Download English
Transcript
Projector CP-AX2503/CP-AX3003/CP-AX3503/ CP-AW2503/CP-AW3003 User's Manual (detailed) Network Guide Thank you for purchasing this product. This manual is intended to explain only the network function. For proper use of this product, please refer to this manual and the other manuals for this product. WARNING Ź%HIRUHXVLQJWKLVSURGXFWEHVXUHWRUHDGDOOPDQXDOVIRUWKLV product. After reading them, store them in a safe place for future reference. Features This projector has the network function that brings you the following main features. 9 Network Presentation : allows the projector to project computer images transmitted through a network. (74) 9 Web Control : allows you to monitor and control the projector through a network from a computer. (36) 9 My Image : allows the projector to store up to four still images and project them. (78) 9 Messenger : allows the projector to display text sent from a computer through a network. (80) 9 Network Bridge DOORZV\RXWRFRQWURODQH[WHUQDOGHYLFHWKURXJKWKHSURMHFWRUIURPD computer. (83) NOTE 7KHLQIRUPDWLRQLQWKLVPDQXDOLVVXEMHFWWRFKDQJHZLWKRXWQRWLFH 7KHLOOXVWUDWLRQVLQWKLVPDQXDODUHIRULOOXVWUDWLYHSXUSRVHV7KH\PD\GLIIHU slightly from your projector. 7KHPDQXIDFWXUHUDVVXPHVQRUHVSRQVLELOLW\IRUDQ\HUURUVWKDWPD\DSSHDULQ this manual. 7KHUHSURGXFWLRQWUDQVIHURUFRS\RIDOORUDQ\SDUWRIWKLVGRFXPHQWLVQRW permitted without express written consent. 1 Contents Contents Caution .......................................................................................... 4 1. Network Function ..................................................................... 5 1.1 Web Control ................................................................................................ 5 1.2 Network Presentation . ................................................................................ 6 1.3 My Image Function ..................................................................................... 7 1.4 Messenger Function ................................................................................... 8 1HWZRUN%ULGJH)XQFWLRQ ............................................................................. 9 1.6 Other Functions ......................................................................................... 10 1.6.1 E-mail Alerts ................................................................................................................... 10 1.6.2 Projector Management using SNMP .............................................................................. 10 (YHQW6FKHGXOLQJ ........................................................................................................... 10 &RPPDQG&RQWUROYLDWKH1HWZRUN ................................................................................ 10 2. Connection to the network .................................................... 11 2.1 System requirements ............................................................................... 2.2 &RQQHFWLRQYLDZLUHG/$1 ......................................................................... 2.3 &RQQHFWLRQVHWXSRI:LUHG/$1 ............................................................... 2.4 &RQQHFWLRQYLDZLUHOHVV/$1 .................................................................... 11 12 12 14 2.4.1 Connection in Ad Hoc Mode .......................................................................................... 15 2.4.2 Connection in Infrastructure Mode ................................................................................. 16 2.5 Applications .............................................................................................. 18 2.6 NETWORK Menu . .................................................................................... 20 3. Web Control ............................................................................ 36 3.1 Projector Web Control ............................................................................... 38 /RJLQ .............................................................................................................................. 38 3.1.2 Network Information ....................................................................................................... 39 3.1.3 Network Settings ............................................................................................................ 40 3.1.4 Port Settings .................................................................................................................. 44 3.1.5 Mail Settings .................................................................................................................. 46 3.1.6 Alert Settings .................................................................................................................. 47 3.1.7 Schedule Settings .......................................................................................................... 49 3.1.8 Date/Time Settings ......................................................................................................... 53 3.1.9 Security Settings ............................................................................................................ 55 3.1.10 Projector Control .......................................................................................................... 56 3.1.11 Remote Control ............................................................................................................ 61 3.1.12 Projector Status ........................................................................................................... 62 3.1.13 Network Restart ........................................................................................................... 63 3.1.14 Connection Test ........................................................................................................... 64 2 Contents 3.2 Crestron e-Control® .................................................................................. 65 3.2.1 Main window .................................................................................................................... 67 3.2.2 Tools window ................................................................................................................... 69 3.2.3 Info window ..................................................................................................................... 71 3.2.4 Help Desk window ........................................................................................................... 72 3.2.5 Emergency Alert .............................................................................................................. 73 4. Network Presentation ............................................................. 74 4.1 Outline ...................................................................................................... 74 4.2 Display Mode . ........................................................................................... 75 4.2.1 Single PC mode ............................................................................................................. 75 4.2.2 Multi PC mode ............................................................................................................... 75 4.3 Multi Projector Mode . ............................................................................... 76 4.4 Moderator Control Mode . ......................................................................... 76 4.5 Port Number . ............................................................................................ 77 5. My Image Function ................................................................. 78 6. Messenger Function ............................................................... 80 6.1 Outline ...................................................................................................... 80 6XSSRUWHG/DQJXDJHV .............................................................................. 81 6.3 Display Style ............................................................................................. 81 7. Network Bridge Function ....................................................... 83 &RQQHFWLQJGHYLFHV .................................................................................. 7.2 Communication setup ............................................................................... 7.3 Communication port ................................................................................. 7.4 Transmission method ............................................................................... 83 84 84 85 +$/)'83/(; .............................................................................................................. 85 )8//'83/(; ............................................................................................................... 86 8. Other Functions ...................................................................... 87 8.1 E-mail Alerts ............................................................................................. 87 8.2 Projector Management using SNMP ........................................................ 90 (YHQW6FKHGXOLQJ ..................................................................................... 92 &RPPDQG&RQWUROYLDWKH1HWZRUN .......................................................... 95 8.5 Crestron RoomView® .............................................................................. 100 9. Troubleshooting ................................................................... 101 10. Warranty and after-sales service ...................................... 109 3 Caution Caution 7RXVHWKHZLUHOHVVQHWZRUNIXQFWLRQRIWKLVSURMHFWRUWKHGHVLJQDWHG86%ZLUHless adapter sold as an option is required. For precautions according to the standards and laws, refer to the documents that come with the adapter. [Restriction on plugging and unplugging the USB wireless adapter] %HIRUH\RXLQVHUWRUSXOORXWWKH86%ZLUHOHVVDGDSWHUIURPWKHSURMHFWRUWXUQRII the power of the projector and pull out the power cord’s plug from the outlet. Do QRWWRXFKWKH86%ZLUHOHVVDGDSWHUWKDWLVFRQQHFWHGWRWKHSURMHFWRUZKLOHWKH SURMHFWRULVUHFHLYLQJ$&SRZHU 'RQRWXVHDQ\H[WHQVLRQFDEOHRUGHYLFHZKHQFRQQHFWLQJWKHDGDSWHUWRWKHSURMHFWRU [Security precautions when using wireless LAN] It is recommended that security settings, such as SSID and ENCRYPTION, are VSHFL¿HGZKHQXVLQJZLUHOHVV/$1FRPPXQLFDWLRQ,IWKHVHFXULW\VHWWLQJVDUHQRW VSHFL¿HGWKHFRQWHQWVPD\EHLQWHUFHSWHGRULWPD\FDXVHXQDXWKRUL]HGDFFHVV WRWKHV\VWHP)RUGHWDLOVRQZLUHOHVV/$1VHFXULW\VHWWLQJVUHIHUWR3.1 Projector Web Control. CAUTION Ź7KHRSWLRQDO,(((EJQ86%ZLUHOHVVDGDSWHUXVHVWKH*+]UDGLR frequency band. You do not need a radio license to use the adapter, but you should be aware of the following: '212786(1($57+()2//2:,1* 0LFURZDYHRYHQV ,QGXVWULDOVFLHQWL¿FRUPHGLFDOGHYLFHV 'HVLJQDWHGORZSRZHUUDGLRVWDWLRQV 3UHPLVHVUDGLRVWDWLRQV 8VLQJWKH86%ZLUHOHVVDGDSWHUQHDUWKHDERYHPD\FDXVHUDGLRLQWHUIHUHQFH which would result in a decrease in transmission speed or interruption, and HYHQOHDGWRPDOIXQFWLRQLQJRIGHYLFHVVXFKDVSDFHPDNHUV 'HSHQGLQJRQWKHORFDWLRQZKHUHWKH86%ZLUHOHVVDGDSWHULVXVHGUDGLRZDYH interference may occur, which may result in a decrease in transmission speed or interruption in communication. In particular, please be aware that using the 86%ZLUHOHVVDGDSWHUDWORFDWLRQVZKHUHWKHUHLVUHLQIRUFHGVWHHORWKHUW\SHVRI PHWDOVRUFRQFUHWHLVOLNHO\WRFDXVHUDGLRZDYHLQWHUIHUHQFH $YDLODEOH&KDQQHOV 7KH86%ZLUHOHVVDGDSWHUXVHVWKH*+]UDGLRIUHTXHQF\EDQGEXW depending on the country or region you are in, the channels that you can use might be limited. Please consult your dealer for information on the usable channels. %ULQJLQJWKHRSWLRQDO86%ZLUHOHVVDGDSWHURXWRIWKHFRXQWU\RUUHJLRQ\RX UHVLGHLQDQGXVLQJLWWKHUHFRXOGOHDGWRDYLRODWLRQRIWKHUDGLRODZVRIWKDW country or region. 4 1. Network Function 1. Network Function This chapter describes the outline of network function. 1.1 Web Control &RQQHFWLQJWKHSURMHFWRUDQGWKHFRPSXWHUYLDWKHQHWZRUNUHPRWHFRQWURODQG status monitoring of the projector can be performed by Web browser. Two types of interface, ”Projector Web Control” and “Crestron e-Control”, are DYDLODEOHIRUWKLVSURMHFWRU36) Projector Web Control Crestron e-Control 5 1. Network Function 1.2 Network Presentation The projector can display or play back the computer screen images and audio data that are transmitted through the network. 7RXVH1HWZRUN3UHVHQWDWLRQDQH[FOXVLYHDSSOLFDWLRQ/LYH9LHZHULVUHTXLUHG The following application is required to use Network Presentation. OS Windows 0DF26; iOS(iPhone/iPad) 6 Application /LYH9LHZHU /LYH9LHZHU Projector Quick Connection 1. Network Function 1.3 My Image Function 7KHSURMHFWRUFDQGLVSOD\VWLOOLPDJHVWUDQVIHUUHGYLDWKHQHWZRUN ,WLVSRVVLEOHWRDOORFDWHXSWRLPDJH¿OHV 0<,0$*(WUDQVPLVVLRQUHTXLUHVDQH[FOXVLYHDSSOLFDWLRQIRU\RXUFRPSXWHU 8VHWKHDSSOLFDWLRQWRWUDQVIHUWKHLPDJHGDWD Transfer image data 1 2 3 4 Display image data (ex. ) 7 1. Network Function 1.4 Messenger Function 7KHSURMHFWRUFDQGLVSOD\WH[WGDWDWUDQVIHUUHGYLDWKHQHWZRUNRQWKHVFUHHQDQG play back audio data inside the projector. It is possible to store up to 12 text data. Transfer text data 1 2 3 4 12 Display text data (ex. 8 ) 1. Network Function 1.5 Network Bridge Function 7KLVSURMHFWRULVHTXLSSHGZLWKWKH1(7:25.%5,'*(IXQFWLRQWRSHUIRUP PXWXDOFRQYHUVLRQRIDQHWZRUNSURWRFRODQGDVHULDOLQWHUIDFH %\PDNLQJXVHRIWKH1(7:25.%5,'*(IXQFWLRQDFRPSXWHUFRQQHFWHGWRWKH SURMHFWRUYLDZLUHOHVVRUZLUHG/$1LVDEOHWRFRQWURODQH[WHUQDOGHYLFHYLD RS-232C communication using the projector as a network terminal. TCP/IP data Protocol change :LUHG/$1 /$1FDEOH Computer Wireless /$1 Serial data RS-232C RS-232C cable USB TYPE A port ([WHUQDOGHYLFH LAN port CONTROL port 9 1. Network Function 1.6 Other Functions 1.6.1 E-mail Alerts 7KHSURMHFWRUFDQDXWRPDWLFDOO\VHQGDQDOHUWPHVVDJHWRWKHVSHFL¿HGHPDLO addresses when the projector detects a certain condition that is requiring maintenance or detected an error. (87) 1.6.2 Projector Management using SNMP The SNMP (Simple Network Management Protocol) enables to manage the projector information, which is a failure or warning status, from the computer on the network. The SNMP management software will be required on the computer to use this function. (90) 1.6.3 Event Scheduling 7KHVFKHGXOLQJIXQFWLRQHQDEOHVWRVHWXSVFKHGXOHGHYHQWVLQFOXGLQJ power on / power off. It enables to be “self-management” projector. 7KHVFKHGXOHFDQEHVHWLQ3URMHFWRU:HE&RQWURORU237,216&+('8/(PHQX in the projector. (92) 1.6.4 Command Control via the Network <RXFDQFRQ¿JXUHDQGFRQWUROWKHSURMHFWRUYLDWKHQHWZRUNXVLQJ56& commands. (95) 10 2. Connection to the network 2. Connection to the network 2.1 System requirements The following equipments are required to connect the projector to your computer through the network. Ŷ&RPPRQ The projector: 1 unit, Computer: 1 or more sets Ŷ&RQQHFWLQJGHYLFHIRUWKHSURMHFWRUDQGWKHFRPSXWHU 1) For the wired connection *1 /$1FDEOH&$7HRUJUHDWHUSLHFH 2) For the wireless connection *2 - Projector side IEEE802.11b/g/n 86%ZLUHOHVVDGDSWHU (option : 86%:/1): 1 unit *3 - Computer side ,(((EJQZLUHOHVV/$1HTXLSPHQWXQLWIRUHDFKFRPSXWHU*4 *1: The system for using the network function of the projector requires FRPPXQLFDWLRQHQYLURQPHQWFRQIRUPLQJWR%DVH7;RU%DVH7 *2:$QDFFHVVSRLQWLVUHTXLUHGZKHQWKHZLUHOHVV/$1FRQQHFWLRQLVXVHGDV Infrastructure mode. *3:$YDLODEOHHQFU\SWLRQPHWKRGVDUHDVIROORZV7KLVSURGXFWFDQQRWEH connected to the wireless network using other encryption method. WPA2-PSK (AES) WPA2-PSK (TKIP) WPA-PSK (AES) WPA-PSK (TKIP) WEP 128bit WEP 64bit *4:'HSHQGLQJRQWKHW\SHRIZLUHOHVVQHWZRUNGHYLFHDQGFRPSXWHU\RXDUHXVLQJ the projector may not be able to communicate properly with your computer, HYHQLIWKHFRPSXWHULVHTXLSSHGZLWKDEXLOWLQZLUHOHVV/$1IXQFWLRQ 7RHOLPLQDWHFRPPXQLFDWLRQSUREOHPVXVHD:L)LFHUWL¿HGZLUHOHVVQHWZRUN GHYLFH Ŷ:HEEURZVHU Web browser is required to be installed in your computer to use Web control. Ŷ$SSOLFDWLRQ ([FOXVLYHDSSOLFDWLRQVDUHUHTXLUHGWREHLQVWDOOHGLQ\RXUFRPSXWHUWRXVH Network Presentation, My Image and Messenger. Refer to (18). For Mac users: Mac OS does not support some applications. Refer to System Requirements for Applications (18¿UVWEHIRUHVHWWLQJXSWKHFRQQHFWLRQ NOTE 7KHQHWZRUNIXQFWLRQLVQRWDYDLODEOHZKHQ67$1'%<02'(LVVHW WR6$9,1*DQGWKHSURMHFWRULVLQVWDQGE\PRGH&RQQHFWWKHSURMHFWRUWRWKH QHWZRUNDIWHUVHWWLQJ67$1'%<02'(WR1250$/6(783PHQXLQWKH 2SHUDWLQJ*XLGH 11 2. Connection to the network 2.2 Connection via wired LAN 7KHFRQQHFWLRQYLDZLUHG/$1LVDYDLODEOH6HWZLUHG/$1IRUWKHSURMHFWRUE\ following the instructions of your network administrator when connecting to the existing network. hub 2.3 Connection setup of Wired LAN &RQQHFWWKHSURMHFWRUWRWKHFRPSXWHUYLDDKXE ZLWKD/$1FDEOH&$7HRUKLJKHU 2) Press the MENU button on the remote control or the control panel of the projector. 7KH0(18\RXODVWXVHGZLOODSSHDU 8VHWKHFXUVRUEXWWRQWRVHOHFWWKHIROORZLQJ ($6<0(18!$'9$1&('0(18!1(7:25.!:,5('6(783 6HWWKHIROORZLQJLWHPVLQ:,5('6(783 䡡㻌㻌DHCP 䡡㻌IP ADDRESS 䡡㻌68%1(70$6. 䡡㻌'()$8/7*$7(:$< 䡡㻌DNS SERVER As for setting an IP address, refer to “About IP address”. (13) 6HOHFW$33/<WKHQSUHVVWKHENTEREXWWRQWRUHÀHFWWKHVHWWLQJV 12 2. Connection to the network [About IP address] Ŷ6HWWLQJPDQXDOO\ The Network address portion of the IP address setting on your computer must be the same as the setting on the projector. Also, the entire IP address on the FRPSXWHUPXVWQRWRYHUODSZLWKWKDWRIWKHRWKHUGHYLFHVRQWKHVDPHQHWZRUN including the projector. The projector’s settings are as follows. IP address: 192.168.1.254 Subnet mask: 255.255.255.0 (Network address: 192.168.1 in this case) Therefore, specify the computer’s IP address as follows. IP address: 192.168.1.xxx (xxx shows decimal number.) Subnet mask: 255.255.255.0 (Network address: 192.168.1 in this case) For example Select from 1 to 254 for “xxx” not duplicating with any other equipments. In this case, since the IP address of the projector is “192.168.1.254”, specify a setting between 1 to 253 for the computer. Ŷ6HWWLQJDXWRPDWLFDOO\ :KHQD'+&3VHUYHUH[LVWVLQWKHFRQQHFWHGQHWZRUNLWDVVLJQVDQ,3DGGUHVV WRWKHSURMHFWRUDQGWKHFRPSXWHUDXWRPDWLFDOO\,I'+&3VHUYHULVQRWDYDLODEOH VHW,3$''5(6668%1(70$6.DQG'()$8/7*$7(:$< NOTE 7KHVDPHQHWZRUNDGGUHVVFDQQRWEHXVHGIRUERWKZLUHOHVV/$1DQGZLUHG/$1 If the projector and the computer exist in the same network (i.e., same network DGGUHVV\RXFDQOHDYHWKHGHIDXOWJDWHZD\¿HOGEODQN :KHQWKHSURMHFWRUDQGWKHFRPSXWHUH[LVWLQGLIIHUHQWQHWZRUNVWKHGHIDXOW gateway must be set. Consult to the network administrator in detail. 13 2. Connection to the network 2.4 Connection via wireless LAN &RQQHFWLRQYLDZLUHOHVV/$1LVDYDLODEOHZLWKRSWLRQSDUWV86%ZLUHOHVVDGDSWHU 86%:/1 :LUHOHVV/$1KDVWZRW\SHVRIFRQQHFWLRQ$G+RFDQG,QIUDVWUXFWXUH Fig. 2.4.a Without an access point communication (Ad Hoc) Fig. 2.4.b With an access point communication (Infrastructure) $G+RFLVRQHRIWKHZLUHOHVV/$1FRPPXQLFDWLRQPHWKRGVZLWKRXWKDYLQJDQ access point to communicate. ,QIUDVWUXFWXUHLVRQHRIWKHZLUHOHVV/$1FRPPXQLFDWLRQPHWKRGVZLWKKDYLQJ an access point to communicate. If communicating with existing network, consult with your network administrator. NOTE 1HWZRUNVHWWLQJVFDQDOVREHFKDQJHGLQ1HWZRUN6HWWLQJVRI3URMHFWRU:HE Control㻚 :LUHOHVV/$1LQLWLDOVHWWLQJVIRUWKHSURMHFWRUDUHDVIROORZV Mode: Ad Hoc DHCP: Off IP address: 192.168.10.254 Subnet Mask: 255.255.255.0 'HIDXOW*DWHZD\ SSID: wireless Encryption: Off Channel: 1 7KHVDPHQHWZRUNDGGUHVVFDQQRWEHXVHGIRUERWKZLUHOHVV/$1DQGZLUHG/$1 14 2. Connection to the network 2.4.1 Connection in Ad Hoc Mode Set the following when connecting the projector and the computer in Ad Hoc mode. Projector setting >5HVWULFWLRQRQSOXJJLQJDQGXQSOXJJLQJWKH86%ZLUHOHVVDGDSWHU@ %HIRUH\RXLQVHUWRUSXOORXWWKH86%ZLUHOHVVDGDSWHUIURPWKHSURMHFWRUWXUQRII the power of the projector and pull out the power cord’s plug from the outlet. Do QRWWRXFKWKH86%ZLUHOHVVDGDSWHUWKDWLVFRQQHFWHGWRWKHSURMHFWRUZKLOHWKH SURMHFWRULVUHFHLYLQJ$&SRZHU 'RQRWXVHDQ\H[WHQVLRQFDEOHRUGHYLFHZKHQFRQQHFWLQJWKHDGDSWHUWRWKH projector. $WWDFKWKH86%ZLUHOHVVDGDSWHUWRWKHUSB TYPE A port of the projector. 2) Turn on the projector. 3) Press the MENU button on the remote control or the control panel of the projector. 7KH0(18\RXODVWXVHGZLOODSSHDU 8VHWKHFXUVRUEXWWRQWRVHOHFWWKHIROORZLQJ ($6<0(18!$'9$1&('0(18!1(7:25.!:,5(/(666(783 6HWWKHIROORZLQJLWHPVLQ:,5(/(666(783 䡡㻌MODE: ADHOC 䡡㻌㻌DHCP 䡡㻌IP ADDRESS 䡡㻌68%1(70$6. 䡡㻌SSID 䡡㻌ENCRYPTION 䡡㻌CH As for setting an IP address, refer to “About IP address”. (13) 6HOHFW$33/<WKHQSUHVVWKHENTEREXWWRQWRUHÀHFWWKHVHWWLQJV Computer setting 6HW,3$''5(66DQG68%1(70$6.IRUWKHFRPSXWHUDFFRUGLQJWR,3 $''5(66DQG68%1(70$6.VHWIRUWKHSURMHFWRU6HWWKHSURMHFWRUDQGWKH FRPSXWHUVRWKDWWKH\FDQKDYHWKHVDPHQHWZRUNDGGUHVV 2) Select SSID set for the projector by following the procedure of wireless connection of the computer. Enter encryption key by following the computer’s instruction if it is encrypted. NOTE $VIRUWKHSURFHGXUHRIVHWWLQJQHWZRUNDQGZLUHOHVVFRQQHFWLRQIRUWKH FRPSXWHUUHIHUWRWKHPDQXDORIFRPSXWHURUZLUHOHVV/$1GHYLFH 15 2. Connection to the network 2.4.2 Connection in Infrastructure Mode Set the following when connecting the projector and the computer in Infrastructure mode. >5HVWULFWLRQRQSOXJJLQJDQGXQSOXJJLQJWKH86%ZLUHOHVVDGDSWHU@ %HIRUH\RXLQVHUWRUSXOORXWWKH86%ZLUHOHVVDGDSWHUIURPWKHSURMHFWRUWXUQRII the power of the projector and pull out the power cord’s plug from the outlet. Do QRWWRXFKWKH86%ZLUHOHVVDGDSWHUWKDWLVFRQQHFWHGWRWKHSURMHFWRUZKLOHWKH SURMHFWRULVUHFHLYLQJ$&SRZHU 'RQRWXVHDQ\H[WHQVLRQFDEOHRUGHYLFHZKHQFRQQHFWLQJWKHDGDSWHUWRWKH projector. $WWDFKWKH86%ZLUHOHVVDGDSWHUWRWKHUSB TYPE A port of the projector. 2) Turn on the projector. 3) Press the MENU button on the remote control or the control panel of the projector. 7KH0(18\RXODVWXVHGZLOODSSHDU 8VHWKHFXUVRUEXWWRQWRVHOHFWWKHIROORZLQJ ($6<0(18!$'9$1&('0(18!1(7:25.!:,5(/(666(783 6HWWKHIROORZLQJLWHPVLQ:,5(/(666(783 䡡㻌02'(,1)5$6758&785( 䡡㻌㻌DHCP 䡡㻌IP ADDRESS 䡡㻌68%1(70$6. 䡡㻌'()$8/7*$7(:$< 䡡㻌DNS SERVER 䡡㻌SSID 䡡㻌ENCRYPTION 䡡㻌CH As for setting an IP address, refer to “About IP address”. (13) 6HOHFW$33/<WKHQSUHVVWKHENTEREXWWRQWRUHÀHFWWKHVHWWLQJV 16 2. Connection to the network Connection in Infrastructure Mode (continued) SSID SCAN LIST function 7KHFRQQHFWLRQFDQEHVHWXSE\VHOHFWLQJIURP66,'6&$1/,67ZLWKRXWVHWWLQJ 66,'DQG(1&5<37,21LQ:,5(/(666(7837KHSURFHGXUHRIFRQQHFWLQJE\ 66,'6&$1/,67LVDVIROORZV 6HOHFW66,'6&$1/,67LQ:,5(/(666(783RQ1(7:25.PHQX The list of SSID in wireless network is displayed. 6HOHFW66,'LQZLUHOHVVQHWZRUNWKDW\RXZDQWWRFRQQHFWLQ66,'6&$1/,67 The display to enter the encryption key appears if it is encrypted. Enter the encryption key by using software keyboard. 3) The icon indicating “connected” ( LVGLVSOD\HGLQ66,'6&$1/,67VFUHHQ when the connection is complete. NOTE 㻌Transmission speed may be slow depending on the settings of an access point. If the projector and the computer exist in the same network (i.e., same network DGGUHVV\RXFDQOHDYHWKHGHIDXOWJDWHZD\¿HOGEODQN :KHQWKHSURMHFWRUDQGWKHFRPSXWHUH[LVWLQGLIIHUHQWQHWZRUNVWKHGHIDXOW gateway must be set. Consult with the network administrator in detail. 6HWZLUHOHVV/$1IRUWKHSURMHFWRUE\IROORZLQJWKHLQVWUXFWLRQVRI\RXUQHWZRUN administrator when connecting to the existing network. 2SHQ6\VWHP$XWKHQWLFDWLRQLVXVHGIRU:(3HQFU\SWLRQDQG6KDUHG.H\ Authentication is not supported. The authentication with an access point succeeds DQGLWLVUHJDUGHGWKDWWKHFRQQHFWLRQLVHVWDEOLVKHGQRUPDOO\HYHQZKHQ entering illegal encryption key due to Open System Authentication, but data cannot actually be transmitted. 17 2. Connection to the network 2.5 Applications 7KHODWHVWYHUVLRQRIWKHDSSOLFDWLRQVRIWZDUHFDQEHGRZQORDGHGIURPWKHZHEVLWH below. http://www.hitachi-america.us/digitalmedia/ http://www.hitachidigitalmedia.com/ http://www.hitachi-dm.cn/ http://www.hitachi.co.jp/proj/ )RUL261HWZRUN3UHVHQWDWLRQVRIWZDUHUHIHUWRWKH85/EHORZIRUGHWDLOVDQG downloads of Projector Quick Connection. KWWSZZZKLWDFKLFRMS3URGYLPVSURMHQLQGH[KWPO KWWSZZZKLWDFKLFRMS3URGYLPVSURMMSLQGH[KWPO [System Requirements for Applications] Application /LYH9LHZHU Hardware and Software [Windows] OS: Windows®;3 Windows Vista®6HUYLFH3DFNRUODWHU Windows 7 Windows 8 *UDSKLFFDUG 9*$[RUKLJKHUUHFRPPHQGHG;*$[ &38 3HQWLXP*+]RUKLJKHU Hard disk space: 0%RUKLJKHU 18 2. Connection to the network [System Requirements for Applications] (continued) Application Hardware and Software /LYH9LHZHU [Mac] 0DF26; 0DF26; 0DF26; 0DF26; Hard disk space: 0%RUKLJKHU NOTE 2QO\IRU,QWHOYHUVLRQ3RZHU0DFLVQRWVXSSRUWHG /LYH9LHZHU for MAC is not included in the bundled CD-ROM. Download it from the website. Projector Quick Connection Projector Image Tool (PJImg) iOS 5.1.1 or later iPad, iPad2, New iPad iPhone4/4S/5 OS: Windows®;3 Windows Vista® Windows 7 Windows 8 &38 3HQWLXP0+]RUKLJKHU Projector Messenger Tool (PJMessenger) Hard disk space: 0%RUKLJKHU OS: Windows®;3 Windows Vista® Windows 7 Windows 8 &38 3HQWLXP0+]RUKLJKHU Hard disk space: 0%RUKLJKHU 19 2. Connection to the network 2.6 NETWORK Menu Remember that incorrect network settings on this SURMHFWRUPD\FDXVHWURXEOHRQWKHQHWZRUN%HVXUH to consult with your network administrator before connecting to an existing access point on your network. Select “NETWORK” from the main menu to access to the following functions. 6HOHFWDQLWHPXVLQJWKHŸźFXUVRUEXWWRQVRQWKH SURMHFWRURUUHPRWHFRQWURODQGSUHVVWKHŹFXUVRUEXWWRQRQWKHSURMHFWRURU remote control, or ENTER button on the remote control to execute the item. Then perform it according to the following table. NOTE 7RXVHWKHZLUHOHVVQHWZRUNIXQFWLRQRIWKLVSURMHFWRUWKHGHVLJQDWHG 86%ZLUHOHVVDGDSWHUVROGDVDQRSWLRQLVUHTXLUHG'RQRWXVHDQ\H[WHQVLRQ FDEOHRUGHYLFHZKHQFRQQHFWLQJWKHDGDSWHUWRWKHSURMHFWRU 7KHSURMHFWRUGRHVQRWDOORZERWKZLUHOHVVDQGZLUHG/$1WREHFRQQHFWHGWR the same network. 'RQRWVHWWKHVDPHQHWZRUNDGGUHVVIRUERWKZLUHOHVVDQGZLUHG/$1 ,I\RXGRQRWXVH6173WKHQ\RXPXVWVHWWKH'$7($1'7,0(GXULQJWKH initial installation. 7KHQHWZRUNIXQFWLRQLVQRWDYDLODEOHZKHQ67$1'%<02'(LVVHWWR 6$9,1*DQGWKHSURMHFWRULVLQVWDQGE\PRGH&RQQHFWWKHSURMHFWRUWRWKH QHWZRUNDIWHUVHWWLQJ67$1'%<02'(WR1250$/6(783PHQXLQWKH 2SHUDWLQJ*XLGH 20 2. Connection to the network Item Description Any name can be set to the projector to identify it on the network. PROJECTOR NAME (1) Select the PROJECTOR NAME and press the Ź button. The PROJECTOR NAME dialog will be displayed. 8VHGLVSOD\HGVRIWZDUHNH\ERDUGWRHQWHU352-(&725 NAME. '(/(7('HOHWHVRQHFKDUDFWHU &/($5$//'HOHWHVDOOFKDUDFWHUV &$1&(/*RHVEDFNWRQHWZRUNPHQXDIWHUGLVFDUGLQJ the entered characters. 2.*RHVEDFNWRQHWZRUNPHQXDIWHUVDYLQJWKHHQWHUHG characters. (2) The current PROJECTOR NAME will be displayed on the ¿UVWOLQHVParticular projector name is pre-assigned by default. 8VHWKHENTER or INPUT button to select and enter characters. To erase 1 character at one time, press the RESET button RUSUHVVWKHŻDQGINPUT button at the same time. Also if \RXPRYHWKHFXUVRUWR'(/(7(RU&/($5$//RQVFUHHQ and push the ENTER or INPUT button, 1 character or DOOFKDUDFWHUVZLOOEHHUDVHG8SWRFKDUDFWHUVFDQEH input for the PROJECTOR NAME. (3) To change an already inserted FKDUDFWHUPRYHWKHFXUVRU WRRQHRIWKH¿UVWOLQHV DQGPRYHWKHFXUVRURQWKH character to be changed. After pressing the ENTER or INPUT button, the character is selected. Then, follow the same procedure as described at the LWHPDERYH 7R¿QLVKHQWHULQJWH[WPRYHWKHFXUVRUWRWKH2.RQ VFUHHQDQGSUHVVWKHŹENTER or INPUT button. To UHYHUWWRWKHSUHYLRXV352-(&7251$0(ZLWKRXWVDYLQJ FKDQJHVPRYHWKHFXUVRUWRWKH&$1&(/RQVFUHHQDQG SUHVVWKHŻENTER or INPUT button. (continued on next page) 21 2. Connection to the network Item Description &RQ¿JXUHVZLUHOHVVQHWZRUN 6HWWLQJYDOXHVDUHVDYHGDIWHU VHOHFWLQJ$33/< NOTE 6HWWLQJYDOXHVDUHQRWVDYHG if Menu dissapears before selecting Apply. SSID SCAN LIST WIRELESS SETUP 6HDUFKHVDYDLODEOHZLUHOHVVQHWZRUNDQGGLVSOD\V the list of SSID. You can select SSID to connect from the list. 66,'RQDYDLODEOHZLUHOHVVQHWZRUNLV GLVSOD\HGDIWHUVHOHFWLQJ6&$1/,67DQGSUHVV WKHŹEXWWRQ NOTE The wireless network using the encryption method not supported by the projector is not displayed in the search list. (continued on next page) 22 2. Connection to the network Item Description 㻌㻌㻌㻌Icon Description The projector is connecting to the wireless network. The wireless network is encrypted. 7KHLQWHQVLW\RIUDGLRZDYH 'HYLFHVHWIRU$G+RF WIRELESS SETUP (continued) SSID SCAN LIST (continued) (2) Select SSID that you want to connect and SUHVVWKHŹRUENTER button. The display to enter the encryption key appears if SSID is encrypted. Enter the characters by using software keyboard. 0RYHWKHFXUVRUWR2.DQGSUHVVWKHŹENTER or INPUT button after entering. NOTE If you select the [HIDE THE CHARACTERS] checkbox, the characters are hidden. (continued on next page) 23 2. Connection to the network Item Description 㻔㻟㻕㻌The OSD below is displayed while the connection is in progress. The keys other than Reset button are not DYDLODEOHZKLOHWKHFRQQHFWLRQLVLQSURJUHVV The connection process is interrupted when pressing the Reset button. The OSD below is displayed when the connection process is complete. 䠖 Connection succeeded The message below is displayed when the connection is not established correctly. 䠖 Connection failed WIRELESS SETUP (continued) SSID SCAN LIST (continued) 䠖 (QFU\SWLRQ/RFNHQDEOHG NOTE ・ Encryption settings cannot be changed when encryption lock is enabled in Network Settings – Wireless Setup in Projector Web Control. Refer to Encryption /RFN41) 2SHQ6\VWHP$XWKHQWLFDWLRQLVXVHGIRU:(3 encryption, and Shared Key Authentication is not supported. The authentication with an access point is succeeded and it is regarded that the connection is established normally HYHQZKHQHQWHULQJLOOHJDOHQFU\SWLRQNH\ due to Open System Authentication, but data cannot actually be transmitted. 㻔㻠㻕㻌The icon indicating the connection status ( LVGLVSOD\HGLQ66,'6&$1/,67ZKHQWKH connection is complete. (continued on next page) 24 2. Connection to the network Item Description SSID SCAN LIST (continued) WIRELESS SETUP (continued) 6ZLWFKHVEHWZHHQ$'+2&DQG,1)5$6758&785( Select the mode of the network communication system. Select according to the settings of your computer. ADHOC Ù,1)5$6758&785( 7RVDYHWKHVHWWLQJSUHVVWKHŹEXWWRQ MODE NOTE :KHQ$'+2&LVVHOHFWHG,(((Q cannot be used. ,I$'+2&LVVHWWR02'(ZKLOH:3$36.RU WPA2-PSK is selected in ENCRYPTION, the ENCRYPTION (27) setting switches to OFF automatically. DHCP IP ADDRESS &RQ¿JXUHVZKHWKHU,3DGGUHVVLVDXWRPDWLFDOO\ obtained or not. 8VHWKHŸźEXWWRQVWRWXUQ'+&3RQRII ON Ù OFF &RQ¿JXUHVWKH,3DGGUHVVZKHQ'+&3LVGLVDEOHG Enter the IP ADDRESS. This function can only be used when DHCP is set to OFF. (continued on next page) 25 2. Connection to the network Item WIRELESS SETUP (continued) Description SUBNET MASK &RQ¿JXUHVWKHVXEQHWPDVNZKHQ'+&3LV disabled. (QWHUWKH68%1(70$6. This function can only be used when DHCP is set to OFF. DEFAULT GATEWAY &RQ¿JXUHVWKHGHIDXOWJDWHZD\ZKHQ'+&3LV disabled. (QWHUWKH'()$8/7*$7(:$<DGGUHVV This function can only be used when DHCP is set to OFF. DNS SERVER &RQ¿JXUHVWKH'16VHUYHUDGGUHVV (QWHUWKH'16VHUYHUDGGUHVV NOTE This setting cannot be obtained automatically. &RQ¿JXUHV66,'IRUZLUHOHVVQHWZRUN SSID 6HOHFWRQHRIWKH'()$8/7aDQGSUHVVŹ or ENTER button. To adjust CUSTOM 3UHVVWKHŹRUENTEREXWWRQZKHQWKH &86720LVVHOHFWHG7KH66,'&86720 menu will be appeared. Enter SSID by using software keyboard. Refer to PROJECTOR NAME (21) for how to use software keyboard. (continued on next page) 26 2. Connection to the network Item Description Select the encryption method to be used. WPA2-PSK(AES) Ù WPA2-PSK(TKIP) Ú Ú OFF WPA-PSK(AES) Ú Ú WEP 64bitÙWEP 128bitÙWPA-PSK(TKIP) It is required to enter the encryption key when selecting the encryption method other than 2))DQGSUHVVLQJWKHŹEXWWRQ ENCRYPTION WIRELESS SETUP (continued) CH NOTE 2QO\:(3ELWRU:(3ELWFDQEH selected when Ad Hoc is set. :3$36.$(6LVUHFRPPHQGHGIRUHQFU\SWLRQ method of IEEE802.11n. Transmission speed in IEEE802.11n may be slow when other encryption method (WEP, WPA-PSK (TKIP), WPA2-PSK (TKIP)). Change the setting to “AES” if encryption other than “AES” is set. (QFU\SWLRQPHWKRGQRWLQFOXGHGLQWKHVHOHFWHG LWHPFDQQRWEHDYDLODEOH 6HOHFWWKHFKDQQHORIWKHZLUHOHVV/$1WREH used while MODE (25) is set to ADHOC. Select according to the settings of your computer. 7KHFKDQQHOVWRDUHDYDLODEOH7RVDYHWKH VHWWLQJSUHVVWKHŹEXWWRQ 7KHDYDLODEOHFKDQQHOVYDU\GHSHQGLQJRQD country. (continued on next page) 27 2. Connection to the network Item Description &RQ¿JXUHVZLUHG network. 6HWWLQJYDOXHVDUHVDYHG DIWHUVHOHFWLQJ$33/< NOTE 6HWWLQJYDOXHVDUHQRWVDYHGLI0HQXGLVDSSHDUVEHIRUHVHOHFWLQJ $33/< WIRED SETUP DHCP 8VHWKHŸźEXWWRQVWRWXUQ'+&3RQRII ON Ù OFF IP ADDRESS &RQ¿JXUHVWKH,3DGGUHVVZKHQ'+&3LVGLVDEOHG Enter the IP ADDRESS. This function can only be used when DHCP is set to OFF. SUBNET MASK &RQ¿JXUHVWKHVXEQHWPDVNZKHQ'+&3LVGLVDEOHG (QWHUWKH68%1(70$6. This function can only be used when DHCP is set to OFF. (continued on next page) 28 &RQ¿JXUHVZKHWKHU,3DGGUHVVLVDXWRPDWLFDOO\ obtained or not. 2. Connection to the network Item Description DEFAULT GATEWAY WIRED SETUP (continued) &RQ¿JXUHVWKHGHIDXOWJDWHZD\ZKHQ'+&3LV disabled. (QWHUWKH'()$8/7*$7(:$<DGGUHVV This function can only be used when DHCP is set to OFF. &RQ¿JXUHVWKH'16VHUYHUDGGUHVV (QWHUWKH'16VHUYHUDGGUHVV DNS SERVER NOTE This setting cannot be obtained automatically. (continued on next page) 29 2. Connection to the network Item Description 6HOHFWLQJWKLVLWHPGLVSOD\VWKHGLDORJIRUYLHZLQJWKHZLUHOHVV DQGZLUHG/$1VHWWLQJV8VHWKHŸźEXWWRQVWRVZLWFKWKHSDJH 7KH¿UVWSDJHVKRZVWKHZLUHOHVV/$1VHWWLQJV7KHVHFRQGSDJH LVIRUWKHZLUHG/$1VHWWLQJVDQGWKHWKLUGSDJHLVIRUFRPPRQ setting item. The following information is displayed. 䡡㻌PASSCODE 䡡㻌MODE 䡡㻌IP ADDRESS 䡡㻌68%1(70$6. 䡡㻌'()$8/7*$7(:$< 䡡㻌DNS SERVER 䡡㻌MAC ADDRESS 䡡㻌SSID 䡡㻌ENCRYPTION 䡡㻌CH 䡡㻌SPEED NETWORK INFORMATION WIRELESS INFORMATION Passcord supports the connection between the projector and the computer when using Network Presentation. Refer to Network Presentation (74) for the details. NOTE ,3$''5(6668%1(70$6.DQG '()$8/7*$7(:$<LQGLFDWH³´LQWKH following condition. 7KH86%ZLUHOHVVDGDSWHULVQRWLQVHUWHG into the projector. (2) DHCP is ON and the projector does not get DGGUHVVIURP'+&3VHUYHU Nothing (blank) is shown in the CH and SPEED ¿HOGVLIWKH86%ZLUHOHVVDGDSWHULVQRWLQVHUWHG (continued on next page) 30 2. Connection to the network Item Description The following information is displayed. 䡡㻌PASSCODE 䡡㻌IP ADDRESS 䡡㻌68%1(70$6. 䡡㻌'()$8/7*$7(:$< 䡡㻌DNS SERVER 䡡㻌MAC ADDRESS NETWORK INFORMATION (continued) WIRED INFORMATION Passcord enables the projector and the computer to be connected to the network easily when using Network Presentation. Refer to Network Presentation (74) for details. NOTE ,3$''5(6668%1(70$6.DQG '()$8/7*$7(:$<LQGLFDWH³´ZKHQ DHCP is ON and the projector has not gotten DGGUHVVIURP'+&3VHUYHU The following information is displayed. 䡡㻌PROJECTOR NAME 䡡㻌DATE AND TIME OTHER 䡡㻌SNTP SERVER INFORMATION 䡡㻌TIME DIFFERENCE PROJECTOR NAME and SNTP SERVER may appear truncated if they are too long. (continued on next page) 31 2. Connection to the network Item Description SNTP SERVER SNTP SETUP :KHQ\RXJHWWKHWLPHYLDWKHQHWZRUNVSHFLI\ 6173VHUYHUZLWK,3DGGUHVVRUGRPDLQQDPH 8SWRFKDUDFWHUVFDQEHHQWHUHGIRUGRPDLQ name. They are entered by using software keyboard. Refer to PROJECTOR NAME(21) for how to use software keyboard. NOTE Set the time difference when using SNTP. Enter the time difference. Set the same time difference as the one set on your computer. If unsure, consult your network TIME DIFFERENCE administrator. 8VHWKHŹEXWWRQWRUHWXUQWRWKHPHQXDIWHU setting the TIME DIFFERENCE. (continued on next page) 32 2. Connection to the network Item Description Selecting this item displays the MY ,0$*( menu. 8VHWKHDSSOLFDWLRQWRWUDQVIHUWKH image data. It can be downloaded from the Hitachi web site. Refer to 5. My Image Function (78) for the details of MY ,0$*( MY IMAGE 6HOHFWDQLWHPRIVWLOOLPDJHE\WKH0<,0$*(DQGWKHŹRU ENTER button to display the image. 7KHLWHPZLWKRXWVWRUHGLPDJHFDQQRWEHVHOHFWHG (DFKLPDJHQDPHLVGLVSOD\HGLQFKDUDFWHUVRUOHVV To switch the image displayed 8VHWKHŸźEXWWRQV To return to the menu 3UHVVWKHŻEXWWRQRQWKHUHPRWHFRQWURO 7RHUDVHWKHGLVSOD\HGLPDJHDQGLWVVRXUFH¿OHLQWKH projector. (1) Press the RESET button on the remote control while displaying an LPDJHWRGLVSOD\WKH0<,0$*( '(/(7(PHQX 3UHVVWKHŹEXWWRQWRHUDVH 7RVWRSHUDVLQJSUHVVWKHŻEXWWRQ AMX D.D. (AMX Device Discovery) 8VHWKHŸźEXWWRQVWRWXUQWKH$0;'HYLFH'LVFRYHU\RQRII ON Ù OFF When ON is selected, the projector can be detected by FRQWUROOHUVRI$0;FRQQHFWHGWRWKHVDPHQHWZRUN)RUWKH GHWDLOVRI$0;'HYLFH'LVFRYHU\YLVLWWKH$0;ZHEVLWH 85/KWWSZZZDP[FRP (continued on next page) 33 2. Connection to the network Item Description 7RXVH1HWZRUN3UHVHQWDWLRQDQH[FOXVLYHDSSOLFDWLRQLV required. It can be installed from the bundled application &'<RXFDQDOVRGRZQORDGWKHODWHVWYHUVLRQDQGUHOHYDQW information from the Hitachi website. Refer to 4. Network Presentation (74) for the details of Network Presentation. If you set a computer to the Presenter mode while its image is projected, the projector is occupied by the computer and access from any other computer is blocked. QUIT 8VHWKLVIXQFWLRQWRTXLWWKH3UHVHQWHUPRGHDQG PRESENTER allow other computers to access the projector. MODE Select this item to display a dialog. 3UHVVWKHŹEXWWRQWRFKRRVH2.LQWKHGLDORJ The Presenter mode is cancelled and a message is displayed indicating the result. PRESENTATION MULTI PC MODE (continued on next page) 34 If you set one or more computers to the Multi PC mode and send their images to the projector, you can select the display mode on the projector from two options below. - Single PC mode: displays the image of the selected computer on full screen. - Multi PC mode: displays the images sent from up to IRXUFRPSXWHUVRQVFUHHQWKDWLVGLYLGHGLQWRTXDUWHU sections. Select this item to display a dialog. 8VHWKHGLDORJWRFKDQJHWKHGLVSOD\PRGHDV explained below. 7RFKDQJHIURP0XOWL3&PRGHWR6LQJOH3&PRGH select one of computers in the dialog using the ŸźŻŹEXWWRQVDQGSUHVVWKHENTER or INPUT button. 3UHVVWKHŹEXWWRQWRFKRRVH2.DQGWKHQSUHVV ENTER or INPUT again. The image for the selected computer is displayed on full screen. (continued on next page) 2. Connection to the network Item PRESENTATION (continued) Description MULTI PC MODE (continued) 7RFKDQJHIURP6LQJOH3&PRGHWR0XOWL3& PRGHSUHVVWKHŹEXWWRQWRFKRRVH2.LQWKH dialog and press the ENTER or INPUT button. The display mode is changed. 7KH3UHVHQWHUPRGHVHWWLQJ of the selected computer EHFRPHVYDOLGZKHQWKH display mode is changed to Single PC mode. Also, the 3UHVHQWHUPRGHVHWWLQJEHFRPHVLQYDOLGZKHQ the display mode is changed to Multi PC mode, regardless of the setting on the computers. Selecting this item displays the user name. This DISPLAY function helps you identify from which computer USER NAME the current image is sent. 35 3. Web Control 3. Web Control <RXFDQDGMXVWRUFRQWUROWKHSURMHFWRUYLDDQHWZRUNIURPDZHEEURZVHURQD computer connected to the same network. Ŷ3URMHFWRU:HE&RQWURO 㻌㻌You can control the projector, collect the status such as lamp time, and set e-mail or schedule, etc. in Projector Web Control. Recommended web browser ・ Internet Explorer® 6/ 7/ 8/ 9/ 10 NOTE :HEEURZVHUVRWKHUWKDQUHFRPPHQGHGRQHVPD\QRWZRUN ,QWHUQHW([SORUHU® 6.0 or later is required. ,I-DYD6FULSW®LVGLVDEOHGLQ\RXUZHEEURZVHUFRQ¿JXUDWLRQ\RXPXVWHQDEOH -DYD6FULSW®LQRUGHUWRXVHWKHSURMHFWRUZHESDJHVSURSHUO\6HHWKH+HOS¿OHV IRU\RXUZHEEURZVHUIRUGHWDLOVRQKRZWRHQDEOH-DYD6FULSW®. ,WLVUHFRPPHQGHGWKDWDOOZHEEURZVHUXSGDWHVDUHLQVWDOOHG ,IGDWDLVWUDQVIHUUHGYLDZLUHOHVVDQGZLUHG/$1DWWKHVDPHWLPHWKH projector may not process the data correctly. Ŷ&UHVWURQH&RQWURO 䚷Crestron e-Control® is a control LQWHUIDFHXVLQJDZHEEURZVHUSURYLGHG by Crestron Electronics, Inc.. Crestron e-Control® can control and monitor the projector. (continued on next page) 36 3. Web Control NOTE &UHVWURQH&RQWURO® is created using Flash®. You need to install Adobe® Flash® Player on your computer to use Crestron e-Control®. Crestron e-Control® is not displayed in a web browser that does not support Flash®. ,I&UHVWURQH&RQWURO® in the Network Settings (43) is set to Disable, the VHOHFWLRQZLQGRZGRHVQRWDSSHDUEXWWKH/RJLQZLQGRZRIWKH3URMHFWRU:HE Control is displayed. 5HIHUWRWKHIROORZLQJIRUFRQ¿JXULQJRUFRQWUROOLQJWKHSURMHFWRUYLDDZHEEURZVHU 0DNHVXUHWKDW\RXUFRPSXWHUDQGWKHSURMHFWRULVFRQQHFWHGYLDQHWZRUNDQG then start Web browser. (QWHUWKHSURMHFWRU V,3DGGUHVVLQWR85/LQSXWER[RIWKH:HEEURZVHUDVWKH button. example below, and then press the Enter key or Example: If the IP address of the projector is set to 192.168.1.10: Enter “http://192.168.1.10/” into the address bar of the web browser and press the Enter key or click button. ,IDFRUUHFW85/LVLQSXWDQGWKH projector and your computer are connected to the same network correctly, the selection window will be displayed. NOTE 'RQRWFRQWUROWKHSURMHFWRUZLWKWKHSURMHFWRU VPHQXRUUHPRWH FRQWURODQGYLD:HE&RQWURODWWKHVDPHWLPH,WPD\FDXVHVRPHRSHUDWLRQDO errors in the projector. 7KHODQJXDJHXVHGRQWKH3URMHFWRU:HE&RQWUROLVWKHVDPHDVWKDWRIWKH OSD on the projector. If you want to change it, you need to change the OSD language on the projector. (6&5((1PHQXLQWKH2SHUDWLQJ*XLGH 37 3. Web Control 3.1 Projector Web Control 3.1.1 Login To use the Projector Web Control function, you need to login with your user name and password. %HORZDUHWKHIDFWRU\GHIDXOWVHWWLQJVIRUXVHU name and password. User name Administrator Password EODQN! /RJLQZLQGRZ Enter your user name and password, and then click the [OK]. If you login successfully, the screen below will be displayed. Main menu &OLFNWKHGHVLUHGRSHUDWLRQRUFRQ¿JXUDWLRQLWHPRQWKHPDLQPHQX 38 3. Web Control 3.1 Projector Web Control (continued) 3.1.2 Network Information Displays the projector’s current network FRQ¿JXUDWLRQVHWWLQJV Item Common Information Projector Name Wireless Information Description 'LVSOD\VLQIRUPDWLRQFRPPRQWRERWKZLUHOHVVDQGZLUHG/$1 Displays the projector name settings. 'LVSOD\VWKHFXUUHQWVHWWLQJVRIZLUHOHVV/$1 Mode 'LVSOD\VWKHPRGHRIZLUHOHVV/$1FRPPXQLFDWLRQ DHCP Displays the DHCP setting. IP Address Displays the IP address. Subnet Mask Displays the subnet mask. Default Gateway Displays the default gateway. DNS Server Address 'LVSOD\VWKH'16VHUYHUDGGUHVV MAC Address Displays the MAC address. Ch 'LVSOD\VWKHFKDQQHOXVHGIRUZLUHOHVV/$1 Encryption Displays the data encryption setting. SSID Displays the SSID used by the projector. Speed 'LVSOD\VWKHFXUUHQWZLUHOHVV/$1WUDQVPLVVLRQVSHHG Wired Information 'LVSOD\VWKHFXUUHQWZLUHG/$1VHWWLQJV DHCP Displays the DHCP setting. IP Address Displays the IP address. Subnet Mask Displays the subnet mask. Default Gateway Displays the default gateway. DNS Server Address 'LVSOD\VWKH'16VHUYHUDGGUHVV MAC Address Displays the MAC address. 39 3. Web Control 3.1 Projector Web Control (continued) 3.1.3 Network Settings 'LVSOD\VDQGFRQ¿JXUHVQHWZRUNVHWWLQJV Item Common Setup Projector Name &RQ¿JXUHVWKHQDPHRIWKHSURMHFWRU The length of the Projector Name can be up to 64 alphanumeric characters. Only alphabets, numbers and following symbols can be used. !"#>?@ABC^_`aDQGVSDFH Particular projector name is pre-assigned by default. sysLocation (SNMP) &RQ¿JXUHVWKHORFDWLRQWREHUHIHUUHGWRZKHQXVLQJ6103 7KHOHQJWKRIWKHV\V/RFDWLRQFDQEHXSWRDOSKDQXPHULF characters. 2QO\QXPEHUVµ¶DOSKDEHWµD]¶DQGµ$=¶FDQ be used. sysContact (SNMP) &RQ¿JXUHVWKHFRQWDFWLQIRUPDWLRQWREHUHIHUUHGWRZKHQ using SNMP. The length of the sysContact can be up to 255 alphanumeric characters. 2QO\QXPEHUVµ¶DOSKDEHWµD]¶DQGµ$=¶FDQ be used. AMX D.D. (AMX Device Discovery) &RQ¿JXUHVWKH$0;'HYLFH'LVFRYHU\VHWWLQJWRGHWHFWWKH SURMHFWRUIURPWKHFRQWUROOHUVRI$0;FRQQHFWHGWRWKHVDPH QHWZRUN)RUWKHGHWDLOVRI$0;'HYLFH'LVFRYHU\YLVLWWKH $0;ZHEVLWH 85/KWWSZZZDP[FRP (continued on next page) 40 Description &RQ¿JXUHVWKHVHWWLQJVFRPPRQWRZLUHOHVVDQGZLUHG/$1 3. Web Control 3.1 Projector Web Control - Network Settings (continued) Item Wireless Setup Description &RQ¿JXUHVWKHZLUHOHVV/$1VHWWLQJV Mode 6HOHFW$G+RFRU,QIUDVWUXFWXUH ,3&RQ¿JXUDWLRQ &RQ¿JXUHVQHWZRUNVHWWLQJV DHCP ON Enables DHCP. DHCP OFF Disables DHCP. IP Address &RQ¿JXUHVWKH,3DGGUHVVZKHQ'+&3LVGLVDEOHG Subnet Mask &RQ¿JXUHVWKHVXEQHWPDVNZKHQ'+&3LVGLVDEOHG Default Gateway &RQ¿JXUHVWKHGHIDXOWJDWHZD\ZKHQ'+&3LVGLVDEOHG DNS Server Address &RQ¿JXUHVWKH'16VHUYHUDGGUHVV Select from “1” to “11”, a channel to use in the Ad Hoc mode. NOTE 7KHFKDQQHOVPD\YDU\GHSHQGLQJRQWKH Ch Encryption Lock country. In addition, depending on the country or region, it may be required to use a wireless network card that FRQIRUPVWRWKHVWDQGDUGVLQWKHUHVSHFWLYHFRXQWU\RU region. Permits or inhibits changes of the following settings related to wireless connection. 䡡㻌Mode 䡡㻌Encryption 䡡㻌Encryption key (WEP key, WPA passphrase) 䡡㻌SSID :KHQ(QFU\SWLRQ/RFNLVVHWWR21WKHVHVHWWLQJVFDQQRWEH changed by the menu of the projector. NOTE ,I(QFU\SWLRQ/RFNLV21ZLUHOHVVFRQQHFWLRQ is performed only when it can be connected without changing the current settings. Encryption Select data encryption method. (continued on next page) 41 3. Web Control 3.1 Projector Web Control - Network Settings (continued) Item Wireless Setup WEP Key Description &RQ¿JXUHVWKHZLUHOHVV/$1VHWWLQJV Input the WEP key. Either ASCII characters or hexadecimal numbers can be XVHGGXULQJ:(3NH\LQSXW+RZHYHU\RXFDQQRWXVHD FRPELQDWLRQRIERWK7KHOHQJWKRIWKHNH\LVGH¿QHGDV follows according to the WEP and character formats. Encryption WEP 64bit WEP 128bit +(;QXPEHUV 10 characters 26 characters WPA Passphrase Input WPA Passphrase. $YDLODEOHQXPEHURILQSXWFKDUDFWHUVLVWR2QO\ alphabets, numbers and the following symbols can be used. !"#>?@ABC^_`aDQGVSDFH SSID Select an SSID from the list. If you require to set your unique SSID, select [Custom], then set your own SSID following the rules below. The maximum number of input characters is 32. Only alphabets, numbers and the following symbols can be used. !"#>?@ABC^_`aDQGVSDFH (continued on next page) 42 ASCII characters 5 characters 13 characters 3. Web Control 3.1 Projector Web Control - Network Settings (continued) Item Wired Setup ,3&RQ¿JXUDWLRQ Description &RQ¿JXUHVWKHZLUHG/$1VHWWLQJV &RQ¿JXUHVQHWZRUNVHWWLQJV DHCP ON Enables DHCP. DHCP OFF Disables DHCP. IP Address &RQ¿JXUHVWKH,3DGGUHVVZKHQ'+&3LVGLVDEOHG Subnet Mask &RQ¿JXUHVWKHVXEQHWPDVNZKHQ'+&3LVGLVDEOHG Default Gateway &RQ¿JXUHVWKHGHIDXOWJDWHZD\ZKHQ'+&3LVGLVDEOHG DNS Server Address Other Setup Crestron e-Control &RQ¿JXUHVWKH'16VHUYHUDGGUHVV &RQ¿JXUHVRWKHUQHWZRUNVHWWLQJV Set whether or not to use Crestron e-Control®. ,I\RXFKRRVH'LVDEOHQRWWKHVHOHFWLRQZLQGRZEXWWKH/RJLQ ZLQGRZRI3URMHFWRU:HE&RQWUROZLOOEHGLVSOD\HGDW¿UVW Click the [Apply]EXWWRQWRVDYHWKHVHWWLQJV NOTE 7KHQHZFRQ¿JXUDWLRQVHWWLQJVDUHDFWLYDWHGDIWHUUHVWDUWLQJWKH QHWZRUNFRQQHFWLRQ:KHQWKHFRQ¿JXUDWLRQVHWWLQJVDUHFKDQJHG\RXPXVW restart the network connection. You can restart the network connection from Network Restart on the main menu. (63) ,I\RXFRQQHFWWKHSURMHFWRUWRDQH[LVWLQJQHWZRUNFRQVXOWDQHWZRUN DGPLQLVWUDWRUEHIRUHVHWWLQJVHUYHUDGGUHVVHV 7KH:(3.H\:3$SDVVSKUDVHDQG66,'VHWWLQJVZLOOQRWEHVHWLIWKHLQYDOLG characters are used. 7KHSURMHFWRUGRHVQRWDOORZERWKZLUHOHVVDQGZLUHG/$1WREHFRQQHFWHGWR the same network. Do not set the same network address for both wireless and ZLUHG/$1 43 3. Web Control 3.1 Projector Web Control (continued) 3.1.4 Port Settings 'LVSOD\VDQGFRQ¿JXUHVFRPPXQLFDWLRQSRUW settings. Item Network Control Port1 (Port:23) &RQ¿JXUHVFRPPDQGFRQWUROSRUW3RUW Port open Click the [Enable] check box to use port 23. Authentication Click the [Enable] check box when authentication is required for this port. Network Control Port2 (Port:9715) &RQ¿JXUHVFRPPDQGFRQWUROSRUW3RUW Port open Click the [Enable] check box to use port 9715. Authentication Click the [Enable] check box when authentication is required for this port. PJLink TM Port (Port:4352) &RQ¿JXUHVWKH3-/LQN TM port (Port:4352). Port open Click the [Enable] check box to use port 4352. Authentication Click the [Enable] check box when authentication is required for this port. My Image Port (Port:9716) &RQ¿JXUHVWKH0\,PDJH3RUW3RUW Port open Click the [Enable] check box to use port 9716. Authentication Click the [Enable] check box when authentication is required for this port. Messenger Port (Port:9719) &RQ¿JXUHVWKH0HVVHQJHU3RUW3RUW Port open Click the [Enable] check box to use port 9719. Authentication Click the [Enable] check box when authentication is required for this port. (continued on next page) 44 Description 3. Web Control 3.1 Projector Web Control - Port Settings (continued) Item SNMP Port Description &RQ¿JXUHVWKHPLE¿OHSRUW Port open Click the [Enable] check box to use SNMP. Trap address &RQ¿JXUHVWKHGHVWLQDWLRQRIWKH61037UDSLQ,3IRUPDW 7KHDGGUHVVDOORZVQRWRQO\,3DGGUHVVEXWDOVRGRPDLQ QDPHLIWKHYDOLG'16VHUYHULVVHWXSLQWKHNetwork Settings. The maximum length of host or domain name is up to 255 characters. 'RZQORDG0,%¿OH 'RZQORDGVD0,%¿OHIURPWKHSURMHFWRU Network Bridge Port Port number &RQ¿JXUHVWKH%ULGJHSRUWQXPEHU Input the port number. Except for 41794, 9715, 9716, 9719, 9720, 5900, 5500, 4352 between 1024 and 65535 can be set up. It is set to 9717 as the default setting. Click the [Apply]EXWWRQWRVDYHWKHVHWWLQJV NOTE 7KHQHZFRQ¿JXUDWLRQVHWWLQJVDUHDFWLYDWHGDIWHUUHVWDUWLQJWKH QHWZRUNFRQQHFWLRQ:KHQWKHFRQ¿JXUDWLRQVHWWLQJVDUHFKDQJHG\RXPXVW restart the network connection. You can restart the network connection from Network Restart on the main menu. (63) 45 3. Web Control 3.1 Projector Web Control (continued) 3.1.5 Mail Settings 'LVSOD\VDQGFRQ¿JXUHVHPDLODGGUHVVLQJ settings. Item Description Send Mail Click the [Enable] check box to use the e-mail function. &RQ¿JXUHWKHFRQGLWLRQVIRUVHQGLQJHPDLOXQGHUWKHAlert Settings. SMTP Server Address &RQ¿JXUHVWKHDGGUHVVRIWKHPDLOVHUYHULQ,3IRUPDW 7KHDGGUHVVDOORZVQRWRQO\,3DGGUHVVEXWDOVRGRPDLQ QDPHLIWKHYDOLG'16VHUYHULVVHWXSLQWKHNetwork Settings. The maximum length of host or domain name is up to 255 characters. Sender E-mail address &RQ¿JXUHVWKHVHQGHUHPDLODGGUHVV The length of the sender e-mail address can be up to 255 alphanumeric characters. Recipient E-mail address &RQ¿JXUHVWKHHPDLODGGUHVVRIXSWR¿YHUHFLSLHQWV<RX can also specify the [to] or [cc] for each address. The length of the recipient e-mail address can be up to 255 alphanumeric characters. Send Test Mail Sends a test e-mail to the set address. Click the [Apply]EXWWRQWRVDYHWKHVHWWLQJV 0DLOVHWWLQJVDUHLQLWLDOL]HGZKHQFOLFNLQJWKH[Reset] button. NOTE <RXFDQFRQ¿UPZKHWKHUWKHPDLOVHWWLQJVZRUNFRUUHFWO\E\XVLQJWKH [Send Test Mail] button. Enable Send Mail setting before clicking the [Send Test Mail]. ,I\RXFRQQHFWWKHSURMHFWRUWRDQH[LVWLQJQHWZRUNFRQVXOWDQHWZRUN DGPLQLVWUDWRUEHIRUHVHWWLQJVHUYHUDGGUHVVHV 46 3. Web Control 3.1 Projector Web Control (continued) 3.1.6 Alert Settings 'LVSOD\VDQGFRQ¿JXUHVIDLOXUHDOHUWVHWWLQJV 1RWL¿FDWLRQVXFKDVHPDLODQG6103WUDSFDQEHVHWUHJDUGLQJWKHIROORZLQJ errors/warnings. 䚷䡡&RYHU(UURU 䚷䡡Fan Error 䚷䡡/DPS(UURU 䚷䡡Temp Error 䚷䡡Air Flow Error 䚷䡡Cold Error 䚷䡡Filter Error 䚷䡡Other Error 䚷䡡Schedule Execution Error 䚷䡡/DPS7LPH$ODUP 䚷䡡Filter Time Alarm 䚷䡡Cold Start 䚷䡡Authentication Failure 5HIHUWR&KDSWHUIRUWKHGHWDLOVRIWKHDERYHHUURUVZDUQLQJV㻔87㻕 47 3. Web Control 3.1 Projector Web Control - Alert Settings (continued) The Alert Items are shown below. Item Alarm Time Description &RQ¿JXUHVWKHWLPHWRDOHUW (Only Lamp Time Alarm and Filter Time Alarm.) SNMP Trap Click the [Enable] check box to enable SNMP Trap alerts. Send Mail Click the [Enable] check box to enable e-mail alerts. (Except Cold Start and Authentication Failure.) Mail Subject &RQ¿JXUHVWKHVXEMHFWOLQHRIWKHHPDLOWREHVHQW The length of the subject line can be up to 100 alphanumeric FKDUDFWHUV8VLQJDQ\RWKHUFKDUDFWHUPD\VKRUWHQWKH subject line. (Except Cold Start and Authentication Failure.) Mail Text &RQ¿JXUHVWKHWH[WRIWKHHPDLOWREHVHQW The length of the text is up to 1024 alphanumeric characters. 8VLQJDQ\RWKHUFKDUDFWHUPD\VKRUWHQWKHWH[W (Except Cold Start and Authentication Failure.) Click the [Apply]EXWWRQWRVDYHWKHVHWWLQJV 7KHVHWWLQJVDUHLQLWLDOL]HGZKHQFOLFNLQJWKH[Reset] button. 48 3. Web Control 3.1 Projector Web Control (continued) 3.1.7 Schedule Settings 'LVSOD\VDQGFRQ¿JXUHVVFKHGXOHVHWWLQJV NOTE %HVXUHWRVHWWKHGDWHDQGWLPH EHIRUHHQDEOLQJVFKHGXOHGHYHQWV53) 5HIHUWR(YHQW6FKHGXOLQJIRUWKHGHWDLOV of schedule settings. (92) 1) Schedule Management Item Description Sunday Monday Tuesday Wednesday Schedule settings executed on each day of the week. Thursday Friday Saturday 6SHFL¿FGDWH1R 6SHFL¿FGDWH1R 6SHFL¿FGDWH1R 6SHFL¿FGDWH1R 6FKHGXOHVHWWLQJVH[HFXWHGRQVSHFL¿HGGD\8SWRGD\V FDQEHVSHFL¿HG 6SHFL¿FGDWH1R 49 3. Web Control 3.1 Projector Web Control - Schedule Settings (continued) Item Schedule Program Date (Month/Day) Description Select the checkbox of the schedule to execute. 6HOHFWWKHSURJUDP7KHGHWDLORIWKHHYHQWUHJLVWHUHGLQHDFK SURJUDPFDQEHFRQ¿UPHGLQWKHSURJUDPOLVWGLVSOD\HGDW the bottom of the screen. Input the date (month/day) when the schedule is executed for 6SHFL¿FGDWHa Click the [Apply]EXWWRQWRVDYHWKHVHWWLQJV Click the [Refresh] button to update the screen to the latest status. Click the [Program Edit] button to display the program edit of the selected program. Click the [Copy to] button to copy the content of the program from which you copy (the list on the left) to the program to which you copy (the list on the right). The same program No. cannot be selected for both the program from which and the program to which you copy. 50 3. Web Control 3.1 Projector Web Control - Schedule Settings (continued) 2) Program Edit 7KHFXUUHQWHYHQWVHWWLQJVDUHGLVSOD\HGRQWKH OLVW7RDGGDGGLWLRQDOIXQFWLRQVDQGHYHQWVVHW the following items. NOTE $PD[LPXPRISURJUDPVRI VFKHGXOHFDQEHVHW$PD[LPXPRIHYHQWV can be registered in 1 program. Item Description Time &RQ¿JXUHVWKHWLPHWRH[HFXWHHYHQWV Event [Parameter] &RQ¿JXUHVWKHHYHQWVWREHH[HFXWHG Power STANDBY &RQ¿JXUHVWKHSDUDPHWHUVIRUSRZHUFRQWURO ON Input Source COMPUTER IN1 COMPUTER IN2 LAN USB TYPE A &RQ¿JXUHVWKHSDUDPHWHUVIRUVZLWFKLQJLQSXW USB TYPE B HDMI 1 HDMI 2 VIDEO My Image IMAGE-OFF IMAGE-1 IMAGE-2 &RQ¿JXUHVWKHSDUDPHWHUVIRU0\,PDJHGDWDGLVSOD\ IMAGE-3 IMAGE-4 51 3. Web Control 3.1 Projector Web Control - Schedule Settings (continued) Item Description Messenger TEXT-OFF TEXT-1 TEXT-2 TEXT-3 TEXT-4 TEXT-5 TEXT-6 &RQ¿JXUHVWKHSDUDPHWHUVIRU0HVVHQJHUGDWDGLVSOD\ TEXT-7 TEXT-8 TEXT-9 TEXT-10 TEXT-11 TEXT-12 Eco Mode NORMAL ECO &RQ¿JXUHVWKHSDUDPHWHUVIRUHFRPRGHVZLWFKLQJ INTELLIGENT ECO SAVER Blank OFF &RQ¿JXUHVWKHSDUDPHWHUVIRUEODQNVFUHHQRQRIIFRQWURO ON Slideshow START &RQ¿JXUHVWKH6WDUW6WRSSDUDPHWHUVIRUWKH6OLGHVKRZ STOP Click the [Register]EXWWRQWRDGGQHZHYHQWVWRWKHSURJUDP Click the [Delete]EXWWRQWRGHOHWHHYHQWVIURPWKHSURJUDP Click the [Delete All]EXWWRQWRFOHDUDOOWKHHYHQWVUHJLVWHUHGLQWKHFXUUHQW selected program. Click the [Back] button to go back to the schedule management screen. 52 3. Web Control 3.1 Projector Web Control (continued) 3.1.8 Date/Time Settings 'LVSOD\VDQGFRQ¿JXUHVWKHGDWHDQGWLPH settings. Item Description &RQ¿JXUHVWKHFXUUHQWGDWHLQyear/month/day format. Current Date Current Time &RQ¿JXUHVWKHFXUUHQWWLPHLQhour:minute:second format. Daylight Savings Time Click the [ON]FKHFNER[WRHQDEOHGD\OLJKWVDYLQJVWLPHDQG set the following items. &RQ¿JXUHVWKHGDWHDQGWLPHGD\OLJKWVDYLQJVWLPHEHJLQV Start Month &RQ¿JXUHVWKHPRQWKGD\OLJKWVDYLQJVWLPHEHJLQVa Week &RQ¿JXUHVWKHZHHNRIWKHPRQWKGD\OLJKWVDYLQJVWLPH EHJLQV)LUVW/DVW Day &RQ¿JXUHVWKHGD\RIWKHZHHNGD\OLJKWVDYLQJVWLPHEHJLQV (Sun, Mon, Tue, Wed, Thu, Fri, Sat). Time hour &RQ¿JXUHVWKHKRXUGD\OLJKWVDYLQJVWLPHEHJLQVa minute &RQ¿JXUHVWKHPLQXWHGD\OLJKWVDYLQJVWLPHEHJLQVa &RQ¿JXUHVWKHGDWHDQGWLPHGD\OLJKWVDYLQJVWLPHHQGV End Month &RQ¿JXUHVWKHPRQWKGD\OLJKWVDYLQJVWLPHHQGVa Week &RQ¿JXUHVWKHZHHNRIWKHPRQWKGD\OLJKWVDYLQJVWLPHHQGV )LUVW/DVW Day &RQ¿JXUHVWKHGD\RIWKHZHHNGD\OLJKWVDYLQJVWLPHHQGV (Sun, Mon, Tue, Wed, Thu, Fri, Sat). Time hour &RQ¿JXUHVWKHKRXUGD\OLJKWVDYLQJVWLPHHQGVa minute &RQ¿JXUHVWKHPLQXWHGD\OLJKWVDYLQJVWLPHHQGVa (continued on next page) 53 3. Web Control 3.1 Projector Web Control - Date/Time Settings (continued) Item Time difference SNTP Description &RQ¿JXUHVWKHWLPHGLIIHUHQFH6HWWKHVDPHWLPHGLIIHUHQFH as the one set on your computer. If unsure, consult your IT manager. SNTP Server Address &RQ¿JXUHVWKH6173VHUYHUDGGUHVVLQ,3IRUPDW 7KHDGGUHVVDOORZVQRWRQO\,3DGGUHVVEXWDOVRGRPDLQ QDPHLIWKHYDOLG'16VHUYHULVVHWXSLQWKH1HWZRUN Settings. The maximum length of host or domain name is up to 255 characters. Cycle &RQ¿JXUHVWKHLQWHUYDODWZKLFKWRUHWULHYH'DWHDQG7LPH LQIRUPDWLRQIURPWKH6173VHUYHUhour:minute). Click the [Apply]EXWWRQWRVDYHWKHVHWWLQJV NOTE 7KHQHZFRQ¿JXUDWLRQVHWWLQJVDUHDFWLYDWHGDIWHUUHVWDUWLQJWKH QHWZRUNFRQQHFWLRQ:KHQWKHFRQ¿JXUDWLRQVHWWLQJVDUHFKDQJHG\RXPXVW restart the network connection. You can restart the network connection from Network Restart on the main menu. (63) ,I\RXFRQQHFWWKHSURMHFWRUWRDQH[LVWLQJQHWZRUNFRQVXOWDQHWZRUN DGPLQLVWUDWRUEHIRUHVHWWLQJVHUYHUDGGUHVVHV 7RHQDEOHWKH6173IXQFWLRQWKHWLPHGLIIHUHQFHPXVWEHVHW 7KHSURMHFWRUZLOOUHWULHYH'DWHDQG7LPHLQIRUPDWLRQIURPWKHWLPHVHUYHUDQG RYHUULGHWLPHVHWWLQJVZKHQ6173LVHQDEOHG 7KHLQWHUQDOFORFN¶VWLPHPD\QRWUHPDLQDFFXUDWH8VLQJ6173LVUHFRPPHQGHG to maintain accurate time. 7KHLQWHUQDOEDWWHU\LVUHTXLUHGWREHUHSODFHGZKHQWKHWLPHLVRIIVRRQDIWHU setting date and time. 54 3. Web Control 3.1 Projector Web Control (continued) 3.1.9 Security Settings 'LVSOD\VDQGFRQ¿JXUHVSDVVZRUGVDQGRWKHU security settings. Item User Account Description &RQ¿JXUHVWKHXVHUQDPHDQGSDVVZRUG User name &RQ¿JXUHVWKHXVHUQDPH The length of the text can be up to 32 alphanumeric characters. Password &RQ¿JXUHVWKHSDVVZRUG The length of the text can be up to 255 alphanumeric characters. Re-enter Password 5HHQWHUWKHDERYHSDVVZRUGIRUYHUL¿FDWLRQ Network Control &RQ¿JXUHVWKH$XWKHQWLFDWLRQSDVVZRUGIRUNetwork Control Port1 (Port: 23), Network Control Port2 (Port: 9715), 3-/LQN3RUW3RUW0\,PDJH3RUW3RUWDQG Messenger Port (Port: 9719). (44) Authentication Password &RQ¿JXUHVWKH$XWKHQWLFDWLRQSDVVZRUG The length of the text can be up to 32 alphanumeric characters. Re-enter Authentication Password 5HHQWHUWKHDERYHSDVVZRUGIRUYHUL¿FDWLRQ SNMP Community name &RQ¿JXUHVWKHFRPPXQLW\QDPHLI6103LVXVHG &RQ¿JXUHVWKHFRPPXQLW\QDPH7KHOHQJWKRIWKHWH[WFDQ be up to 64 alphanumeric characters. Click the [Apply@EXWWRQWRVDYHWKHVHWWLQJV NOTE 7KHQHZFRQ¿JXUDWLRQVHWWLQJVDUHDFWLYDWHGDIWHUUHVWDUWLQJWKH QHWZRUNFRQQHFWLRQ:KHQWKHFRQ¿JXUDWLRQVHWWLQJVDUHFKDQJHG\RXPXVW restart the network connection. You can restart the network connection from Network Restart on the main menu. (63) 2QO\QXPEHUVµ¶DOSKDEHWµD]¶DQGµ$=¶FDQEHXVHG 55 3. Web Control 3.1 Projector Web Control (continued) 3.1.10 Projector Control Operations of the projector can be performed with the items on the screen. The categories of the items are shown in the main menu.0RVWRIWKHLWHPVKDYHDVXEPHQX Refer to the table below for details. NOTE 7KHVHWWLQJYDOXHPD\QRWPDWFKZLWKWKHDFWXDOYDOXHLIWKHXVHU FKDQJHVWKHYDOXHPDQXDOO\,QWKDWFDVHUHIUHVKWKHSDJHE\FOLFNLQJWKH [Refresh] button. 56 3. Web Control 3.1 Projector Web Control - Projector Control (continued) Item MAIN POWER INPUT SOURCE PICTURE MODE BLANK ON/OFF MUTE FREEZE MAGNIFY MAGNIFY POSITION V MAGNIFY POSITION H TEMPLATE MY IMAGE MY IMAGE DELETE (continued on next page) 57 3. Web Control 3.1 Projector Web Control - Projector Control (continued) Item BRIGHTNESS CONTRAST HDCR ACCENTUALIZER GAMMA PICTURE COLOR TEMP COLOR TINT SHARPNESS ACTIVE IRIS MY MEMORY ASPECT The selected parameter cannot be set depending on the input signal. OVER SCAN V POSITION IMAGE H POSITION H PHASE H SIZE AUTO ADJUST EXECUTE PROGRESSIVE VIDEO NR COLOR SPACE VIDEO FORMAT INPUT HDMI FORMAT HDMI RANGE COMPUTER IN FRAME LOCK (continued on next page) 58 3. Web Control 3.1 Projector Web Control - Projector Control (continued) Item INPUT D-ZOOM D-SHIFT V D-SHIFT H PICTURE POSITION (CP-AX2503, CP-AX3003, CP-AX3503) PICT.POSIT.H (CP-AW2503, CP-AW3003) KEYSTONE V KEYSTONE KEYSTONE H Corner Position PERFECT FIT Line Distortion AUTO ECO MODE ECO MODE INSTALLATION STANDBY MODE NOTE 7KHQHWZRUNIXQFWLRQLVQRWDYDLODEOHZKHQ67$1'%< 02'(LVVHWWR6$9,1*DQGWKHSURMHFWRULVLQVWDQGE\PRGH &RQQHFWWKHSURMHFWRUWRWKHQHWZRUNDIWHUVHWWLQJ67$1'%< 02'(WR1250$/ AUDIO SCREEN MONITOR OUT VOLUME SPEAKER AUDIO SOURCE MIC VOLUME LANGUAGE Click the [Apply] button to switch the language on the Web screen according to the setting of the selected language in the projector. MENU POSITION V MENU POSITION H BLANK AUTO BLANK START UP MyScreen Lock MESSAGE TEMPLATE C.C. - DISPLAY C.C. - MODE C.C. - CHANNEL (continued on next page) 59 3. Web Control 3.1 Projector Web Control - Projector Control (continued) Item OPTION SERVICE 60 AUTO SEARCH DIRECT POWER ON AUTO POWER OFF USB TYPE B MY BUTTON – 1 / 2 REMOTE RECEIV. REMOTE FREQ. Quit Presenter Mode Quit compulsorily from the Presenter mode. Refer to Chapter 4 for the details of Presenter Mode.㻌㻔75㻕 3. Web Control 3.1 Projector Web Control (continued) 3.1.11 Remote Control The functions on the bundled remote control are assigned to the Web Remote Control screen. Do not control the projector with the projector's UHPRWHFRQWURODQGYLD:HE5HPRWH&RQWURODW the same time. It may cause some operational errors in the projector. 67$1'%<21 COMPUTER IN1 COMPUTER IN2 LAN 86%7<3($ 86%7<3(% HDMI 1 HDMI 2 VIDEO AV MUTE FREEZE ŸźŻŹ ENTER MENU RESET 3$*(83 3$*('2:1 6/,'(6+2: NOTE One operation can be executed only with one click. The button should be clicked repeatedly to operate continuously. When clicking the button repeatedly, some commands may not be sent FRUUHFWO\&OLFNLWDWLQWHUYDOV When the [ ]EXWWRQLVSXVKHGDPHVVDJHZLQGRZFRPHVXSWRFRQ¿UPWKH operation. To control the power, push [OK], otherwise push [Cancel]. 61 3. Web Control 3.1 Projector Web Control (continued) 3.1.12 Projector Status Displays the current settings and status of the projector. Item Description Error Status Displays the error status. Lamp Time Displays the usage time for the lamp. Filter Time 'LVSOD\VWKHXVDJHWLPHIRUWKH¿OWHU Power Status Displays the power status. Input Status Displays the input signal source. Blank On/Off 'LVSOD\VWKH%ODQNVFUHHQRQRIIVWDWXV Mute Displays the Mute on/off status. Freeze 'LVSOD\VWKH)UHH]HVWDWXV 62 3. Web Control 3.1 Projector Web Control (continued) 3.1.13 Network Restart Restarts the projector’s network connection. Item Restart Description Restarts the projector’s network connection in order to DFWLYDWHQHZFRQ¿JXUDWLRQVHWWLQJV NOTE 5HVWDUWLQJUHTXLUHV\RXWRUHORJLQLQRUGHUWRIXUWKHUFRQWURORU FRQ¿JXUHWKHSURMHFWRUYLDDZHEEURZVHU:DLWVHFRQGVRUPRUHDIWHU clicking the [Restart] button to log on again. 63 3. Web Control 3.1 Projector Web Control (continued) 3.1.14 Connection Test Checks if the network is connecting to DNS VHUYHURU6173VHUYHUHWF Item Destination IP Address Description Click the [Execute] button to test the connection after entering IP address to connect to. Display example of the connection succeeded 䠖 Display example of the connection failed 䠖 NOTE &RQ¿UPLQIRUPDWLRQRIWKHWDUJHW,3DGGUHVVZLWKQHWZRUNDGPLQLVWUDWRU &RQQHFWLRQWHVWPD\UHVXOWLQDQHUURUHYHQLIWKHFRQQHFWLRQLVSHUIRUPHG properly when the packets for checking the connection are discarded before DUULYLQJDWWKHWDUJHWGHSHQGLQJRQWKHVHWWLQJVRI¿UHZDOORUSDFNHW¿OWHULQJHWF 7KHUHVXOWRIWKHFRQQHFWLRQWHVWLVGLVSOD\HGRQO\LQ(QJOLVK 64 3. Web Control 3.2 Crestron e-Control® Tab 7KH0DLQZLQGRZDVVKRZQDERYHLV GLVSOD\HGDW¿UVW+RZHYHULI\RXKDYH HQDEOHG8VHU3DVVZRUGRQWKH7RROVZLQGRZ (69), a dialog prompting you to enter the password as shown on the right will be displayed, and no operation is enabled until \RXKDYHHQWHUHGWKHSDVVZRUG$IWHUHQWHULQJ the preset password, the dialog disappears and the Main window will be displayed. As shown below, you can open a window by clicking the corresponding tab at the top right of the window. Tab 8VHU3DVVZRUGGLDORJ Description /RJVRXWIURPH&RQWURO . 7KLVWDEDSSHDUVRQO\ZKHQ8VHU3DVVZRUGRIWKH7RROVZLQGRZLV enabled. Opens Tools window. (69) Opens Info window. (71) Opens Help Desk window. (72) ® Logout Tools Info Contact IT Help 65 3. Web Control 3.2 Crestron e-Control® (continued) NOTE ,I&UHVWURQH&RQWURO® in the Network Settings (43) is set to Disable, Crestron e-Control® cannot be used to operate the projector. Enable Crestron e-Control® and close the web browser. Next, restart the web browser, followed by entering the projector's IP address. 2QO\(QJOLVKLVVXSSRUWHGRQ&UHVWURQH&RQWURO®. ,IWKHFRQQHFWLRQLVWHUPLQDWHGWKH/RDGLQJVFUHHQZLOODSSHDU&KHFNWKH connection between the projector and the computer, then return or refresh the Web page. 7KHFRQWUROIURP&UHVWURQH&RQWURO®LVVXSSRUWHGRQO\YLDZLUHG/$1 66 3. Web Control 3.2 Crestron e-Control® (continued) 3.2.1 Main window 1 4 2 3 You can operate the basic controls of the projector on this screen. NOTE ,IWKHSURMHFWRULVLQWKHVWDQGE\PRGHRQO\WKH[Power] button can be operated. 1. Click a button and operate as follows. Button Power Vol -/ Vol + Mute Description Turns the power on/off. $GMXVWVWKHYROXPHVHWWLQJ Turns Mute on/off. 2. Sources List <RXFDQFOLFNDEXWWRQWRVZLWFKWKHLQSXWFKDQQHO7KHFXUVRUZLOOPRYH according to the currently selected input port. Button Computer in1 Computer in2 LAN USB Type A USB Type B HDMI 1 HDMI 2 Video Description Selects input from COMPUTER IN1 port. Selects input from COMPUTER IN2 port. Selects input from LAN port. Selects input from USB TYPE A port. Selects input from USB TYPE B port. Selects input from HDMI 1 port. Selects input from HDMI 2 port. Selects input from VIDEO port. 67 3. Web Control 3.2 Crestron e-Control® - Main window (continued) &OLFNDEXWWRQDQGRSHUDWHDVIROORZV7RVKRZWKHKLGGHQEXWWRQVFOLFNWKHŻ ŹLFRQVDWWKHOHIWDQGULJKWHQGV Button Freeze Contrast Brightness Color Sharpness Magnify Auto Blank Description 7XUQV)UHH]HRQRII Adjusts the contrast setting. Adjusts the brightness setting. Adjusts the color setting. Adjusts the sharpness setting. &RQWUROVWKHPDJQL¿FDWLRQVHWWLQJXVLQJWKH>@>@EXWWRQV 8VHWKH>Ÿ@>ź@>Ż@>Ź@EXWWRQVWRPRYHWRWKHDUHD\RXZDQW to magnify. Performs the automatic adjustment. 7XUQVWKH%/$1.VFUHHQRQRII 4. Click the button and operate in the same way as the bundled remote control. Button Menu Enter Reset Ÿ ź Ż Ź 68 Description Assigned the same operation as MENU button. Assigned the same operation as ENTER button. Assigned the same operation as RESET button. Assigned the same operation as Ÿ button. $VVLJQHGWKHVDPHRSHUDWLRQDVźEXWWRQ $VVLJQHGWKHVDPHRSHUDWLRQDVŻEXWWRQ $VVLJQHGWKHVDPHRSHUDWLRQDVŹEXWWRQ 3. Web Control 3.2 Crestron e-Control® (continued) 3.2.2 Tools window 2 1 4 5 3 &RQ¿JXUHVWKHVHWWLQJVbetween the projector and Crestron® control system. Click the [Exit] button to return to the Main window. NOTE ,IWZRE\WHFKDUDFWHUVDUHXVHGWKHLQSXWWH[WRUQXPEHUVFDQQRWEH set correctly. $Q\LWHPVRQWKLVZLQGRZFDQQRWEHOHIWEODQN 1. Crestron Control &RQ¿JXUHVWKHVHWWLQJVRI&UHVWURQ®FRQWUROV\VWHPGHYLFHV Item IP Address IP ID Port Description &RQ¿JXUHVWKH,3DGGUHVVRIWKHFRQWUROV\VWHP &RQ¿JXUHVWKH,3,'RIWKHFRQWUROV\VWHP 6SHFL¿HVWKHSRUWQXPEHUXVHGIRUFRPPXQLFDWLRQE\WKH control system. To apply the settings, click the [Send] button. 2. Projector &RQ¿JXUHVWKHQHWZRUNVHWWLQJVRIWKHSURMHFWRU Item Projector Name Location Assigned To: Description &RQ¿JXUHVWKHQDPHRIWKHSURMHFWRU7KHOHQJWKRIWKH Projector Name can be up to 64 alphanumeric characters. &RQ¿JXUHVWKHORFDWLRQQDPHRIWKHSURMHFWRU<RXFDQVSHFLI\ D/RFDWLRQQDPHXSWRDOSKDQXPHULFFKDUDFWHUV &RQ¿JXUHVWKHXVHUQDPHIRUWKHSURMHFWRU<RXFDQVSHFLI\D user name up to 32 alphanumeric characters. The usable symbols are space and the following: !"#>?@ABC^_`a To apply the settings, click the [Send] button. 69 3. Web Control 3.2 Crestron e-Control® - Tools window (continued) 3. Projector (continued) &RQ¿JXUHVWKHQHWZRUNVHWWLQJVRIWKHSURMHFWRU Item DHCP IP Address Description Enables DHCP. &RQ¿JXUHVWKH,3DGGUHVVZKHQ'+&3LVGLVDEOHG Subnet Mask &RQ¿JXUHVWKHVXEQHWPDVNZKHQ'+&3LVGLVDEOHG Default Gateway DNS Server &RQ¿JXUHVWKHGHIDXOWJDWHZD\ZKHQ'+&3LVGLVDEOHG &RQ¿JXUHVWKH'16VHUYHUDGGUHVVZKHQ'+&3LVGLVDEOHG To apply the settings, click the [Send] button. 4. User Password &RQ¿JXUHVWKH8VHU3DVVZRUG7RSURPSWWKHHQWU\RI8VHU3DVVZRUGEHIRUH starting e-Control®, select the checkbox. Item New Password &RQ¿UP Description &RQ¿JXUHVWKHSDVVZRUG You can specify a password up to 26 alphanumeric characters. The usable symbols are space and the following: !"#>?@ABC^_`a 5HHQWHUWKHDERYHSDVVZRUGIRUYHUL¿FDWLRQ,IWKHSDVVZRUGLV incorrect, an error message is displayed. To apply the settings, click the [Send] button. 5. Admin Password &RQ¿JXUHVWKH$GPLQ3DVVZRUG7RSURPSWWKHHQWU\RI$GPLQ3DVVZRUGEHIRUH displaying the Tools window, select the checkbox. Item New Password &RQ¿UP Description &RQ¿JXUHVWKHSDVVZRUG You can specify a password up to 26 alphanumeric characters. The usable symbols are space and the following: !"#>?@ABC^_`a 5HHQWHUWKHDERYHSDVVZRUGIRUYHUL¿FDWLRQ,IWKHSDVVZRUGLV incorrect, an error message is displayed. To apply the settings, click the [Send] button. 70 3. Web Control 3.2 Crestron e-Control® (continued) 3.2.3 Info window 1 2 Displays the current settings and status of the projector. Click the [Exit] button to return to the Main window. 1. Projector Information Item Projector Name Location MAC Address Resolution Lamp Hours Assigned To: Description Displays the projector name settings. Displays the location name of the projector. 'LVSOD\VWKHZLUHG/$10$&DGGUHVVRIWKHSURMHFWRU 'LVSOD\VWKHUHVROXWLRQDQGYHUWLFDOIUHTXHQF\RIWKHVLJQDOLQSXW selected on the projector. Displays the usage time for the lamp. Displays the user name for the projector. 2. Projector Status Item Description Power Status Displays the power status. Input Source Displays the input signal source. Picture Mode Displays the picture mode setting. Installation Displays the installation setting. Eco Mode Displays the eco mode setting. Error Status Displays the error status. NOTE 3URMHFWRU1DPH/RFDWLRQDQGWKHXVHUQDPHIRU$VVLJQHG7RPD\ appear truncated if they are too long. 71 3. Web Control 3.2 Crestron e-Control® (continued) 3.2.4 Help Desk window 6HQGVUHFHLYHVPHVVDJHVWRIURPWKHDGPLQLVWUDWRUIRU&UHVWURQ5RRP9LHZ® Express. Button Send 72 Description Sends a message. &KHFNVWKHUHFHLYHGPHVVDJH 3. Web Control 3.2 Crestron e-Control® (continued) 3.2.5 Emergency Alert When the administrator for Crestron RoomView® Express sends out an alert message, it will be displayed on the screen. <RXFDQUHSO\WRWKHDOHUWPHVVDJHYLDDFKDWIRUPDWInput a message in the box below the alert message, and click the [Send] button. NOTE )RUGHWDLOVRI(PHUJHQF\$OHUWUHIHUWRWKHPDQXDORI&UHVWURQ RoomView® Express. 7KHDOHUWPHVVDJHIURP&UHVWURQ5RRP9LHZ® is displayed on the screen of the projector in the way similar to the real-time text of the Messenger function. (80,IDQRWKHUUHDOWLPHWH[WLVGLVSOD\HGRQWKHVFUHHQLWZLOOEHRYHUZULWWHQ E\WKHDOHUWPHVVDJH+RZHYHULIWKHSULRULW\RIWKHUHDOWLPHWH[WLVVHWWRKLJK the alert message does not appear on the screen. For details, refer to the manual for the application of the Messenger. 73 4. Network Presentation 4. Network Presentation 4.1 Outline The projector can display or play back the computer screen images and audio data that are transmitted through the network. This Network Presentation feature helps you to smoothly make your presentations and conduct conferences. 7RXVH1HWZRUN3UHVHQWDWLRQDQH[FOXVLYHDSSOLFDWLRQ/LYH9LHZHULVUHTXLUHG It can be installed from the bundled application CD. )RUGHWDLOVRI1HWZRUN3UHVHQWDWLRQDQGLQVWUXFWLRQVWRLQVWDOOWKH/LYH9LHZHU UHIHUWRWKHPDQXDOIRU/LYH9LHZHU NOTE 㻌7KHXVHRI/LYH9LHZHUIXQFWLRQGHSHQGVRQWKHPRGHO\RXDUH XVLQJ,I\RXZDQWWRXVHWKHODWHVW/LYH9LHZHUSOHDVHUHIHUWRWKHDSSURSULDWH JURXSLWHPLQWKH/LYH9LHZHU8VHU V0DQXDO7KLVPRGHOZLOOEHLQWKH*URXS RI* )RU0DFXVHUGRZQORDGWKHVRIWZDUHIURPWKHZHEVLWH Refer to 2-5. Applications. 74 4. Network Presentation 4.2 Display Mode /LYH9LHZHUKDVWZRGLVSOD\PRGHV6LQJOH3&PRGHDQG0XOWL3&PRGH 4.2.1 Single PC mode The Single PC mode can display images in full screen from one computer to the SURMHFWRUVZLWFKHUYLDZLUHOHVV/$1RUZLUHG/$1 Ŷ3UHVHQWHU0RGH In the Single PC mode, the projector can be occupied by one computer and can block access from any other computers (if Presenter Mode is set to ON in /LYH9LHZHU:KLOHPDNLQJ\RXUSUHVHQWDWLRQ\RXGRQ¶WQHHGWRZRUU\WKDWWKH image on screen will be unexpectedly switched to an image sent by another FRPSXWHU3UHVHQWHU0RGHFDQEHVHWWR21LQWKHRSWLRQPHQXLQWKH/LYH9LHZHU 4.2.2 Multi PC mode The projector can display images of up to four computers connected at the same time. 75 4. Network Presentation 4.3 Multi Projector Mode In the Multi Projector/Multi Display mode, up to 12 projectors or switchers FRQQHFWHGWRSURMHFWRUVFDQFRQQHFWZLWKWKHFRPSXWHUYLDZLUHOHVVRUZLUHG/$1 simultaneously. This function is for Windows users only. 4.4 Moderator Control Mode One computer can be assigned as Moderator (Host) to control all other computers &OLHQWVRUWKHVZLWFKHUVFRQQHFWHGZLWKWKHSURMHFWRUYLDZLUHOHVV/$1RUZLUHG /$16LQFH&OLHQWVFDQQRWFRQWUROWKH/LYH9LHZHUDQGWKHSURMHFWRUWKH+RVWFDQ proceed with the program as arranged smoothly and safely. Moderator (Host) Moderator (Host) LAN LA Clients Clien This function is for Windows users only. 76 4. Network Presentation 4.5 Port Number 7KHSRUWQXPEHUVXVHGIRU/LYH9LHZHUDUHVKRZQEHORZ Port No. 5500 5900 9720 Protocol TCP TCP TCP NOTE :KHQRWKHUDSSOLFDWLRQXVHVWKHSRUWVDERYH/LYH9LHZHUDQG3URMHFWRU4XLFN Connection may not work. 77 5. MyImage Function 5. My Image Function 7KHSURMHFWRUFDQGLVSOD\VWLOOLPDJHVWUDQVIHUUHGYLDWKHQHWZRUN ,WLVSRVVLEOHWRDOORFDWHXSWRLPDJH¿OHV 0<,0$*(WUDQVPLVVLRQUHTXLUHVDQH[FOXVLYHDSSOLFDWLRQIRU\RXUFRPSXWHU 8VHWKHDSSOLFDWLRQWRWUDQVIHUWKHLPDJHGDWD For information on the necessary settings and operations for the computer and projector, refer to the manual for the application. 7RGLVSOD\WKHWUDQVIHUUHGLPDJHVHOHFWWKH0<,0$*(LWHPLQWKH1(7:25. PHQX)RUPRUHLQIRUPDWLRQSOHDVHVHHWKHGHVFULSWLRQRIWKH0<,0$*(LWHPRI the NETWORK menu. 78 5. MyImage Function NOTE 8VLQJ0<%87721UHJLVWHUHGDV0<,0$*(FDQGLVSOD\WUDQVIHUUHG image. (237,21PHQXLQWKH2SHUDWLQJ*XLGH 7KHLPDJH¿OHDOVRFDQEHGLVSOD\HGE\XVLQJVFKHGXOHIXQFWLRQIURPWKHZHE browser.(92) ,I\RXGLVSOD\0<,0$*(GDWDRQVFUHHQZKLOH\RXDUHXVLQJWKH86%'LVSOD\ IXQFWLRQWKHDSSOLFDWLRQIRUWKH86%'LVSOD\ZLOOEHFORVHG7RUHVWDUWWKH DSSOLFDWLRQH[LWWKH0<,0$*(IXQFWLRQDQGWKHQWKHVRIWZDUHLQWKHSURMHFWRU /LYH9LHZHU/LWH)RU86%H[HZLOOUXQDJDLQ86%'LVSOD\LQWKH2SHUDWLQJ *XLGH ,IGDWDLVWUDQVIHUUHGYLDZLUHOHVVDQGZLUHG/$1DWWKHVDPHWLPHWKHSURMHFWRU may not be able to process the data correctly. 79 6. Messenger Function 6. Messenger Function 6.1 Outline 7KHSURMHFWRUFDQGLVSOD\WH[WGDWDWUDQVIHUUHGYLDWKHQHWZRUNRQWKHVFUHHQDQG play back audio data inside the projector. The text data can be displayed on the screen in two ways. One is to display the text transferred from the computer on real time, and the other is to choose the text data stored in the projector and display it. It is possible to store up to 12 text data. Transfer text data 1 2 3 4 12 Display text data (ex. 80 ) 6. Messenger Function 0HVVHQJHUIXQFWLRQUHTXLUHVDQH[FOXVLYHDSSOLFDWLRQIRU\RXUFRPSXWHU7RHGLW transfer and display the text data, use the application. For information on the necessary settings and operations for the computer and projector, refer to the manual for the application. 6.2 Supported Languages The languages that can be displayed by Messenger function are shown below. (QJOLVK)UHQFK*HUPDQ6SDQLVK,WDOLDQ1RUZHJLDQ'XWFK3RUWXJXHVH 6ZHGLVK)LQQLVK'DQLVK%UDVLOHLUR,QGRQHVLDQ/LWKXDQLDQ(VWRQLDQ/DWYLDQ 3ROLVK&]HFK+XQJDULDQ6ORYHQLDQ&URDWLDQ5XVVLDQ7XUNLVK*UHHN -DSDQHVH6LPSOL¿HG&KLQHVH7UDGLWLRQDO&KLQHVH.RUHDQ9LHWQDPHVH 6.3 Display Style There are 4 types of message display style. The following is the description of each type. 1) Scroll The message scrolls to the left in the message display area. Today’s The chemical class %R[6FUROOXS The message scrolls upwards in the square message display area. 81 6. Messenger Function 3) Pop on 7KHPHVVDJHLVGLVSOD\HGLQIXOOYLHZLQWKH square message display area. 4) Picture Side The message is displayed in the message display area on the right or left. 7KLVVW\OHLVDYDLODEOHRQO\IRU:;*$DQG :8;*$PRGHOSURMHFWRU NOTE 8VLQJMY BUTTONUHJLVWHUHGDV0(66(1*(5FDQWXUQWKH displaying messenger text on/off. (237,21PHQXLQWKH2SHUDWLQJ*XLGH 7KHWH[W¿OHDOVRFDQEHGLVSOD\HGE\XVLQJVFKHGXOHIXQFWLRQYLDWKHZHE browser. (92) ,IGDWDLVWUDQVIHUUHGYLDZLUHOHVVDQGZLUHG/$1DWWKHVDPHWLPHWKHSURMHFWRU may not process the data correctly. 82 7. Network Bridge Function 1HWZRUN%ULGJH)XQFWLRQ 7KLVSURMHFWRULVHTXLSSHGZLWKWKH1(7:25.%5,'*(IXQFWLRQWRSHUIRUP PXWXDOFRQYHUVLRQRIDQHWZRUNSURWRFRODQGDVHULDOLQWHUIDFH %\PDNLQJXVHRIWKH1(7:25.%5,'*(IXQFWLRQDFRPSXWHUFRQQHFWHGWRWKH SURMHFWRUYLDZLUHOHVVRUZLUHG/$1LVDEOHWRFRQWURODQH[WHUQDOGHYLFHYLD56 232C communication using the projector as a network terminal. TCP/IP data :LUHG/$1 /$1FDEOH Computer Protocol change USB TYPE A port Serial data RS-232C RS-232C cable ([WHUQDOGHYLFH Wireless /$1 LAN port CONTROL port 7.1 Connecting devices 1) Connect the projector’s LANSRUWWRWKHFRPSXWHU¶V/$1SRUWZLWKD/$1FDEOH RULQVHUWWKH86%ZLUHOHVVDGDSWHULQWRWKHUSB TYPE A port. 2) Connect the projector’s CONTROL SRUWDQGWKHGHYLFH¶V56&SRUWZLWKDQ RS-232C cable, for RS-232C communication. NOTE %HIRUHFRQQHFWLQJWKHGHYLFHVUHDGWKHPDQXDOVIRUWKHGHYLFHVWR ensure the connection. )RU56&FRQQHFWLRQFKHFNWKHVSHFL¿FDWLRQVRI each port and use the suitable cable. (Connection to the ports in the Operating *XLGH7HFKQLFDO 83 7. Network Bridge Function 7.2 Communication setup 7RFRQ¿JXUHWKHVHWXSRIWKHFRPPXQLFDWLRQXVLQJ1(7:25.%5,'*(IRU WKHSURMHFWRUXVHLWHPVLQWKH&20081,&$7,21PHQX2SHQWKHPHQXRI WKHSURMHFWRUDQGVHOHFWWKH237,216(59,&(&20081,&$7,21PHQX (OPTION menu ! SERVICE !&20081,&$7,21LQWKH2SHUDWLQJ*XLGH) ,QWKH&20081,&$7,217<3(PHQXVHOHFW1(7:25.%5,'*( :,5(/(66RU:,5('GHSHQGLQJRQWKHW\SHRIFRQQHFWLRQ\RXXVHIRUWKH CONTROL port. 8VLQJWKH6(5,$/6(77,1*6PHQXVHOHFWWKHSURSHUEDXGUDWHDQGSDULW\ for the CONTROLSRUWDFFRUGLQJWRWKHVSHFL¿FDWLRQRIWKH56&SRUWRI WKHFRQQHFWHGGHYLFH Item %$8'5$7( PARITY Condition 4800bps/9600bps/19200bps/38400bps NONE/ODD/EVEN Data length ELW¿[HG Start bit ELW¿[HG Stop bit ELW¿[HG 8VLQJWKH75$160,66,210(7+2'PHQXVHWXSWKHSURSHUPHWKRGIRUWKH CONTROL port according to your use. NOTE 7KH2))LVVHOHFWHGIRUWKH&20081,&$7,217<3(DVWKHGHIDXOW setting. 8VLQJWKH&20081,&$7,21PHQXVHWXSWKHFRPPXQLFDWLRQ5HPHPEHU that an unsuitable setup could cause malfunction of communication. :KHQHLWKHURQHRIWKH1(7:25.%5,'*(VHWWLQJVLVVHOHFWHGLQWKH &20081,&$7,217<3(PHQX56&FRPPDQGVFDQQRWEHUHFHLYHGIURP the CONTROL port. 7.3 Communication port )RUWKH1(7:25.%5,'*(IXQFWLRQVHQGWKHGDWDIURPWKHFRPSXWHUWRWKH SURMHFWRUZLWKXVLQJWKH1HWZRUN%ULGJH3RUWFRQ¿JXUHGLQWKH3RUW6HWWLQJVRI web browser. (45) NOTE ([FHSWIRU EHWZHHQDQGFDQEHVHWXSDVWKH1HWZRUN%ULGJH3RUWQXPEHU,W is set to 9717 as the default setting. 84 7. Network Bridge Function 7.4 Transmission method The transmission method can be selected from the menus, only when the 1(7:25.%5,'*(LVVHOHFWHGIRUWKH&20081,&$7,217<3( (OPTION menu ! SERVICE !&20081,&$7,21LQWKH2SHUDWLQJ*XLGH) +$/)'83/(;)8//'83/(; 7.4.1 HALF-DUPLEX This method lets the projector make two way communication, but only one GLUHFWLRQHLWKHUWUDQVPLWWLQJRUUHFHLYLQJGDWDLVDOORZHGDWDWLPH 7KHPHWKRGGRHVQRWDOORZWKHSURMHFWRUWRUHFHLYHWKHGDWDIURPWKHFRPSXWHU ZKLOHZDLWLQJIRUUHVSRQVHGDWDIURPDQH[WHUQDOGHYLFH$IWHUWKHSURMHFWRU UHFHLYHVWKHUHVSRQVHGDWDIURPDQH[WHUQDOGHYLFHRUWKHUHVSRQVHOLPLWWLPHLV SDVWWKHSURMHFWRUFDQUHFHLYHWKHGDWDIURPWKHFRPSXWHU 7KDWPHDQVWKDWWKHSURMHFWRUFRQWUROVWUDQVPLWWLQJDQGUHFHLYLQJWKHGDWDWR V\QFKURQL]HWKHFRPPXQLFDWLRQ 7RXVHWKH+$/)'83/(;PHWKRGVHWXSWKH5(63216(/,0,77,0(IROORZLQJ the instructions below. TCP/IP data :LUHG/$1 /$1FDEOH Protocol change Serial data RS-232C RS-232C cable Computer ([WHUQDOGHYLFH :LUHOHVV/$1 Transmitting data Transmitting data Discarding data Response limit time Response data Response data Discarding data 8VLQJWKH5(63216(/,0,77,0(PHQXVHWWKHZDLWLQJWLPHIRUUHVSRQVHGDWD IURPDQH[WHUQDOGHYLFH(OPTION menu ! SERVICE !&20081,&$7,21LQ the 2SHUDWLQJ*XLGH) OFF 1s 2s 3s ( OFF) 85 7. Network Bridge Function 7.4 Transmission method (continued) NOTE :LWKXVLQJWKH+$/)'83/(;PHWKRGWKHSURMHFWRUFDQVHQGRXW 254 byte data at the maximum at a time. ,ILWLVQRWUHTXLUHGWRPRQLWRUWKHUHVSRQVHGDWDIURPDQH[WHUQDOGHYLFHDQG WKH5(63216(/,0,77,0(LVVHWWR2))WKHSURMHFWRUFDQUHFHLYHWKHGDWD IURPWKHFRPSXWHUDQGVHQGLWRXWWRDQH[WHUQDOGHYLFHFRQWLQXRXVO\ The OFF is selected as the default setting. 7.4.2 FULL-DUPLEX This method lets the projector make two way communication, transmitting and UHFHLYLQJGDWDDWWKHVDPHWLPHZLWKRXWPRQLWRULQJUHVSRQVHGDWDIURPDQ H[WHUQDOGHYLFH :LWKXVLQJWKLVPHWKRGWKHFRPSXWHUDQGDQH[WHUQDOGHYLFHZLOOVHQGWKHGDWD RXWRIV\QFKURQL]DWLRQ,ILWLVUHTXLUHGWRV\QFKURQL]HWKHPVHWWKHFRPSXWHUWR PDNHWKHV\QFKURQL]DWLRQ NOTE :KHQWKHFRPSXWHUFRQWUROVWKHV\QFKURQL]DWLRQRIUHFHSWLRQVDQGWUDQVPLVVLRQV WKHH[WHUQDOGHYLFHPD\QRWEHFRQWUROOHGSURSHUO\GHSHQGLQJRQWKHVWDWXVRIGDWD processing of the projector. 86 8. Other Functions 8. Other Functions 8.1 E-mail Alerts 7KHSURMHFWRUFDQDXWRPDWLFDOO\VHQGDQDOHUWPHVVDJHWRWKHVSHFL¿HGHPDLO addresses when the projector detects a certain condition that is requiring maintenance or detected an error. NOTE 8SWR¿YHHPDLODGGUHVVHVFDQEHVSHFL¿HG 7KHSURMHFWRUPD\EHQRWDEOHWRVHQGHPDLOLIWKHSURMHFWRUVXGGHQO\ORVHV power. 7KLVIXQFWLRQLVQRWDYDLODEOHLI\RXXVHDPDLOVHUYHUUHTXLULQJDXWKHQWLFDWLRQ to send a mail. 0DLOVPD\QRWEHVHQWFRUUHFWO\GHSHQGLQJRQWKHPDLOHQYLURQPHQW\RXDUH using. $OHUWVDYDLODEOHWR(PDLODOHUWVDUHDVIROORZV Item Cover Error Fan Error Lamp Error Temp Error Air Flow Error Cold Error Filter Error Other Error Schedule Execution Error Lamp Time Alarm Filter Time Alarm Description 7KHODPSFRYHUKDVQRWEHHQSURSHUO\¿[HG The cooling fan is not operating. The lamp does not light, and there is a possibility that interior portion has become heated. There is a possibility that the interior portion has become heated. The internal temperature is rising. There is a possibility that the interior portion has EHFRPHRYHUFRROHG )LOWHUWLPHRYHU (UURUVRWKHUWKDQWKHDERYH If this error is displayed, please contact your dealer. )DLOHGWRH[HFXWHVFKHGXOHGHYHQWV /DPS7LPHKDVH[FHHGHGWKHVSHFL¿HGDODUPOLPLW )LOWHU7LPHKDVH[FHHGHGWKHVSHFL¿HGDODUPOLPLW (continued on next page) 87 8. Other Functions NOTE 7KHWLPLQJRIUHFHLYLQJ)LOWHU(UURUHPDLOLVGHSHQGLQJRQWKH ),/7(50(66$*(VHWWLQJLQWKH6(59,&(LWHPRIWKH237,21 menu which GHWHUPLQHVWKHSHULRGXQWLOWKH¿OWHUPHVVDJHLVGLVSOD\HGRQWKHSURMHFWRU VFUHHQ$QHPDLOZLOOEHVHQWZKHQWKHXVDJHWLPHRIWKH¿OWHUH[FHHGVWKHVHW WLPHOLPLW1RQRWL¿FDWLRQHPDLOZLOOEHVHQWLIWKH),/7(50(66$*(LVVHWWR 78512))237,21PHQXLQWKH2SHUDWLQJ*XLGH Lamp Time AlarmLVDWKUHVKROGIRUHPDLOQRWL¿FDWLRQRIWKHODPSWLPH :KHQWKHVHWWLPHH[FHHGVWKHOLPLWFRQ¿JXUHGLQWKH3URMHFWRU:HE&RQWURO an e-mail will be sent. Filter Time Alarm LVDWKUHVKROGIRUHPDLOQRWL¿FDWLRQRIWKH¿OWHUWLPH:KHQ WKHVHWWLPHH[FHHGVWKHOLPLWFRQ¿JXUHGLQWKH3URMHFWRU:HE&RQWURODQHPDLO will be sent. 88 8. Other Functions 7RXVHWKHSURMHFWRU¶VHPDLODOHUWIXQFWLRQSOHDVHFRQ¿JXUHWKHIROORZLQJLWHPV through a web browser. Mail Settings (46) 1) Select [Mail Settings] on main menu in Projector Web Control. &RQ¿JXUHHDFKLWHPLQ0DLO6HWWLQJVSDJH5HIHUWRLWHP0DLO6HWWLQJV (46) for further information. 3) Click the [Apply]EXWWRQWRVDYHWKHVHWWLQJV 4) Click the [Send Test Mail]EXWWRQWRFRQ¿UPWKDWWKHHPDLOVHWWLQJVDUH correct. 7KHIROORZLQJPDLOZLOOEHGHOLYHUHGWRWKHVSHFL¿HGDGGUHVVHV 6XEMHFWOLQH7HVW0DLO3URMHFWRUQDPH! Text : Send Test Mail 'DWH 7HVWLQJGDWH! 7LPH 7HVWLQJWLPH! ,3$GGUHVV 3URMHFWRU,3DGGUHVV! 0$&$GGUHVV 3URMHFWRU0$&DGGUHVV! Alert Settings (47) 1) Select [Alert Settings] on main menu in Projector Web Control. 6HOHFWDQGFRQ¿JXUHHDFKDOHUWLWHP5HIHUWRLWHP$OHUW6HWWLQJV47) for further information. 3) Click the [Apply] EXWWRQWRVDYHWKHVHWWLQJV Failure/Warning e-mails are formatted as follows: 6XEMHFWOLQH0DLOWLWOH!3URMHFWRUQDPH! 7H[W 0DLOWH[W! 'DWH )DLOXUH:DUQLQJGDWH! 7LPH )DLOXUH:DUQLQJWLPH! ,3$GGUHVV 3URMHFWRU,3DGGUHVV! 0$&$GGUHVV 3URMHFWRU0$&DGGUHVV! 89 8. Other Functions 8.2 Projector Management using SNMP The SNMP (Simple Network Management Protocol) enables to manage the projector information, which is a failure or warning status, from the computer on the network. NOTE ,WLVUHFRPPHQGHGWKDW6103IXQFWLRQVDUHH[HFXWHGE\DQHWZRUN administrator. 6103PDQDJHPHQWVRIWZDUHPXVWEHLQVWDOOHGRQWKHFRPSXWHUWRPRQLWRU WKHSURMHFWRUYLD6103 Standard MIB (MIB-2) <RXFDQUHIHUWKHIROORZLQJLWHPVGH¿QHGLQV\VWHPJURXSRI6WDQGDUG0,%0,% Item sysName V\V/RFDWLRQ sysContact Description Projector name is set. The information on where it is located. It has character string VHWLQV\V/RFDWLRQ6103LQ3URMHFWRU:HE&RQWURO>1HWZRUN Settings] - [Common Setup]. The information on the administrator's contact information. It has character string set in sysContact (SNMP) in Projector Web Control - [Network Settings] - [Common Setup]. Enhanced MIB <RXFDQJHWFRQ¿JXUDWLRQLQIRUPDWLRQE\XVLQJ(QKDQFHG0,%IRUSURMHFWRUV (QKDQFHG0,%IRUSURMHFWRUVFDQEHGRZQORDGHGIURP>3RUW6HWWLQJV@SDJHLQ Projector Web Control. Trap :KHQDQHUURURUZDUQLQJRFFXUVLQWKHSURMHFWRUDQRWL¿FDWLRQFDQEHVHQWWRWKH VSHFL¿HGDGGUHVV In addition to e-mail alert shown in 8.1 Email Alerts (87), the following QRWL¿FDWLRQFDQEHVHQW Item Cold Start Authentication Failure 90 Description When the projector is supplied with the power, it works as below. ,IWKH67$1'%<02'(LVVHWWRWKH1250$/WKHSURMHFWRU V power status changes from “OFF” to “Standby state”. ,IWKH67$1'%<02'(LVVHWWRWKH6$9,1*WKHSURMHFWRU V power status changes from “Standby state” to “ON (lamp is turned on)”. (6(783PHQXLQWKH2SHUDWLQJ*XLGH 7KH6103DFFHVVLVGHWHFWHGIURPWKHLQYDOLG6103 community. 8. Other Functions 6HWXSWKHIROORZLQJIXQFWLRQVWKURXJK:(%EURZVHULI\RXZDQWWRPDQDJHWKH projector by SNMP. Port Settings (44) 1) Select [Port Settings] on main menu in Projector Web Control. 2) Click the >'RZQORDG0,%¿OH@WRGRZQORDGD0,%¿OH 3) Click the [Enable] check box to open the SNMP Port. Set the address to send the SNMP trap to when a Failure/Warning occurs. Security Settings (55) 1) Select [Security Settings] on main menu in Projector Web Control. 2) Click the [SNMP] and set the community name on the screen that is displayed. Alert Settings (47) &RQ¿JXUHWKHVHWWLQJVIRU7UDSWUDQVPLVVLRQRI)DLOXUHV:DUQLQJV 1) Select [Alert Settings] on main menu in Projector Web Control. 6HOHFWWKH)DLOXUH:DUQLQJLWHPWREHFRQ¿JXUHG 3) Click the [Enable] check box to send out the SNMP trap for Failures/Warnings. Clear the [Enable] check box when SNMP trap transmission is not required. 4) Click the [Apply]EXWWRQWRVDYHWKHVHWWLQJV NOTE 5HJLVWHUWKHGRZQORDGHG0,%¿OHWR6103PDQDJHUSURJUDPWREHXVHG %HVXUHWRH[HFXWH1HWZRUN5HVWDUWZKHQWKHVHWWLQJVRI[Port Settings] or [Security Settings] is changed. 91 8. Other Functions 8.3 Event Scheduling 7KHVFKHGXOLQJIXQFWLRQHQDEOHVWRVHWXSVFKHGXOHGHYHQWVLQFOXGLQJSRZHURQ power off. It enables to be “self-management” projector. Installing the battery is required if you want to use under the conditions that 67$1'%<02'(LVVHWWR6$9,1*5HIHUWR2SHUDWLQJ*XLGH±237,21RU the AC power is turned off. (5HIHUWR8VHU V0DQXDOFRQFLVH Note the following before setting the schedule. NOTE 6FKHGXOHFDQDOVREHVHWLQ237,216&+('8/(PHQXRIWKH projector. (5HIHUWR2SHUDWLQJ*XLGH±237,21 $PD[LPXPRISURJUDPVRIVFKHGXOHFDQEHVHW$PD[LPXPRIHYHQWV can be registered in 1 program. 1RHYHQWVDUHUHJLVWHUHGLQSURJUDP±ZLWKIDFWRU\GHIDXOWVHWWLQJV7KH SURJUDPLVUHTXLUHGWREHVHWLQDGYDQFHZKHQXVLQJWKHVFKHGXOHIXQFWLRQIRU WKH¿UVWWLPH 7KHSULRULW\IRUVFKHGXOHGHYHQWVLVDVIROORZVVSHFL¿FGDWHZHHNO\ 8SWR¿YHVSHFL¿FGDWHVDUHDYDLODEOHIRUVFKHGXOHGHYHQWV3ULRULW\LVJLYHQWR WKRVHZLWKWKHORZHUQXPEHUVZKHQPRUHWKDQRQHHYHQWKDVEHHQVFKHGXOHG IRUWKHVDPHGDWHDQGWLPHHJµ6SHFL¿FGDWH1R¶KDVSULRULW\RYHUµ6SHFL¿F date No. 2’ and so on. 7KHSRZHURQHYHQWKDVWKHORZHVWSULRULW\DPRQJDOOWKHHYHQWVWKDWDUHVHW at the same time. %HVXUHWRVHWWKHGDWHDQGWLPHEHIRUHHQDEOLQJVFKHGXOHGHYHQWV53) $IWHUWKHSURMHFWRULVPRYHGFKHFNWKHGDWHDQGWLPHVHWIRUWKHSURMHFWRU EHIRUHFRQ¿JXULQJWKHVFKHGXOHV 7KHLQWHUQDOFORFN¶VWLPHPD\QRWUHPDLQDFFXUDWH8VLQJ6173LVUHFRPPHQGHG to maintain accurate time. &HUWDLQHUURUVWDWHLQWKHSURMHFWRUVXFKDVWHPSHUDWXUHHUURUODPSHUURUZLOO SUHYHQWWKHSURMHFWRUIURPDSSURSULDWHH[HFXWLRQRIVFKHGXOHGIXQFWLRQVHYHQWV (YHQWV³My Image” and “Messenger” will not be executed appropriately and result in “schedule execution error” status when the lamp does not light and/or data to be displayed are not stored in the projector at the time when scheduled HYHQWLVH[HFXWHG (YHQWV³Input Source” and “My Image” is not executed if security function is enabled and the projector is locked due to the function. ,IQR86%PHPRU\GHYLFHLVLQVHUWHGWRWKHSURMHFWRURUQRLPDJHGDWDIRU GLVSOD\H[LVWVDWWKHVFKHGXOHGHYHQWWLPHDVFKHGXOHH[HFXWLRQHUURURFFXUV DJDLQVWWKHVFKHGXOHG6OLGHVKRZHYHQW :KHQ\RXVWDUWWKH6OLGHVKRZLQSXWVRXUFHZLOOEHDXWRPDWLFDOO\VZLWFKHGWR the USB TYPE A port. ,PDJH¿OHVVWRUHGLQWKHURRWGLUHFWRU\RIWKH86%PHPRU\GHYLFHZLOOEH displayed for the scheduled Slideshow. 92 8. Other Functions The procedure to set the schedule in Projector Web Control is described in the following. 6HWWLQJWKHSURJUDPLVQHFHVVDU\WRXVHWKHVFKHGXOHIXQFWLRQ9DULRXVHYHQWV VXFKDVSRZHURQRIIRUVZLWFKLQJLQSXWVRXUFHDQGWKHWLPHWRH[HFXWHWKHHYHQWV DUHWREHUHJLVWHUHGLQWKHSURJUDP1RHYHQWVDUHUHJLVWHUHGLQSURJUDP± with factory default settings. Set the program following the steps below. In the case that the program has already been set, skip to step 6). 1) Select [Schedule Settings] on main menu in Projector Web Control. 6HOHFWWKHSURJUDPQXPEHULQGURSGRZQOLVWXQGHU3URJUDP/LVWDQGFOLFNWKH [Program Edit] button to display the following program edit display. The display for editing Program-1 is shown below. $IWHUVHWWLQJWKHWLPHHYHQWVDQGSDUDPHWHUVFOLFNWKH[Register] to add the QHZHYHQW Click the [Delete]EXWWRQZKHQ\RXZDQWWRGHOHWHDQHYHQW Click the [Delete All]EXWWRQZKHQ\RXZDQWWRGHOHWHDOOWKHHYHQWVLQWKHFXUUHQWO\ selected program. 93 8. Other Functions 4) When you want to edit the program with other number continuously, select the program you want to edit in dropdown list and click the [Select] button to display the display for editing the selected program. 5) Click the [Back] button to go back to schedule management screen after ¿QLVKLQJWKHSURJUDPVHWWLQJ 7KHSURFHGXUHWRDVVLJQWKHSURJUDPVHWLQWKHVWHSaWRWKHVFKHGXOHLV described in the following. 6) Click the checkbox of the schedule to be executed (e.g. Click the checkbox of “Monday”, when it is to be executed on Mondays) in the schedule management screen. 6HOHFWWKHSURJUDPWREHH[HFXWHGLQGURSGRZQOLVW<RXFDQFRQ¿UPWKHHYHQW information registered in each program in the program list on the bottom of the screen. :KHQVHWWLQJWKH6SHFL¿FGDWH1RaHQWHUWKHGDWHPRQWKGD\ 8) Click the [Apply]EXWWRQWRVDYHWKHVFKHGXOHVHWWLQJVLQWKHSURMHFWRU 5HSHDWVWHSaVLPLODUO\WRVHWWKHVFKHGXOH\RXZDQWWRH[HFXWH The schedule settings are now complete. )LQDOO\FRQ¿UPWKHWLPHVWRUHGLQWKHSURMHFWRULVFRUUHFWO\VHW Ŷ+RZWRFRS\WKHSURJUDP When you copy the currently selected program to other program, click the checkbox under icon. Click the [Copy to] button after selecting the program to which you want to copy in dropdown list. 7KHVDPHSURJUDPDVWKHFXUUHQWO\VHOHFWHGRQHFDQQRWEHVSHFL¿HGDVWKH program to which you want to copy. 94 8. Other Functions 8.4 Command Control via the Network <RXFDQFRQ¿JXUHDQGFRQWUROWKHSURMHFWRUYLDWKHQHWZRUNXVLQJ56& commands. Communication Port The following two ports are assigned for the command control. 7&3(Network Control Port1 (Port: 23)) 7&3(Network Control Port2 (Port: 9715)) NOTE &RPPDQGFRQWUROLVDYDLODEOHRQO\YLDWKHVSHFL¿HGSRUWDERYH Command Control Settings (44) &RQ¿JXUHWKHIROORZLQJLWHPVIURPDZHEEURZVHUZKHQFRPPDQGFRQWUROLVXVHG Example: If the IP address of the projector is set to 192.168.1.10: 1) Enter “http://192.168.1.10/” into the address bar of the web browser, and select Projector Web Control from the selection window. 2) Enter your user name and password, and then click the [OK]. 3) Click the [Port Settings] on the main menu. 4) Click the [Enable] check box to open Network Control Port1 (Port: 23) to use 7&3&OLFNWKH[Enable] check box for the [Authentication] setting when authentication is required, otherwise clear the check box. 5) Click the [Enable] check box to open Network Control Port2 (Port: 9715) to XVH7&3&OLFNWKH[Enable] check box for the [Authentication] setting when authentication is required, otherwise clear the check box. 6) Click the [Apply]EXWWRQWRVDYHWKHVHWWLQJV 95 8. Other Functions 8.4 Command Control via the Network (continued) When the authentication setting is enabled, the following settings are required. (55) 7) Click the [Security Settings] on the main menu. 8) Click the [Network Control] and enter the desired authentication password. * See NOTE. 9) Click the [Apply]EXWWRQWRVDYHWKHVHWWLQJV NOTE 7KH$XWKHQWLFDWLRQ3DVVZRUGZLOOEHWKHVDPHIRUNetwork Control Port1 (Port: 23), Network Control Port2 (Port: 9715), PJLink™ Port (Port: 4352), My Image Port (Port: 9716) and Messenger Port (Port: 9719). 7KHQHZFRQ¿JXUDWLRQVHWWLQJVDUHDFWLYDWHGDIWHUUHVWDUWLQJWKHQHWZRUN FRQQHFWLRQ:KHQWKHFRQ¿JXUDWLRQVHWWLQJVDUHFKDQJHG\RXPXVWUHVWDUW the network connection. You can restart the network connection from Network Restart on the main menu. (63) 96 8. Other Functions 8.4 Command Control via the Network (continued) Command Format Command formats differ among the different communication ports. Ɣ7&3 You can use the RS-232C commands without any changes. The reply data format is the same as the RS-232C commands. (RS-232C Communication in WKH2SHUDWLQJ*XLGH7HFKQLFDO +RZHYHUWKHIROORZLQJUHSO\ZLOOEHVHQWEDFNLQWKHHYHQWRIDXWKHQWLFDWLRQ failure when authentication is enabled. 5HSO\LQWKHHYHQWRIDQDXWKHQWLFDWLRQHUURU! Reply 0x1F Error code 0x04 0x00 Ɣ7&3 Send Data format The following formatting is added to the header (0 x 02), Data length (0 x 0D), Checksum (1 byte) and Connection ID (1 byte) of the RS-232C commands. Header Data length RS-232Ccommand Check Sum Connection ID 0x02 0x0D 13 bytes 1 byte 1 byte +HDGHU ĺ [)L[HG 'DWDOHQJWK ĺ 56&FRPPDQGVE\WHOHQJWK[')L[HG 56&FRPPDQG ĺ 56&FRPPDQGVWKDWVWDUWZLWK[%([() (13 bytes) &KHFN6XP ĺ 7KLVLVWKHYDOXHWRPDNH]HURRQWKHDGGLWLRQRIWKH lower 8 bits from the header to the checksum. &RQQHFWLRQ,' ĺ 5DQGRPYDOXHIURPWR7KLVYDOXHLVDWWDFKHG to the reply data) 97 8. Other Functions 8.4 Command Control via the Network (continued) Reply Data format The connection ID (the data is same as the connection ID data on the sending data format) is attached to the RS-232C commands reply data. $&.UHSO\! Reply Connection ID 0x06 1 byte 1$.UHSO\! Reply Connection ID 0x15 1 byte (UURUUHSO\! Reply Error code Connection ID 0x1C 2 bytes 1 byte Reply Data Connection ID 0x1D 2 bytes 1 byte 'DWDUHSO\! 3URMHFWRUEXV\UHSO\! Reply Status code Connection ID 0x1F 2 bytes 1 byte $XWKHQWLFDWLRQHUURUUHSO\! 98 Reply Authentication Error code 0x1F 0x04 0x00 Connection ID 1 byte 8. Other Functions 8.4 Command Control via the Network (continued) Automatic Connection Break The TCP connection will be automatically disconnected after there is no communication for 30 seconds after being established. Authentication The projector does not accept commands without authentication success when authentication is enabled. The projector uses a challenge response type authentication with an MD5 (Message Digest 5) algorithm. :KHQWKHSURMHFWRULVXVLQJD/$1DUDQGRPE\WHVZLOOEHUHWXUQHGLI DXWKHQWLFDWLRQLVHQDEOHG%LQGWKLVUHFHLYHGE\WHVDQGWKH$XWKHQWLFDWLRQ Password and digest this data with the MD5 algorithm and add this in front of the commands to send. Following is a sample if the Authentication Password is set to “password” and the random 8 bytes are “a572f60c”. 1) Connect the projector. 5HFHLYHWKHUDQGRPE\WHV³DIF´IURPWKHSURMHFWRU %LQGWKHUDQGRPE\WHV³DIF´DQGWKH$XWKHQWLFDWLRQ3DVVZRUG “password” and it becomes “a572f60cpassword”. 4) Digest this bind “a572f60cpassword” with MD5 algorithm. It will be “e3d97429adffa11bce1f7275813d4bde”. 5) Add this “e3d97429adffa11bce1f7275813d4bde” in front of the commands and send the data. 6HQG³HGDGIIDEFHIGEGH´FRPPDQG 6) When the sending data is correct, the command will be performed and the reply data will be returned. Otherwise, an authentication error will be returned. NOTE $VIRUWKHWUDQVPLVVLRQRIWKHVHFRQGRUVXEVHTXHQWFRPPDQGVWKH authentication data can be omitted when the same connection. 99 8. Other Functions 8.5 Crestron RoomView® Crestron RoomView®LVDPXOWLXVHUUHVRXUFHPDQDJHPHQWSURJUDPSURYLGHG by Crestron Electronics, Inc. It is an application for managing and controlling the SURMHFWRUDQGRWKHU$9GHYLFHVFROOHFWLYHO\ For details of Crestron RoomView®, refer to the Crestron® website. 85/http://www.crestron.com The following communication interfaces can be used to manage the entire facility. 1) Crestron RoomView® Express / Crestron RoomView®6HUYHU(GLWLRQ RoomView® Express and RoomView®6HUYHU(GLWLRQDUHVRIWZDUHSURYLGHG E\&UHVWURQ(OHFWURQLFV,QF7KH\DUHXVHGIRUPDQDJLQJDOOWKH$9GHYLFHV and are also able to communicate with the help desk as well as send out alert messages. For details of the software, refer to the following website. 85/KWWSZZZFUHVWURQFRPJHWURRPYLHZ 2) Crestron e-Control® Crestron e-Control®LVDV\VWHPFRQWUROOHUWKDWFDQEHRSHUDWHGYLDDZHE browser. (65) 100 9. Troubleshooting 9. Troubleshooting Phenomenon: Cannot communicate with the projector. (Wired network) Item to be checked ,VWKHSURMHFWRUWXUQHGRQ" Solutions Turn on the projector. ,VWKHQHWZRUNGHYLFHVXFKDVD 7XUQRQWKHQHWZRUNGHYLFH URXWHUHWFWXUQHGRQ" ,V67$1'%<02'(VHWWR 6$9,1*" 7KHQHWZRUNIXQFWLRQLVQRWDYDLODEOHZKHQ 67$1'%<02'(LVVHWWR6$9,1*,I\RX want to use the network function in the standby PRGHVHWWR1250$/ ,V/$1FDEOHFRQQHFWHG" &RQQHFWWKH/$1FDEOH Contact your dealer when MAC address on Is MAC address displayed the label put on the projector does not match correctly in the NETWORK ,1)250$7,21±:,5('PHQX" MAC address displayed in the NETWORK INFORMATION – WIRED menu. Are the network settings such as Check the network settings in the NETWORK ,3DGGUHVVVHWFRUUHFWO\" INFORMATION – WIRED menu. Consult with your network administrator for details. ,V¿UHZDOORUSDFNHW¿OWHULQJVHWLQ Consult with your network administrator. DURXWHUHWF" Is the same network address set The same network address cannot be used IRUZLUHOHVV/$1DQGZLUHG/$1 IRUZLUHOHVV/$1DQGZLUHG/$16HWGLIIHUHQW QHWZRUNDGGUHVVIRUZLUHOHVV/$1DQGZLUHG RIWKHSURMHFWRU" /$1 Is the wired network adapter of WKHFRPSXWHUHQDEOHG" Refer to the user’s manual for the computer and enable the wired network adapter. 101 9. Troubleshooting Phenomenon: Cannot communicate with the projector. (Wireless network) Item to be checked ,VWKHSURMHFWRUWXUQHGRQ" Solutions Turn on the projector. ,VWKHQHWZRUNGHYLFHVXFKDVDQ 7XUQRQWKHQHWZRUNGHYLFH DFFHVVSRLQWHWFWXUQHGRQ" ,V67$1'%<02'(VHWWR 6$9,1*" 7KHQHWZRUNIXQFWLRQLVQRWDYDLODEOHZKHQ 67$1'%<02'(LVVHWWR6$9,1*,I\RX want to use the network function in the standby PRGHVHWWR1250$/ Are the network settings such as Check the network settings in the NETWORK ,3DGGUHVVVHWFRUUHFWO\" INFORMATION 䠉:,5(/(66PHQX&RQVXOW with your network administrator for details. ,VWKH86%ZLUHOHVVDGDSWHU ,QVHUWWKH86%ZLUHOHVVDGDSWHU RSWLRQDOSDUWV86%:/1 inserted into USB TYPE A port of WKHSURMHFWRU" ,VDQRSWLRQDO86%ZLUHOHVV DGDSWHUXVHG" 7KH86%ZLUHOHVVDGDSWHUDYDLODEOHWRWKLV SURMHFWRULVRSWLRQDO86%:/1RQO\ Is MAC address displayed correctly in the NETWORK INFORMATION 䠉:,5(/(66 PHQX" When MAC address displayed in NETWORK ,1)250$7,21±:,5(/(66PHQXGRHVQRW PDWFK0$&DGGUHVVHQJUDYHGRQWKH86% ZLUHOHVVDGDSWHUSXOORXWDQGLQVHUWWKH86% wireless adapter again. ,IWKHSUREOHPSHUVLVWVWKH86%ZLUHOHVV adapter may be broken. Contact your dealer. ,V/('RIWKH86%ZLUHOHVV DGDSWHUEOLQNLQJ" :KHQ/('RIWKH86%ZLUHOHVVDGDSWHUGRHV QRWEOLQNLQRYHUPLQXWHDIWHULQVHUWLQJSXOO RXWDQGLQVHUWWKH86%ZLUHOHVVDGDSWHUDJDLQ ,IWKHSUREOHPSHUVLVWVWKH86%ZLUHOHVV adapter may be broken. Contact your dealer. 102 9. Troubleshooting Phenomenon: Cannot communicate with the projector. (Wireless network) (continued) Item to be checked Solutions ,V¿UHZDOORUSDFNHW¿OWHULQJVHWLQ Consult with your network administrator. DQDFFHVVSRLQWHWF" Is the wireless network to FRQQHFWHQFU\SWHG" Set the encryption settings of the projector again and reconnect. Is an encryption method which The followings are encryption methods is not supported by the projector supported by the projector: XVHG" 䡡㻌WPA2-PSK(AES) 䡡㻌WPA2-PSK(TKIP) 䡡㻌WPA-PSK(AES) 䡡㻌WPA-PSK(TKIP) 䡡㻌WEP128bit 䡡㻌WEP64bit This projector cannot be connected to the wireless network using the encryption methods RWKHUWKDQWKHDERYH Is signal strength of wireless network displayed in the SSID 6&$1/,67PHQXZHDN" 䡡㻌3XWWKHSURMHFWRUFORVHWRWKHZLUHOHVVGHYLFH 䡡㻌When the projector is near the steel door, WKHUDGLRZDYHPD\QRWUHDFKWRWKHZLUHOHVV GHYLFH,QWKDWFDVHNHHSWKHSURMHFWRUDZD\ from the door. 䡡㻌Consult with your network administrator because there may be an interfering wireless GHYLFH ,V*+]UDGLRZDYHXVHG" 7KH86%ZLUHOHVVDGDSWHU86%:/1 GRHVQRWVXSSRUW*+]EXWRQO\*+] Is the same network address set The same network address cannot be used IRUZLUHOHVV/$1DQGZLUHG/$1 IRUZLUHOHVV/$1DQGZLUHG/$16HWGLIIHUHQW QHWZRUNDGGUHVVIRUZLUHOHVV/$1DQGZLUHG RIWKHSURMHFWRU" /$1 Is the wireless network adapter RIWKHFRPSXWHUHQDEOHG" Refer to the user’s manual for the computer and enable the wireless network adapter. 103 9. Troubleshooting 3KHQRPHQRQ&DQQRWXVHZLUHOHVV/$1DQGZLUHG/$1DWWKHVDPHWLPH Item to be checked Is the same network address set IRUZLUHOHVV/$1DQGZLUHG/$1 RIWKHSURMHFWRU" Solutions The same network address cannot be used IRUZLUHOHVV/$1DQGZLUHG/$16HWGLIIHUHQW QHWZRUNDGGUHVVIRUZLUHOHVV/$1DQGZLUHG /$1 Are you trying to access to GLIIHUHQWQHWZRUNYLDDURXWHU" (LWKHUZLUHG/$1RUZLUHOHVV/$1FDQDFFHVV to different network. 6HWGHIDXOWJDWHZD\RIHLWKHUZLUHG/$1RU ZLUHOHVV/$1WR Phenomenon: Web(Projector Web Control) is not displayed correctly. Item to be checked ,VWKHFRUUHFW85/HQWHUHGLQ :HEEURZVHU" Solutions Enter the IP address of the projector in Web browser. ,V-DYD6FULSWHQDEOHG" (QDEOH-DYD6FULSW How to set is different depending on the Web browser. Refer to Help of Web browser, etc. for details. Is recommended Web browser XVHG" Recommended Web browsers are Internet Explorer 6/7/8/9/10. Projector Web Control may not displayed correctly except in recommended browser. Is the cache of the screen GLVSOD\HGHDUOLHUUHPDLQLQJ" Clear the cache. How to set is different depending on the Web browser. Refer to Help of Web browser, etc. for details. 104 9. Troubleshooting Phenomenon: Crestron e-Control® is not displayed. Item to be checked Has Adobe® Flash® Player been LQVWDOOHG" Solutions Adobe® Flash® Player is required to display Crestron e-Control®. Install Adobe® Flash® Player. Is Web browser that does not support Adobe® Flash® Player XVHG" 8VHD:HEEURZVHUWKDWVXSSRUWV$GREH® Flash® Player. Are Crestron e-Control® settings Enable Crestron e-Control® settings on on Network Settings – Other Network Settings – Other Setup screen of the Setup screen of the Projector Projector Web Control. :HE&RQWUROGLVDEOHG" Phenomenon: Cannot send an e-mail correctly. Item to be checked ,VDWHVWHPDLOVHQWFRUUHFWO\" Solutions Check if a test e-mail is sent correctly by pressing the [Send Test Mail] button on the Mail Settings screen of the Projector Web Control. $UHHPDLOVHWWLQJVFRUUHFW" Check the settings on the Mail Settings screen of the Projector Web Control. Are the settings of Sender E-mail 6HWYDOLGHPDLODGGUHVV $GGUHVVFRUUHFW" Is only e-mail regarding the VSHFL¿F(UURU:DUQLQJQRWVHQW FRUUHFWO\" &KHFNLIWKHVSHFL¿F(UURU:DUQLQJLVVHWWR be sent on the Mail Settings screen of the Projector Web Control. 105 9. Troubleshooting 3KHQRPHQRQ$QHPDLOGRHVQRWUHDFKRQO\WRWKHVSHFL¿FDGGUHVV Item to be checked ,VHPDLODGGUHVVVHWFRUUHFWO\" Solutions Check the settings on the Mail Settings screen of the Projector Web Control. ,V¿OWHULQJRUIRUZDUGLQJVHWIRU the e-mail address in the mail VHUYHU" Consult with your network administrator. Phenomenon: The schedule is not executed correctly. Item to be checked ,VWKHSURMHFWRUWXUQHGRQ" Solutions Turn on the projector. ,V67$1'%<02'(VHWWR 6$9,1*" 7KHVFKHGXOHIXQFWLRQLVQRWDYDLODEOHZKHQ 67$1'%<02'(LVVHWWR6$9,1*,I\RXZDQW to use the schedule function in the standby PRGHVHWWR1250$/ ,VWKHWLPHVHWFRUUHFWO\" Check the settings of Date and Time. Is the image data to be displayed Register the image data to be displayed with in the schedule function WKHSURMHFWRUE\XVLQJH[FOXVLYHDSSOLFDWLRQ UHJLVWHUHG" software. :KHQWKHHYHQWRI0\,PDJHLV set.) Is the message data to be Register the message data to be displayed with displayed in the schedule WKHSURMHFWRUE\XVLQJH[FOXVLYHDSSOLFDWLRQ IXQFWLRQUHJLVWHUHG" software. :KHQWKHHYHQWRI0HVVHQJHULV set.) Is the lamp of the projector OLJKWLQJ" 106 7KHHYHQWRI0\,PDJH0HVVHQJHUDQG%ODQN are not executed when the lamp is not lighting. Set the program of the schedule function so WKDWWKHHYHQWRI0\,PDJH0HVVHQJHUDQG %ODQNFDQEHH[HFXWHGZKHQWKHODPSLV lighting. 9. Troubleshooting Item to be checked Is the program to be executed VHWFRUUHFWO\" Solutions Check the settings of Schedule Settings of the Projector Web Control. $UHWKHUHDQ\HYHQWVVHWDWWKH VDPHWLPH" 6RPHHYHQWVFDQQRWEHH[HFXWHGDWWKHVDPH time. Set them to be executed at the different time or change the order. * The schedule function may not operate correctly depending on the status of the projector. Phenomenon: The time settings are not correct. Item to be checked ,VEDWWHU\VHW" Solutions Set the battery. The battery is considered to be exhausted if the time is off soon after setting date and time. In that case, replace the battery. ,VWKHGDWHDQGWLPHVHWFRUUHFWO\" Check the settings of Date/Time Settings menu of the Projector Web Control or DATE AND TIME menu of the projector. Is the projector connected to the Connect to the network. network correctly when getting WKHWLPHYLDWKHQHWZRUN" ,V6173VHUYHUVHWFRUUHFWO\ ZKHQJHWWLQJWKHWLPHYLDWKH QHWZRUN" &KHFNWKHVHWWLQJVRI6173VHUYHU Consult with your network administrator UHJDUGLQJWKHVHWWLQJVRI6173VHUYHU Is the time difference set correctly :KHQJHWWLQJWKHWLPHYLDWKHQHWZRUN the correct time is not displayed if the time ZKHQJHWWLQJWKHWLPHYLDWKH difference is not set. QHWZRUN" Set the time difference. 107 9. Troubleshooting Phenomenon: &DQQRWFRQWUROWKHH[WHUQDOGHYLFHE\XVLQJ1HWZRUN%ULGJH Item to be checked ,V1HWZRUN%ULGJHVHWWLQJV HQDEOHG" Solutions Check the settings in OPTION – SERVICE ±&20081,&$7,21±&20081,&$7,21 TYPE menu. ,V67$1'%<02'(VHWWR 6$9,1*" 7KH1HWZRUN%ULGJHLVQRWDYDLODEOHZKHQ 67$1'%<02'(LVVHWWR6$9,1*6HW 67$1'%<02'(WR1250$/DQGVHW 1(7:25.%5,'*(:,5(/(66:,5('LQ WKH&20081,&$7,217<3(PHQX Are the serial settings set FRUUHFWO\" Check the serial settings of the projector and WKHH[WHUQDOGHYLFH 108 10. Warranty and after-sales service :DUUDQW\DQGDIWHUVDOHVVHUYLFH ,IDQDEQRUPDORSHUDWLRQVXFKDVVPRNHVWUDQJHRGRURUH[FHVVLYHVRXQG should occur, stop using the projector immediately. ,IWKLVGRHVQRWUHVROYHWKHSUREOHPSOHDVHFRQVXOW\RXUGHDOHURUVHUYLFH company. They will tell you what warranty condition is applied. 3OHDVHFKHFNWKHIROORZLQJZHEDGGUHVVZKHUH\RXPD\¿QGWKHODWHVWLQIRUPDWLRQ for this projector. http://www.hitachi-america.us/projectors http://www.hitachiserviceeu.com/support/guides/userguides.htm Trademark acknowledgment 0LFURVRIW® and Internet Explorer®, Windows®, Windows Vista® are registered trademark of 0LFURVRIW&RUSRUDWLRQLQWKH86DQGRURWKHUFRXQWULHV $GREH® and Flash® are registered trademarks of Adobe Systems Incorporated. 3HQWLXP® is a registered trademark of Intel Corporation. -DYD6FULSW® is a registered trademark of Sun Microsystems, Inc. +'0,TMWKH+'0,ORJRDQG+LJK'H¿QLWLRQ0XOWLPHGLD,QWHUIDFHDUHWUDGHPDUNVRU UHJLVWHUHGWUDGHPDUNVRI+'0,/LFHQVLQJ//&LQWKH8QLWHG6WDWHVDQGRWKHUFRXQWULHV &UHVWURQ®, Crestron e-Control®, e-Control®, Crestron RoomView® and RoomView® are trademarks or registered trademarks of Crestron Electronics, Inc. in WKH8QLWHG6WDWHVDQGRWKHUFRXQWULHV 7UDGHPDUN3-/LQNLVDWUDGHPDUNDSSOLHGIRUWUDGHPDUNULJKWVLQ -DSDQWKH8QLWHG6WDWHVRI$PHULFDDQGRWKHUFRXQWULHVDQGDUHDV $OORWKHUWUDGHPDUNVDUHWKHSURSHUWLHVRIWKHLUUHVSHFWLYHRZQHUV 109