36 FORmEXLINEDESCRIPTION4HE mEXLINEISRATEDFORBOTHNATURALANDPROPANE gas. A manual shut off valve is also provided WITHTHEmEXLINE The gas control valve is located on the right side of the unit. 7HENUSINGSOLIDGASLINECONNECTORACCESS THEVALVEBYREMOVINGTHEFRONTDOORASSEMBLY on the valve access side and the access plate see Figure 37). 4HEELECTRONICCONTROLVALVEHASAMM NPT thread gas supply inlet. "RINGTHESHUTOFFVALVEONTHEENDOFTHEmEXLINE over to the hard pipe and tighten with wrenches FROMABOVETHROUGHTHElREBOXOPENING Secure all joints tightly using appropriate tools and sealing compounds (ensure propane resistant compounds are used in propane applications). It is recommended to seal around the gas line to prevent cold air leakage. Gas Valve Step 7. CHECKING APPLIANCE OPERATION Figure 37 TEST ALL CONNECTIONS FOR GAS LEAKS (FACTORY AND FIELD): WARNING Never use an open flame to check for leaks. 4URNONGASSUPPLYANDTESTFORGASLEAKSUSINGA GASLEAKTESTSOLUTIONALSOREFERREDTOASBUBBLE LEAKSOLUTION NOTE: Using a soapy water solution is an effective leak test solution but it is not recommended, because the soap residue that is left on the pipes/fittings can result in corrosion over time. Gas Flex Line Connector Gas Valve 4URN ON BURNER THEN OBSERVE THE INDIVIDUAL TONGUESOFmAMEONTHEBURNER-AKESUREALL ports are open and producing flame evenly ACROSSTHEBURNER)FANYPORTSAREBLOCKEDOR PARTIALLYBLOCKEDCLEANOUTTHEPORTS 7ITHGASLINEINSTALLEDRUNINITIALSYSTEMCHECKOUTBEFORECLOSINGUPTHEFRONTOFTHEUNIT&OLLOW the lighting instructions provided in the Care and Operation Instructions manual. NOTE: Lighting Instructions are also found on the literature tag tied to the bracket above the gas valve. To access the tag, reach into the right side opening. 7HENlRSTLIGHTINGTHEAPPLIANCEITWILLTAKEAFEW minutes for the line to purge itself of air. Once PURGINGISCOMPLETETHEPILOTANDBURNERWILL light and operate as indicated in the instruction MANUAL3UBSEQUENTLIGHTINGOFTHEAPPLIANCEWILL NOTREQUIRESUCHPURGING)NSPECTTHEPILOTmAME REMOVELOGSIFNECESSARYHANDLINGCAREFULLY Electronic Appliance Checkout 4OLIGHTTHEBURNERTURNh/.vTHEOPTIONALREMOTE wall switch or turn the appliance mounted ON/ /&& SWITCH TO THE h/.v POSITION %NSURE THE igniter lights the pilot. The pilot flame should engulf the flame sensor as shown in Figure 38. 3/8" NPT x 1/2" x 3/8" Flare Flare Fitting Shut-off Valve 3/8" Flex Tubing 1/2" x 3/8" Reducer 3/8" Nipple Gas Stub Igniter NOTE: The gas supply line must be installed in accordance with building codes by a qualified installer approved and/or licensed as required by the locality. In the Commonwealth of Massachusetts, installation must be performed by a licensed plumber or gas fitter. 3/8" Union 3/8" Close Nipple 3/8" Shut-off Valve Gas Solid Line Connector Pilot Hood Flame Rod (Sensor) 3" Min *Sediment Trap Figure 38 Figure 36—Gas Connection 23 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 Step 8. INSTALL VOLCANIC STONE, GLOWING EMBERS, AND LOGS (Traditional Only), or GLASS MEDIA (Contemporary Only) NOTE: If installing the Contemporary Burner/Floor Kit, skip this step and instead refer to the instructions provided with the kit. Step 4. Position the individual logs as shown in Figures 42 through 46. ,OGSSHOULDBEPLACEDINTHEORDERSHOWNPlace logs 2 and 3 against the pins on the grate, NOT over them. Proper log and twig placement is critical to encourage outstandINGmAMEAPPEARANCEANDPREVENTSOOTING7HENPOSITIONED PROPERLY AS SHOWN TWIGS WILL BE POSITIONED BETWEEN mAME PEAKSANDWILLNOTIMPINGEANYmAMES Cat. No. WARNING s$/./4OPERATETHISAPPLIANCEWITHOUTTHE required accessories properly installed: - floor (log set or contemporary kit), and - firebox liner panels (ceramic or porcelain). Model Description 88L53 FGE Bag of Glowing Embers 80L42 FDVS Bag of Volcanic Stone H8312 PGE Bag of Platinum Embers Table 10—Firebox Accessories / Parts WARNING s DO NOT attempt to install the logs until the appliance installation has been completed, the gas line connected and tested for leaks and the initial burner operation has been checked out. s The size and position of the log set was engineered to give the appliance a safe, reliable and attractive flame pattern. Any attempt to use a different log set in the fireplace will void the warranty and will result in incomplete combustion, sooting, and poor flame quality. s Logs get very hot and will remain hot up to one hour after gas supply is turned off. Handle only when logs are cool. Turn off all electricity to the appliance before you install grate, volcanic stone, embers and logs. s This appliance is not designed to burn wood. Any attempt to do so could cause irreparable damage to the appliance and prove hazardous to your safety. s If logs are not installed according to the log installation instructions, flame impingement and improper combustion could occur and result in soot and/or excessive production of carbon monoxide (CO), a colorless, odorless, toxic gas. Figure 39 For Propane Gas Only: Do Not Place Embers On Main Ports. Glowing Embers (Rockwool) Figure 40 Step 1. )NSTALL THE CERAMIC OR PORCELAIN lREBOX LINER PANELS PER THE INSTRUCTIONSPROVIDEDINKIT. 24 Step 2. 0LACEVOLCANICSTONEAROUNDTHEBURNERTHEENTIREBAGOFVOLCANIC STONEWILL./4BEUSEDDO NOT PLACE VOLCANIC STONE ON THE BURNER. See Figure 41. Step 3.3EPARATETHEGLOWINGEMBERSROCKWOOLINTOPIECESABOUTTHE SIZEOFAQUARTER(see Figure 39)+EEPTHEPIECESmUFFEDNOT MATTED$ISTRIBUTETHESEPIECESOVERTHEBURNERASSHOWNINFigure 40$ONOTUSEMORETHANNECESSARY7HENPROPERLYPOSITIONED THE'LOWING%MBERSWILLCOVERAPPROXIMATELYOFTHEBURNER ONNATURALGAS&ORPROPANEGASDONOTPLACEEMBERSONMAIN ports. NOTE: Excessive use of embers may result in sooting or poor flame. This appliance is provided with enough Glowing Embers for several applications, do not feel compelled to use all that is in a new bag. For best glowing effect, replace the ember material annually. Replacement Glowing Embers are available (Catalog Number 88L53). Volcanic Stone Figure 41 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 Traditional Only: Log Placement 3 5 6 2 4 1 7 Log Number Description 1 ,OG#ENTER 2 ,OG2EAR ,OG#ENTER,EFT 4 ,OG#ENTER2IGHT 5 ,OG2EAR4OP 6 ,OG&RONT,EFT ,OG&RONT#ENTER 4 3 Engage Logs (3 & 4) With The Grate Pins And Align Groves At The Bottom Of The Logs Over The Grate. Figure 44 - Placing Logs 3 and 4 6 5 Align Hole At Bottom Of Log (5) Over The Pin On Log (2). 7 2 Table 6 - Log Set 1 Engage Log (6) With The Grate Pin And Align Groove At The Bottom Of The Log Over The Grate. Engage Log (7) With The Pin On Log (4). 4 Figure 45 - Placing Logs 5, 6, and 7 Contemporary Only: Glass Media Placement Align Two Holes At Bottom Of Log (1) Over The Pins On The Gas Burner. Figure 42 - Placing Log 1 3PREADATHINLAYEROFTHEMEDIAEVENLYONTHEBURNERAND media screen. 2 Align Groove At The Bottom Of Log (2) Over The Grate And Push It Towards The Rear. Figure 43 - Placing Log 2 Figure 46 - Glass media installed 2. On the corner of the right media screen, arrange the media to allow THEPILOTmAMETOREACHTHEBURNERDURINGLIGHTING ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% 25 )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 Step 9. INSTALLATION AND REMOVAL OF GLASS DOOR WARNING s When reinstalling the glass door, the door latch screws must be securely tightened to prevent the glass door from falling out, which could potentially cause damage and possible injury. s Do not attempt to substitute the materials used on this door, or replace cracked or broken glass. s Handle this glass with extreme care! Glass is susceptible to damage — Do not scratch or handle roughly while reinstalling the glass door frame. s The glass door of this appliance must only be replaced as a complete unit as provided by the manufacturer. Do not attempt to replace broken, cracked or chipped glass separately. s Do not attempt to touch the front enclosure glass with your hands while the fireplace is in use. Installing Glass Enclosure Panel (see Figure 47) Retrieve the glass door. Visually inspect the GASKET ON THE BACKSIDE OF THE FRAME 'ASKET SURFACE MUST BE CLEAN FREE OF IRREGULARITIES ANDSEATEDlRMLY 0OSITIONTHEDOORINFRONTOFTHElREBOXOPENING with the top of the door held away from the lREPLACE(Figure 47),OWERTHEBOTTOMOFTHE DOORASSEMBLYONTHEBOTTOMDOORTRACKAND set on padded surface. Pivot the door up after ENGAGINGANDCENTERINGINTHEBASECHANNEL Using a Phillips screwdriver, fasten the door FRAMETOTHEDOORLATCHWITHTHETWOSCREWS The latch should pull forward to engage the door frame. Install the door modesty shield on top flange GLASSDOORASFOLLOWSGRABTHEDOORMODESTY SHIELD WITH BOTH HANDS WITH THE OPEN HEM going down and engage it with the upper lip OFTHEGLASSDOORFRAMEBYPUSHINGITALLTHE WAY DOWN -AKE SURE THE INSTALLED SHIELD IS lRMLYINPLACE 7ITHTHElRESCREENHANGINGONTHESCREENROD INSERTTHERIGHTSIDEOFTHERODINTOTHEEXISTING HOLEONTHERIGHTMODESTYPANEL"ENDDOWN the rod at the center and drop the left end into THESLOTONTHELEFTMODESTYPANELBEINGCAREFUL not to scratch the paint. Top Flange Glass door assembly Glass Door Latch (2) WARNING Do not operate appliance with the glass front removed, cracked or broken. Screws AVERTISSEMENT Ne pas utiliser l'appareil si le panneau frontal en verre n'est pas en place, est craqué ou brisé. Firebox Floor Step 10. BURNER ADJUSTMENTS Flame Appearance and sooting Proper flame appearance is a flame which is BLUEATTHEBASEANDBECOMESYELLOWISHORANGE INTHEBODYOFTHEmAME7HENTHEAPPLIANCEIS lRSTLITTHEENTIREmAMEMAYBEBLUEANDWILL GRADUALLYTURNYELLOWISHORANGEDURINGTHElRST 15 minutes of operation. After 15 minutes of OPERATIONIFTHEmAMEISBLUEORIFTHEmAMEIS ORANGEWITHEVIDENCEOFSOOTINGBLACKTIPTHE AIRSHUTTEROPENINGMAYNEEDTOBEADJUSTED If the air shutter opening is closed too far, SOOTINGMAYDEVELOP3OOTINGISINDICATEDBY BLACKPUFFSDEVELOPINGATthe tips of very long ORANGEmAMES3OOTINGRESULTSINBLACKDEPOSITS forming on the logs, appliance inside surfaces ANDONEXTERIORSURFACESADJACENTTOTHEVENT termination. 3OOTINGISCAUSEDBYINCOMPLETECOMBUSTION INTHEmAMESANDLACKOFCOMBUSTIONAIRENTERing the air shutter opening. To achieve a warm YELLOWISHORANGE mAME WITH AN ORANGE BODY THATDOESNOTSOOTTHESHUTTEROPENINGMUSTBE ADJUSTEDBETWEENTHESETWOEXTREMES Air Shutter Adjustment Guidelines s )FTHEREISSMOKEORSOOTPRESENTlRSTCHECK the log set positioning to ensure that the flames are not impinging on any of the logs. If the log set is properly positioned and a SOOTING CONDITION STILL EXISTS THEN THE AIR SHUTTEROPENINGSHOULDBEINCREASED s 4HEMOREOFFSETSINTHEVENTSYSTEMTHELARGER THEAIRSHUTTEROPENINGWILLNEEDTOBE s !NAPPLIANCEOPERATEDWITHTHEAIRSHUTTER opened too far, may have flames that appear BLUEANDTRANSPARENT4HESEWEAKBLUEAND transparent flames are termed anemic. s 0ROPANEMODELSMAYEXHIBITmAMESWHICH candle or appear stringy. If this is present ANDPERSISTSADJUSTTHEAIRSHUTTERTOAMORE closed position, then operate the appliance for a few more minutes to ensure that the flame normalizes and the flames do not appear sooty. The following chart is provided to aid you in ACHIEVING THE CORRECT AIR SHUTTER ADJUSTMENT for your installation. Glass Door Assembly Figure 47—Installing the Glass Door Only doors certified with the appliance shall be used. Seules des portes certifiées pour cet appareil doivent être utilisées. WARNING: DO NOT abuse glass door by striking or slamming shut. 26 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% Amount of Primary Air Flame Color Air Shutter Adjustment If air shutter is closed too far Flame will be orange Air shutter gap should be increased If air shutter is open too far Flame will be blue Air shutter gap should be decreased )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 Burner Air Shutter Adjustment Procedure Air Shutter Opening WARNING s Air shutter adjustment should only be performed by a qualified professional service technician. s Ensure that the front glass door assembly is in place and sealed After adjustment. Main Burner Factory Air Shutter Opening Setting—Inches (millimeter) Model Nat.Gas Propane Gas 40 in. 1/16 (1.59) 9/32 (7.14) 45 in. 1/16 (1.59) 9/32 (7.14) Venturi Orifice Gas Valve Burner CAUTION Soot will be produced if the air shutter is closed too much. Any damage due to carboning resulting from improperly setting the air shutter is not covered under the warranty. Venturi Figure 48 Contemporary Media Shown 4OADJUSTTHEmAMEROTATETHEAIRSHUTTERTOWARD THEBACKORTOWARDTHEFRONTOFTHElREPLACE Position the air shutter to the factory setting as SHOWNINTHETABLEINFigure 48!LLOWTHEBURNER TOOPERATEFORATLEASTMINUTES/BSERVETHE mAMECONTINUOUSLY)FITAPPEARSWEAKORSOOTY ASPREVIOUSLYDESCRIBEDADJUSTTHEAIRSHUTTER until the flame appearance is as desired. Use the remote to adjust the flame height as desired. 0ROPANE MODELS MAY EXHIBIT A mAME PATTERN that may candle or appear stringy. If this is PROBLEMATIC OR PERSISTS AS THE APPLIANCE IS CONTINUALLY OPERATED ADJUST THE AIR SHUTTER CLOSEDASDESCRIBEDINTHEPREVIOUSPARAGRAPHS Operate the appliance for a period of time as the effect diminishes, ensuring that the appliance DOESNOTDEVELOPSOOTYmAMES7HENSATISlED that the appliance operates properly, proceed TOlNISHTHEINSTALLATION Figure 49—Burner Flame Appearance Oak Logs Shown Figure 50—Burner Flame Appearance 27 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 FINISHING REQUIREMENTS Wall Details .ONCOMBUSTIBLEMATERIALSSUCHASSURROUNDSANDOTHERAPPLIANCETRIM MAYBEINSTALLEDONTHEAPPLIANCEFRONTFACEWITHTHEEXCEPTIONS #OMPLETElNISHEDINTERIORWALL4OINSTALLTHEAPPLIANCEFACINGmUSHWITH THElNISHEDWALLPOSITIONFRAMEWORKTOACCOMMODATETHETHICKNESSOF THElNISHEDWALL(Figure 51). 6ERTICALINSTALLATIONCLEARANCESTOCOMBUSTIBLEMANTELSVARYACCORDING TOTHEDEPTHOFTHEMANTELSEEFigure 8)-ANTELSCONSTRUCTEDOFNON COMBUSTIBLEMATERIALSMAYBEINSTALLEDATANYHEIGHTABOVETHEAPPLIANCE opening. #OMBUSTIBLEMATERIALSMAYPROJECTBEYONDTHESIDEOFTHElREPLACEOPENINGASLONGASITISKEPTWITHINTHESHADEDAREAILLUSTRATEDINFigure 9. 3" Min. Combustible Finished Wall Materials (76 mm)* Header (2x4’s) Combustible materials are allowed above this point on the face of the appliance. 2 Foot Vertical Vent & 90° Elbow 1* 8-3/8" Min. (213 mm) Top of Appliance The gray shaded area must be non-combustible or Dura Rock Spacers Top of Door Frame Finish Combustible Or Non-Combustible Material Fireplace (right side) Front Face Of Fireplace Floor Panel Figure 52 1Installations with horizontal terminations which have minimum vertical vent height only will require 4”(102mm) minimum side clearance as shown in shaded zone above. All other installations require 1" (25mm) minimum side clearance as specified in Figure 4 on Page 6. Glass Door Assembly Fireplace * Insulation is NOT ALLOWED in the clearance zones around vent components. Keep this area free from combustible materials. Figure 51 !HEARTHEXTENSIONISNOTREQUIREDWITHTHISAPPLIANCE)FAHEARTHEXTENSION ISUSEDTHEREARETWOMETHODSOFINSTALLATION/NETHElNISHCOMBUSTIBLE ORNONCOMBUSTIBLEMATERIALCOULDBEENDEDBYBUTTINGUPAGAINSTTHE FRONTFACEOFTHElREPLACEANDTHEmOORPANELrefer to Figure 52). 28 4WOTHElNISHCOMBUSTIBLEORNONCOMBUSTIBLEMATERIALCOULDBEENDED BELOWTHElREPLACE (refer to Figure 53). Remove the floor panel as shown in Figure 52BYREMOVINGTHESCREWSONTHERIGHTSIDEOFTHEPANELAND SLIDINGTHELEFTSIDEAWAYFROMTHETAB$ISCARDTHESCREWSANDmOORPANEL It is critical that there is at least a 1/8" gap between the bottom of the door track and the surface of the finish material. 1/8” Minimum Finish Combustible Or Non-Combustible Material Figure 53 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% Door Track Bottom Of Fireplace )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 Step 11. INSTALLER INSTRUCTIONS—ATTACHING SAFETY-IN-OPERATION WARNINGS It is the installers responsibility to ensure these warnings are properly affixed during installation. These warning labels are a critical step in informing consumers of safe operation of this appliance. ATTACHING SAFETY IN OPERATION WARNINGS )TISREQUIREDTHATTHESETOFSAFETYINSTRUCTIONLABELS THATHAVEBEENFURNISHEDWITHTHElREPLACEBEAFlXED TOTHEOPERATIONANDCONTROLPOINTSOFTHElREPLACE! SAFETYINSTRUCTIONLABELMUSTBEAFlXEDTOTHERECEIVER WALLSWITCHPLATEWHERETHElREPLACEISTURNEDONAND off (See Figure A) and on the remote control handheld transmitter (See Figure B). To properly complete the INSTALLATIONOFTHISlREPLACELOCATETHEMULTILINGUAL ADHESIVELABELSPROVIDEDWITHTHE#AREAND/PERATION Instructions and proceed as follows: ,OCATETHEWALLRECEIVERTHATCONTROLSTHElREPLACE VERIFYTHESWITCHOPERATESTHElREPLACEBYTURNINGITONANDOFF#LEANTHEWALLRECEIVERPLATE THOROUGHLYTOREMOVEANYDUSTANDOILS!FlXTHE LABELTOTHESURFACEOFTHEPLATEOFTHEWALLRECEIVER THATCONTROLSTHElREPLACE(Figure A). Choose THELANGUAGEPRIMARILYSPOKENINTHEHOME)F UNKNOWNAFlXTHE%NGLISHLANGUAGELABEL ,OCATETHEREMOTECONTROLTRANSMITTERANDCLEAN ITTHOROUGHLYTOREMOVEANYDUSTANDOILS!FlX THELABELTOTHESURFACEOFHANDHELDTRANSMITTER (Figure B). Choose the language primarily spoKENINTHEHOME)FUNKNOWNAFlXTHE%NGLISH LANGUAGELABEL )F YOU ARE UNABLE TO LOCATE THE LABELS PLEASE call Innovative Hearth Products or your nearest Innovative Hearth Products dealer to receive adDITIONALSAFETYINSTRUCTIONLABELSFREEOFCHARGE #AT.O(2EPLACEMENT,ABEL+IT NOTE: English is red text on clear label. French and Spanish are white text on black label. SAFETY LABEL DIAGRAMS APPOSITION DES MISES EN GARDE RELATIVES À LA SÉCURITÉ D’UTILISATION )LESTIMP£RATIFQUELEJEUD£TIQUETTESDES£CURIT£QUI ONT £T£ FOURNIES AVEC LE FOYER SOIENT COLL£ES Ü C¹T£ DESDISPOSITIFSDECONTR¹LEDUFOYER5NE£TIQUETTEDE S£CURIT£DOITäTRECOLL£ESURLAPLAQUEDUR£CEPTEURMURAL CONTR¹LANTLALLUMAGEDUFOYER(voir Figure A) et sur le BO¦TIERDELAT£L£COMMANDE(Figure B). Pour achever LINSTALLATIONCORRECTEDECEFOYERPROC£DEZCOMMESUIT AVEC LES £TIQUETTES ADH£SIVES EN LANGUES £TRANGáRES FOURNIESAVECLESINSTRUCTIONSDUTILISATIONETDENTRETIEN 2EP£REZ LE R£CEPTEUR MURAL QUI CONTR¹LE LE FOYER V£RIlEZ QUE LINTERRUPTEUR CONTR¹LE LE FONCTION NEMENTDUFOYERENLEFAISANTBASCULERDE-ARCHE Ü !RRäT ET VICEVERSA .ETTOYEZ SOIGNEUSEMENT LA PLAQUE DU R£CEPTEUR MURAL POUR £LIMINER LA POUSSIáREETLESTRACESDEGRAISSEOUDHUILE#OLLEZ L£TIQUETTESURLASURFACEDELAPLAQUEDUR£CEPTEUR MURALQUICONTR¹LELEFOYER(Figure A). Choisissez LA LANGUE QUI EST PRINCIPALEMENT PARL£E DANS LA résidence du propriétaire. En cas de doute, collez L£TIQUETTEENANGLAIS 2. Repérez la télécommande et nettoyez-la soigneuseMENT POUR £LIMINER LA POUSSIáRE ET LES TRACES DEGRAISSEOUDHUILE#OLLEZL£TIQUETTESURLEBO¦TIER de la télécommande (Figure B). Choisissez la LANGUE QUI EST PRINCIPALEMENT PARL£E DANS LA résidence du propriétaire. En cas de doute, collez L£TIQUETTEENANGLAIS 3I VOUS NE TROUVEZ PAS LES £TIQUETTES VEUILLEZ APPELER)NNOVATIVE(EARTH0RODUCTSOUVOTREDISTRIBU teur Innovative Hearth Products local pour recevoir GRATUITEMENTDES£TIQUETTESSUPPL£MENTAIRES »TIQUETTESDEREMPLACEMENTNCAT( Remarque : Le texte anglais est rouge sur un support transparent. Le texte français et espagnol est blanc sur un support noir. DIAGRAMMES DES ÉTIQUETTES DE SÉCURITÉ COLOCACIÓN DE ADVERTENCIAS DE SEGURIDAD EN OPERACIÓN 3EREQUIEREQUEELJUEGODEETIQUETASDEINSTRUCCIONES DESEGURIDADQUESEINCLUYERONCONLACHIMENEASE COLOQUE EN LOS PUNTOS DE OPERACIN Y CONTROL DE LA MISMA3EDEBECOLOCARUNAETIQUETADEINSTRUCCIONES de seguridad en la placa del interruptor de pared del receptor desde el cual se enciende y se apaga la chimenea (ver la Figura A) y en el transmisor de control remoto (ver la Figura B). Para completar correctamente la instalación de esta chimenea, ENCUENTRE LAS ETIQUETAS ADHESIVAS MULTILINGÓES incluidas con las instrucciones de cuidado y operación y haga lo siguiente: )DENTIlQUE EL RECEPTOR DE PARED QUE CONTROLA LA CHIMENEA VERIlQUE QUE EL INTERRUPTOR OPERA LA CHIMENEA ENCENDI£NDOLA Y APAGÖNDOLA ,IMPIE BIENLAPLACADELRECEPTORDEPAREDPARAQUITAREL POLVOYACEITE0EGUELAETIQUETAENLASUPERlCIE DELAPLACADELRECEPTORDEPAREDQUECONTROLALA chimenea (Figura A). 3ELECCIONE EL IDIOMA QUE MÖSSEHABLAENLACASA3INOSABECUÖLESUSELA ETIQUETAENINGL£S )DENTIlQUEELTRANSMISORDECONTROLREMOTOYL¤MPIELO BIENPARAQUITARELPOLVOYACEITE0EGUELAETIQUETA ENLASUPERlCIEDELTRANSMISOR(Figura B). Seleccione ELIDIOMAQUEMÖSSEHABLAENLACASA3INOSABE CUÖLESUSELAETIQUETAENINGL£S 3INOPUEDEENCONTRARLASETIQUETASS¤RVASELLAMAR A)NNOVATIVE(EARTH0RODUCTSOALDISTRIBUIDORDE Innovative Hearth Products más cercano para RECIBIR ETIQUETAS DE INSTRUCCIONES DE SEGURIDAD adicionales gratuitas. *UEGODEETIQUETASDEREPUESTO.DECAT( Nota: La etiqueta en inglés es transparente con texto rojo. Las etiquetas en francés y español son negras con texto blanco. DIAGRAMAS DE ETIQUETAS DE SEGURIDAD Illustrations are for example only. Your accessories may be different. Les illustrations sont par exemple uniquement. Vos accessoires peuvent être différents. Las ilustraciones son sólo ejemplos. Tu accesorios pueden ser diferentes. Figure A On Remote Figure B Off PRG Figure 54 29 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 INSTALLATION ACCESSORIES Listed Secure Vent® Components Cat. No. Model No. H2266 SV8HTS H2265 SV8VTR H2262 SV8SU Support Strap H2263 SV8SP Support Plate H3908 SV8ARSA Description Horizontal Square Termination with Firestop/Spacer (H2260) and Adaptor (H2267) Attic Insulation Shield (adjustable 12" to 22") Vertical Termination CTSO-46 Shroud for double terminations CTSO-33/44 Shrouds for Single terminations 1 typ. C 1 typ. 2a H2250 H2251 SV8L6 SV8L12 6" (152mm) Vent Section 12" (305mm) Vent Section H2252 SV8L24 24" (610mm) Vent Section H2253 SV8L36 36" (914mm) Vent Section H2254 SV8L48 48" (1219mm) Vent Section H2255 SV8LA Telescopic Section H2256 SV8E45 45 Degree Elbow H2257 SV8E90 2b C 2b D 2b B 2a A B A Open Top Shroud Kits Inches (millimeters) Cat. No. Model A B C D *E H1985 CTSO-33 37-5/8 (955) 37-5/8 (955) 7-1/2 (191) 24-1/2 (622) 3 (76) H1987 CTSO-44 48-5/8 (1235) 48-5/8 (1235) 7-1/2 (191) 24-1/2 (622) 3 (76) H1986 CTSO-46 48-5/8 (1235) 73 1/4 (1860) 7-1/2 (191) 24-1/2 (622) 3 (76) 90 Degree Elbow H3236 SV8F Flat Roof Flashing H2258 SV8FA 1/12 to 7/12 Adjustable Flashing H2259 SV8FB 7/12 to 12/12 Adjustable Flashing H3237 SV8SC6 Storm Collars, 6 pack H2260 SV8HF Firestop/Spacer— Horizontal (3-1-1 spacing) SV8BF E 2a The following flashings come packaged with a storm collar H2261 2 typ. E D 2a A B D C Closed Top Shroud Termination Kits Inches (millimeters) Cat. No. Model A B C D H1988 CTSA-33 34 (864) 5 (127) 34 (864) 34 (864) Firestop/Spacer— Vertical (1-1-1 spacing) 30 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 GAS CONVERSION KITS Step 1. TURN OFF THE GAS SUPPLY TO THE APPLIANCE and disconnect power supply at the circuit breaker. Ensure appliance is cold. WARNING This conversion kit shall be installed by a qualified service agency in accordance with the manufacturer’s instructions and all applicable codes and requirements of the authority having jurisdiction. If the information in these instruction is not followed exactly, a fire, explosion or production of carbon monoxide may result causing property damage, personal injury or loss of life. The qualified service agency is responsible for the proper installation of this kit. The installation is not proper and complete until the operation of the converted appliance is checked as specified in the manufacturer’s instructions supplied with the kit. The qualified service agency performing this installation assumes responsibility for this conversion. AVERTISSEMENT Cette trousse de conversion doit être installée par un technicien agréé, selon les instructions du fabricant et selon toutes les exigences et tous les codes pertinents de l’autorité compétente. Assurez-vous de bien suivre les instructions dans cette notice pour réduire au minimum le risque d’incendie, d’explosion ou la production de monoxyde de carbone pouvant causer des dommages matériels, des blessures ou la mort. Le tecnicien agréé est responsable de l’installation de cette trousse. L’installation n’est pas adéquate ni complète tant que le bon fonctionnement de l’appareil converti n’a pas été vérifié selon les instructions du fabricant fournies avec la trousse. Le fournisseur de service qualifié ayant réalisé l'installation assume les responsabilités liées à la conversion. In Canada: THE CONVERSION SHALL BE CARRIED OUT IN ACCORDANCE WITH THE REQUIREMENTS OF THE PROVINCIAL AUTHORITIES HAVING JURISDICTION AND IN ACCORDANCE WITH THE REQUIREMENTS OF THE CAN/CGA-B149.1 INSTALLATION CODE. LA CONVERSION DEVRA ÊTRE EFFECTUÉE CONFORMÉMENT AUX RECOMMANDATIONS DES AUTORITÉS PROVINCIALES AYANT JURIDICTION ET CONFORMÉMENT AUX EXIGENCES DU CODE D'INSTALLATION CAN/CGAB149.1. 'ASCONVERSIONKITSAREAVAILABLETOADAPTYOUR appliance from the use of one type of gas to THEUSEOFANOTHER4HESEKITSCONTAINALLTHE necessary components needed to complete the TASKINCLUDINGLABELINGTHATMUSTBEAFlXEDTO ensure safe operation. CAUTION: THE GAS SUPPLY SHALL BE SHUT OFF PRIOR TO DISCONNECTING THE ELECTRICAL POWER, BEFORE PROCEEDING WITH THE CONVERSION. ATTENTION. AVANT D’EFFECTUER LA CONVERSION, COUPEZ D’ABORD L’ALIMENTATION EN GAZ, ENSUITE, COUPEZ L’ALIMENTATION ÉLECTRIQUE. Step 2. Remove the front glass door/frame and the access plate from the appliance. See Figures 37 and 47. Step 3. Carefully remove the logs and the grate ASSEMBLYCONTEMPORARYMEDIAExercise care so as not to break the logs / contemporary media. Step 4. Refer to Figure 55. Remove the two SCREWSSECURINGTHEBURNERTOTHEBURNER BRACKETS#AREFULLYSLIDETHEBURNERTOTHELEFT TOCLEARTHEVENTURIFROMTHEORIlCE3ETASIDE THE SCREWS AND BURNER ASSEMBLY IN A SECURE location for later reinstallation. Burner Assembly +ITPARTNUMBERSARELISTEDBELOWANDTHEFOLlowing steps detail the conversion procedure. Natural Gas to Propane Gas Conversion Kits Fireplace Conversion Kit Model No. Cat. No. 40 in. GCKMDLX40NP H8668 45 in. GCKMDLX45NP H8669 Propane Gas to Natural Gas Conversion Kits Fireplace Conversion Kit Conversion Model No. Kit Cat. No. 40 in. GCK-MDLX40PN H8670 45 in. GCK-MDLX45PN H8671 Gas Valve Assembly Burner Orifice Figure 55 Step 5. Remove the control compartment access DOORANDGASKETBYREMOVINGTHETWELVE screws securing it, and set it aside for later reinSTALLATION4HEGASVALVECANBEACCESSEDTHROUGH THEOPENINGORTHECOMPLETEASSEMBLYCANBE REMOVEDBYSLIDINGTHEASSEMBLYTOTHERIGHT 31 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 Step 6. Refer to the instructions provided WITHTHE3)4REGULATORCONVERSIONKIT5SINGA 4ORX4WITHSHANKANDCENTERHOLEOR slotted screwdriver, remove and discard the two pressure regulator mounting screws, the pressure regulator tower, and the diaphragm ASSEMBLYIFAPPLICABLEProperly dispose of all removed components-AKESURETHERUBBER GASKETINSTALLEDONTHEBACKOFTHEREPLACEMENT pressure regulator is properly positioned. Step 7. Install the new stepper motor pressure REGULATORASSEMBLYUSINGTHESUPPLIEDSCREWS 3ECURELYTIGHTENTHESCREWSINLBS Step 8. !TTACHTHEENCLOSEDIDENTIlCATIONLABEL TOTHEVALVEBODYWHEREITCANBEEASILYSEEN Step 9. -AKE STEPPER MOTOR AND VALVE electrical connections. Step 10. 2EMOVETHEPILOTHOODASSEMBLYTO ACCESSTHEHEXEDPILOTORIlCE5SINGAALLENWRENCHREMOVEANDREPLACETHEPILOTORIlCE WITHTHEONEPROVIDEDWITHTHEKIT NOTE: Use extreme care to avoid damaging the igniter assembly. Step 11. Refer to Figure 57 and remove the PILOTHOODASSEMBLYTOACCESSTHEHEXEDPILOT ORIlCE2EMOVEANDREPLACETHEORIlCEWITHTHE ONEPROVIDEDWITHTHEKIT Step 122EFERTOFigure 55 on Page 31 and Figure 58) VERIFY THE PROPER ORIFICE SIZE BEFORE INSTALLING IT. Pilot Hood Burner Orifice Sizes Elevation 0-4500 feet ( 0-1372 meters) Natural Gas Model drill size (inches) 40 in. 0.1405" (#28)* s( 0.086" (#44)* s( 45 in. 0.161" (#20)* s( 0.093" (#42)* s( * Standard size installed at factory s0ART#AT.UMBER Table 11 Pilot Orifice Figure 57 A.2EMOVETHEORIlCEFROMTHEMANIFOLDAND REPLACEITWITHTHEONEPROVIDEDINTHEKIT3EE THEFOLLOWINGTABLEFORORIlCESIZESFORNATURAL and propane models. Figure 58 illustrates THEORIlCE5SEPIPEJOINTCOMPOUNDOR4EFLONTAPEONALLPIPElTTINGSBEFOREINSTALLING ENSUREPROPANERESISTANTCOMPOUNDSARE used in propane applications, do not use pipe JOINTCOMPOUNDSONmARElTTINGS Step 16. 2ELIGHT THE MAIN BURNER AND VERIFY PROPERBURNERIGNITIONANDOPERATION3EEBurner Adjustments Pages 26 and 27. B.2ETRIEVETHEBURNERANDSLIDETHEVENTURITUBE OVERTHEORIlCE3ETTHEBURNERASSEMBLYINTO its position and secure it. Inspect the pilot system for proper flame. The pilot flame should engulf the flame sensor as shown in Figure 59. C.2EINSTALLTHEGRATEASSEMBLY 4HELIGHTINGINSTRUCTIONSCANBEFOUNDONTHE LIGHTINGLABELINTHECONTROLCOMPARTMENTORIN THE#AREAND/PERATION-ANUALPROVIDEDWITH the appliance. Step 13. 2EASSEMBLE THE REMAINING COMPONENTSBYREVERSINGTHEPROCEDURESOUTLINEDIN the preceding steps. Step 14.!TTACHTHECONVERSIONLABELPROVIDED INTHECONVERSIONKITTOTHERATINGPLATEONTHE appliance. Step 15. Apply gas to the system and relight APPLIANCE7ITHTHEMAINBURNER/.TESTTHE NEWPRESSUREREGULATORASSEMBLYANDALLGAS LINEJOINTSFORLEAKSUSINGAGASLEAKTESTSOLUtion. See Test All Connections For Gas Leaks on Page 23. Figure 58 Step 17. Using a manometer, test the inlet and manifold gas pressures. See Tables 2 and 3 on Page 4. ALWAYS TEST PRESSURES WITH THE VALVE REGULATOR CONTROL AT THE HIGHEST SETTING. SEE PAGE 26 FOR AIR SHUTTER ADJUSTMENT GUIDELINES. Igniter Rod Green Wire (from DFC Wire Harness) Manifold (OUT) Test Port Inlet (IN) Test Port Connect GTMS wire harness. Flame Sensor Pressure Regulator Tower Wire (from DFC Wire Harness) Figure 59 Main Gas Inlet 3/8" NPT 32 Propane drill size (inches) Yellow Ground Wire (from DFC Wire Harness) Figure 56 ./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,% Pilot Hood Pilot Nozzles )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 NOTES 33 )../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3 )NNOVATIVE(EARTH0RODUCTSRESERVESTHERIGHTTOMAKECHANGESATANYTIMEWITHOUTNOTICE IN DESIGN MATERIALS SPECIlCATIONS AND PRICES AND ALSO TO DISCONTINUE COLORS STYLES AND PRODUCTS#ONSULTYOURLOCALDISTRIBUTORFORlREPLACECODEINFORMATION 0RINTEDIN53!Ú)NNOVATIVE(EARTH0RODUCTS,,# 34 P/N 506023-22 Rev. NC 12/2013 %LM(ILL0IKE3UITEs.ASHVILLE4.