Download Toshiba BDX1250KE User's Manual
Transcript
Blu-ray Disc™ Player BDX1250KE Owner’s Manual Contents English 1 Important ................................................................................................................... 3-4 Safety and important notice ..............................................................................................3 Disposal of your old product and batteries ...................................................................... 3-4 2 Your Product .............................................................................................................. 5-7 Regions codes ................................................................................................................. 5 Product overview ............................................................................................................. 6 Remote Control................................................................................................................ 7 3 Connections ............................................................................................................... 8-9 Connecting to a TV .......................................................................................................... 8 Optional Connection ......................................................................................................... 8 Connect USB device ......................................................................................................... 9 Connect Power ................................................................................................................ 9 4 Preparation ................................................................................................................. 10 Prepare the remote control ............................................................................................. 10 Setting up the player ...................................................................................................... 10 5 Playback ................................................................................................................. 11-13 Playback Functions .....................................................................................................11-13 6 Customizing ............................................................................................................14-20 General Setting ..........................................................................................................14-18 Display Setting...........................................................................................................18-19 Audio Setting..................................................................................................................20 System information ........................................................................................................ 20 6SHFL¿FDWLRQ ............................................................................................................... 21 8 Troubleshooting .....................................................................................................22-23 9 Glossary ..................................................................................................................24-25 10 License Information ...............................................................................................26-48 2 Safety and important notice Disposal of your old product and batteries Warning: 5LVNRIRYHUKHDWLQJ1HYHULQVWDOOWKHSURGXFWLQD FRQ¿QHGVSDFH$OZD\VOHDYHDVSDFHRIDWOHDVW 10cm around the product for ventilation. Ensure curtains or other objects never cover the ventilation slots on the product. 1HYHUSODFHWKHSURGXFWUHPRWHFRQWURORU EDWWHULHVQHDUQDNHGÀDPHVRURWKHUKHDW sources, including direct sunlight. 2QO\XVHWKLVSURGXFWLQGRRUV.HHSWKLVSURGXFW DZD\IURPZDWHUPRLVWXUHDQGOLTXLG¿OOHG objects. 1HYHUSODFHWKLVSURGXFWRQRWKHUHOHFWULFDO equipment. .HHSDZD\IURPWKLVSURGXFWGXULQJOLJKWQLQJ storms. :KHUHWKHPDLQVSOXJRUDQDSSOLDQFHFRXSOHULV used as the disconnect device, the disconnect device shall remain readily operable. LASER CAUTION: 86(2)&21752/625$'-8670(17625 3(5)250$1&(2)352&('85(627+(57+$1 7+26(63(&,),('+(5(,10$<5(68/7,1 +$=$5'2865$',$7,21(;32685( CAUTION: 9,6,%/($1',19,6,%/(/$6(55$',$7,21 :+(123(1$1',17(5/2&.6'()($7(''2 12767$5(,172%($0 LOCATION: ,16,'(1($57+('(&.0(&+$1,60 EU Conformity Statement This product is marked with "CE" and complies therefore with the applicable harmonized (XURSHDQVWDQGDUGVOLVWHGXQGHUWKH/RZ 9ROWDJH'LUHFWLYH(&DQGWKH(0& Directive 2004/108/EC. ErP Directive 2009/125/ EC Responsible for CE-marking is 726+,%$(8523(*0%+ +DPPIHOGGDPP'1HXVV*HUPDQ\ Pb,Hg,Cd Following information is only valid for EUmember States: Disposal of products The crossed out wheeled dust bin symbol indicates that products must be collected and disposed of separately from household waste. Integrated batteries and accumulators can be disposed of with the product. They will be separated at the recycling centres. The black bar indicates that the product was placed on the market after August 13, 2005. By participating in separate collection of products and batteries, you will help to assure the proper disposal of products and batteries and thus help to prevent potential negative consequences for the environment and human health. For more detailed information about the collection and recycling programmes available in your country, please contact your retailer where the product was purchased. Disposal of batteries and/or accumulators The crossed out wheeled dust bin symbol indicates that batteries and/or accumulators must be collected and disposed of separately from household waste. If the battery or accumulator contains more than the specified values of lead (Pb), mercury (Hg),and/or cadmium (Cd) defined in the Battery Directive (2006/66/EC), then the chemical symbols for lead (Pb), mercury (Hg) and/or cadmium (Cd) will appear below the crossed out wheeled dust bin symbol. By participating in separate collection of batteries, you will help to assure the proper disposal of products and batteries and thus help to prevent potential negative consequences for the environment and human health. For more detailed information about the collection and recycling programmes available in your country, please contact your retailer where the product was purchased. Copyright notice This product incorporates copyright protection technology that is protected by U.S. patents and other intellectual property rights. Use of this copyright protection technology must be authorized by Rovi Corporation, and is intended for 3 English 1 Important English home and other limited viewing uses only unless otherwise authorized by Rovi Corporation. Reverse engineering or disassembly is prohibited. Notice for Trademark +'0,WKH+'0,ORJRDQG+LJK'H¿QLWLRQ 0XOWLPHGLD,QWHUIDFHDUHWUDGHPDUNVRU UHJLVWHUHGWUDGHPDUNVRI+'0,/LFHQVLQJ //&LQWKH8QLWHG6WDWHVDQGRWKHU countries. µ$9&+'¶DQGWKHµ$9&+'¶ORJRDUH trademarks of Panasonic Corporation and Sony Corporation. ‘DVD Video¶ is a trademark of DVD Format/ /RJR/LFHQVLQJ&RUSRUDWLRQ 2UDFOHDQG-DYDDUHUHJLVWHUHGWUDGHPDUNV RI2UDFOHDQGRULWVDI¿OLDWHV2WKHUQDPHV may be trademarks of their respective owners. BONUSVIEW ™ Blu-ray Disc70, Blu-ray70%'/LYH70, %21869,(:70, and the logos are trademarks of the Blu-ray Disc Association. 0DQXIDFWXUHGXQGHUOLFHQVHIURP'ROE\ /DERUDWRULHV'ROE\DQGWKHGRXEOH' symbol are trademarks of Dolby /DERUDWRULHV 0DQXIDFWXUHGXQGHUOLFHQVHXQGHU86 3DWHQW1RV RWKHU 86DQGZRUOGZLGHSDWHQWVLVVXHG SHQGLQJ'76+'WKH6\PERO'76+' and the Symbol together are registered WUDGHPDUNV'76+'0DVWHU$XGLR_ (VVHQWLDOLVDWUDGHPDUNRI'76,QF 3URGXFWLQFOXGHVVRIWZDUH'76,QF$OO Rights Reserved. 4 $%287',9;9,'(2 'LY;® is a digital video format created by 'LY;,QF7KLVLVDQRI¿FLDO'LY;&HUWL¿HG® GHYLFHWKDWSOD\V'LY;YLGHR9LVLWGLY[FRP for more information and software tools to FRQYHUW\RXU¿OHVLQWR'LY;YLGHR $%287',9;9,'(221'(0$1' 7KLV'LY;&HUWL¿HG® device must be UHJLVWHUHGLQRUGHUWRSOD\SXUFKDVHG'LY; Video-on-Demand (VOD) movies. To obtain your registration code, locate the 'LY;92'VHFWLRQLQ\RXUGHYLFHVHWXS PHQX*RWRYRGGLY[FRPIRUPRUH information on how to complete your registration. 'LY;®'LY;&HUWL¿HG® and associated logos DUHWUDGHPDUNVRI'LY;,QFDQGDUHXVHG under license. )RU+'7HVW.LWSYDQGODWHU 'LY;&HUWL¿HG®WRSOD\'LY;® video up to +'SLQFOXGLQJSUHPLXPFRQWHQW Region Regions Codes Both the Blu-ray Disc70 Player and the discs are coded by region. These regional codes must match in order to play the GLVF,IWKHFRGHVGRQRWPDWFKWKHGLVF will not play. 7KH5HJLRQ1XPEHUIRUWKLV%OXUD\'LVF70 Player is described on the rear panel of the Blu-ray Disc70 player. Region " % $ # DVD discs that can be played ALL 1 ALL 2 ALL 3 " ! # ! ALL 4 " ALL 5 "!" ALL 6 Blu-ray™ discs that can be played English 2 Your Product North America, Central America, South America, Korea, Japan, Taiwan, Hong Kong and South East Asia. Europe, Greenland, French territories, Middle East, Africa, Australia and New Zealand. India, China, Russia, Central and South Asia. Feature highlights +LJK'H¿QLWLRQHQWHUWDLQPHQW :DWFKKLJKGH¿QLWLRQFRQWHQWGLVFZLWK +'79+LJK'H¿QLWLRQ7HOHYLVLRQ&RQQHFW LWWKURXJKDKLJKVSHHG+'0,FDEOH<RX FDQHQMR\H[FHOOHQWSLFWXUHTXDOLW\XSWR 1080p resolution with the frame rate of 24 frames per second with progressive scan output. BD-Live70 Connect this player to the movie studios website via the LAN jack to access a variety of up-to-date content (e.g. refreshed previews and exclusive special features). Blu-ray Disc 70 Java Blu-ray Disc 70-DYD%'-$SSOLFDWLRQ 7KH%'520IRUPDWVXSSRUWV-DYDIRU LQWHUDFWLYHIXQFWLRQV³%'-´RIIHUVFRQWHQW providers almost unlimited functionality ZKHQFUHDWLQJLQWHUDFWLYH%'520WLWOHV 5 Product overview English Main Unit 6 7 NO 4 3 Control Function a Turns the power on or restores the unit to the standby mode. b #9 Playback/Pause. c Y Stop play. d ; Open or close the disc compartment. e Display panel Show information about the current status of this unit. f ,56HQVRU 3RLQWWKHUHPRWHFRQWURODWWKH,5VHQVRU g Disc compartment /RDGVDGLVFLQWRWKHGLVFGULYH 1 6 5 2 3 4 2 1 5 NO Control Function a AC power cord Connects to a standard AC outlet. b &2$;,$/MDFN 2XWSXWGLJLWDODXGLRVLJQDOVZKHQFRQQHFWLQJWKHFRD[LDOGLJLWDOFDEOH c HDMI OUTPUT jack 2XWSXWVYLGHRDXGLRVLJQDOVWRDFRQQHFWHG79PRQLWRURU$9DPSOL¿HU &RQQHFWWRD79PRQLWRURU$9DPSOL¿HUHTXLSSHGZLWK+'0,LQSXW. d LAN jack 8VHWKLVWRFRQQHFWWRDQHWZRUNZLWKDQDOZD\VRQEURDGEDQGFRQQHFWLRQ,WLV UHVHUYHGIRUIXWXUHXVDJHRI%'/LYH e USB jack &RQQHFWD86%ÀDVKGULYH English Remote Control OPEN/CLOSE / Open/ Close the disc tray Number Buttons Select numbered items in a menu Press to enter track/ chapter/ title numbers/password directly CLEAR / To clear an entry or the bookmark and program you set MC(Media Center) / To open/close Media Center POP MENU/MENU / To display a menu included on many Blu-ray Disc™/DVD video discs OK / Acknowledge/ Confirm menu selection / Navigation/ Cursor buttons for moving to the left / right / up / down / Press during JPEG playback to rotate the current photo track, but the JPEG playback will be paused RETURN / Return to previous menu TOP MENU / To display the disc title during playback PROGRAM / To access program list. DIGEST / To access JPEG thumbnail view during playback SUBTITLE / To display subtitle; press repeatedly to select different subtitles available in your disc AUDIO / To select the sound stream; press repeatedly to select different audio streams available in your disc ANGLE / Switch the camera angle during playback REMOTE SIGNAL EMITTER / Point remote control to the sensor on the front panel ON / STANDBY 7 To switch the Blu-ray Disc™ Player to ON or standby mode SETUP Enters or exits the system setup menu REPEAT A-B 0 To repeat from A to B REPEAT 0 Selects various repeat mode. SEARCH 0 To search a title, chapter, track or playing time DISPLAY 0 To display a window to locate a title, chapter or track / Instant replay/instant search F.R & F.F Fast reverse/ fast forward PLAY/PAUSE 0 Start/Pause playback PREV & NEXT 0 Skip to previous/next chapter/ title/track STOP 0 Stop playback Do a slow forward during normal playback Advance the picture frame by frame during pause mode ZOOM 7 To zoom out/in BOOKMARK 7 To bookmark at any point during playback PIP (Picture in Picture) 7 Switch on or off the secondary video PIP AUDIO Switch the secondary audio of secondary video(PIP) to on or off HDMI 7 To change resolution of HDMI video output to fit TV. Such as 1080p, 1080i… etc 7 3 Connections English 0DNHWKHIROORZLQJFRQQHFWLRQWRXVHWKLV product. Connecting to a TV Connect the product to TV to view the playback from the disc. Connect to the HDMI Jack Optional Connection Option 1:&RQQHFWWRWKHGLJLWDODPSOL¿HU receiver Option 2: Connect to network Option 1: Connect to the digital DPSOL¿HUUHFHLYHU Route the sound from this player to other device to enhance audio output. DIGITAL AUDIO INPUT COAXIAL HDMI IN &RQQHFWD+'0,FDEOHIURPWKH+'0, RXWSXWMDFNRQWKLVSURGXFWWRWKH+'0, input jack on the TV. Note: ʹzŽƵĐĂŶŽƉƟŵŝnjĞƚŚĞǀŝĚĞŽŽƵƚƉƵƚďLJ ƉƌĞƐƐŝŶŐƚŚĞ,D/ďƵƩŽŶƌĞƉĞĂƚĞĚůLJƚŽƐĞůĞĐƚ ƚŚĞďĞƐƚƌĞƐŽůƵƟŽŶǁŚŝĐŚƚŚĞdsĐĂŶƐƵƉƉŽƌƚ͘ &RQQHFWDFRD[LDOFDEOHIURPWKH &2$;,$/MDFNRQWKLVSURGXFWWRWKH &2$;,$/MDFNRQWKHGHYLFH Option 2: Connect to network Connect this product to the network to HQMR\%'/LYH70 bonus content and software upgrade by network. &RQQHFWWKHQHWZRUNFDEOHIURPWKH/$1 MDFNRQWKHSURGXFWWRWKH/$1MDFNRQWKH network system. 8 Connect USB device English A USB device provides an additional memory WRVRIWZDUHXSJUDGHDQGHQMR\%'/LYH70 bonus content. <RXFDQDOVRHQMR\SOD\LQJEDFN03-3(* 03(*'LY;® ¿OHV VWRUHG LQ WKH 86% ÀDVK device. 1. Connect the USB Flash device to the USB jack on this product. Notes: -‐ Connect only a USB Flash device to the USB jack on this product. -‐ To enjoy BD-‐Live™ bonus content, as your local storage, use a 1 GB or larger USB memory. Ͳ&Žƌ ƐŽŵĞ ůƵͲƌĂLJdD ĚŝƐĐƐ ǁŝƚŚ Ͳ>ŝǀĞdD ĨĞĂƚƵƌĞ͕LJŽƵŵĂLJŶĞĞĚƚŽƉůƵŐŝŶƚŚĞh^ĚĞǀŝĐĞ ďĞĨŽƌĞůŽĂĚŝŶŐƚŚĞĚŝƐĐ͘KƚŚĞƌǁŝƐĞ͕ƚŚĞĚŝƐĐŵĂLJ ŶŽƚƉůĂLJďĂĐŬ͘ -‐ TOSHIBA does not guarantee 100% ĐŽŵƉĂƟďŝůŝƚLJǁŝƚŚĂůůh^&ůĂƐŚĚĞǀŝĐĞƐ͘ Connect Power &RQQHFWWKH$&SRZHUFDEOHWR - the wall socket. 7KHSURGXFWLVUHDG\WREHVHWXSIRUXVH Notes: ʹĞĨŽƌĞĐŽŶŶĞĐƟŶŐƚŚĞƉŽǁĞƌĐŽƌĚ͕ĞŶƐƵƌĞ LJŽƵŚĂǀĞĐŽŵƉůĞƚĞĚĂůůŽƚŚĞƌĐŽŶŶĞĐƟŽŶƐ͘ – ZŝƐŬŽĨƉƌŽĚƵĐƚĚĂŵĂŐĞ͊ŶƐƵƌĞƚŚĂƚƚŚĞƉŽǁĞƌ ƐƵƉƉůLJǀŽůƚĂŐĞĐŽƌƌĞƐƉŽŶĚƐƚŽƚŚĞǀŽůƚĂŐĞƉƌŝŶƚĞĚ ŽŶƚŚĞďĂĐŬŽĨƚŚĞƵŶŝƚ͘ ʹdŚĞƚLJƉĞƉůĂƚĞŝƐůŽĐĂƚĞĚŽŶƚŚĞďĂĐŬŽĨƚŚĞƵŶŝƚ͘ 9 4 Preparation Setting up the player English Always follow the instructions in this chapter in sequence. Note: ͲhƐĞŽĨĐŽŶƚƌŽůƐŽƌĂĚũƵƐƚŵĞŶƚƐŽƌ ƉĞƌĨŽƌŵĂŶĐĞŽĨƉƌŽĐĞĚƵƌĞƐŽƚŚĞƌƚŚĂŶŚĞƌĞŝŶ ŵĂLJƌĞƐƵůƚŝŶŚĂnjĂƌĚŽƵƐƌĂĚŝĂƟŽŶĞdžƉŽƐƵƌĞŽƌ ŽƚŚĞƌƵŶƐĂĨĞŽƉĞƌĂƟŽŶ͘ Prepare the remote control Initial Setting :KHQ\RXWXUQRQWKLVXQLWIRUWKH¿UVWWLPH you need to follow these steps. 1. A welcome page will be displayed when this product is powered on. 3UHVV2.WRHQWHUODQJXDJHVHWWLQJ 3. Select your desired language, resolution and aspect ratio using S/T, then SUHVV2. 3UHVV6(783WRH[LWWKH6HWXSPHQX 1. Open the battery compartment. ,QVHUWRQH5EDWWHU\ZLWKFRUUHFW polarity (+/-) as indicated. 3. Close the battery compartment. Notes: Ͳ/ĨLJŽƵĂƌĞŶŽƚŐŽŝŶŐƚŽƵƐĞƚŚĞƌĞŵŽƚĞĐŽŶƚƌŽů ĨŽƌĂůŽŶŐƟŵĞ͕ƌĞŵŽǀĞƚŚĞďĂƩĞƌLJ͘ Ͳ ZŝƐŬ ŽĨ ĞdžƉůŽƐŝŽŶ͊ <ĞĞƉ ďĂƩĞƌLJ ĂǁĂLJ ĨƌŽŵ ŚĞĂƚ͕ƐƵŶƐŚŝŶĞŽƌĮƌĞ͘EĞǀĞƌĚŝƐĐĂƌĚďĂƩĞƌLJŝŶ ĮƌĞ͘ Use the SETUP menu 1. Press SETUP to display the Setup menu when the Blu-ray Disc70 Player is playing or no disc. And press SETUP WRH[LWWKH6HWXS menu. 7KHPD[LPXPRSHUDEOHUDQJHVIURP the unit are as follows. /LQHRIVLJKWDSSUR[P (LWKHUVLGHRIWKHFHQWUHDSSUR[P within 30° $ERYHDSSUR[PZLWKLQ %HORZDSSUR[PZLWKLQ 7m 10 Find the correct viewing input 1. Press to turn on this product. 2. Turn on the TV and switch to the correct video-in input (refer to the TV user manual on how to select the correct input). 10 m 7m dŝƉ͗ ͲtŚĞŶƉůĂLJŝŶŐŚŝŐŚͲĚĞĮŶŝƟŽŶƐŽƵƌĐĞƐ LJŽƵŵƵƐƚƉƌĞƐƐ STOP ďƵƩŽŶƚŽĞŶƚĞƌSETUP ŝŶƚĞƌĨĂĐĞ͘ Select menu display language 1. Press SETUP, [General Setting] menu is displayed. 2. Select [Language], then press X. 3. Select [OSD], then press X. - The language options may vary for different regions. 4. Press S/T to select a language, then press 2. Note: Ͳ/ĨƚŚŝƐĚŝƐĐƉůĂLJĞƌŝƐĐŽŶŶĞĐƚĞĚƚŽĂ,D/ ĐŽŵƉůŝĂŶƚds͕ƐŬŝƉƚŚŝƐƐĞƚƚŝŶŐ͘/ƚƐǁŝƚĐŚĞƐ ĂƵƚŽŵĂƚŝĐĂůůLJƚŽƚŚĞƐĂŵĞK^ŵĞŶƵůĂŶŐƵĂŐĞ ĂƐƉĞƌLJŽƵƌdsƐĞƚƚŝŶŐ͘ Playback Functions Basic Playback 1. Press button on the front panel or the remote control, your Blu-ray Disc™ player will turn on. The unit will take around 20 seconds to warm up. 2. Turn on the TV, and then select the input setting on the TV that matches the connection method you used to connect your player. 3UHVV23(1&/26(; to slide out the disc tray. 4. Place a disc on the disc tray with the label IDFLQJXSDQGWKHQSUHVV23(1&/26(; to slide back and close the disc tray. The disc loading time depends on the types of disc you are loading, and loading a Blu-ray Disc70 will take longer time. ,IWKHGLVFGRHVQRWVWDUWSOD\LQJ automatically, please press #9 to start playback. ,ID%OXUD\'LVF70 or DVD menu displays, XVHFXUVRUEXWWRQVWRVHOHFW3/$<7KHQ SUHVV2.WRFRQ¿UP 7RHMHFWWKHGLVFSUHVV23(1&/26(;. Pause playback 1. Press #9 to pause playback. The sound will be muted. 2. Press #9 to resume the playback. Stop playback 1. Press STOP button once to go to resume mode, the TV screen will show the resume logo. 2. Press STOP twice to stop the playback completely. 3. Press #9 to resume playback from the point where playback is stopped or from the beginning of the disc after the playback is completely stopped. 1RWDOO%OXUD\70 discs support the resume feature. Fast Forward and Fast Reverse VHTXHQFH ;;;;; 2. Press #9 to resume playback. 3. Press F.R N to fast reverse through the disc. The fast reverse speed changes based on how many times you pressed the button. The speed will increase through the IROORZLQJVHTXHQFH ;;;;; 4. Press #9 to resume playback. Instant Search and Instant Replay 1. During playback, press and hold .button, you can search 30 seconds forward. 2. During playback, press and hold N button, you can instant replay the content from 10 seconds before. 3UHYLRXVDQG1H[W During playback, press PREV button, and you can skip back to the previous chapter or track. Each press of this button will allow you to skip a chapter or track till the beginning of the disc. 3UHVVRI1(;7 button during playback ZLOODOORZ\RXWRVNLSWKHSOD\EDFNWRQH[W chapter or track. Slow Forward 1. Press # during normal playback. The slow forward speed is 1/16 in default. 2. To change slow forward speed, press # repeatedly, and the slow forward speed will be FKDQJHGLQWKHIROORZLQJVHTXHQFH 1/4, 1/2, normal. 7RH[LWVORZIRUZDUGPRGHDQGUHWXUQWR normal playback, press #9. Step Forward Use this feature to help you to enjoy the video frame by frame. 1. Press #9 during normal playback, then playback will change to pause state. 2. Press # repeatedly to advance the picture frame by frame. 3. Press #9 to resume normal playback. HDMI :KHQWKHUHLV¿OHRUGLVFEHLQJSOD\HGLWLV not allowed to switch resolution through WKH+'0,EXWWRQRIWKH5HPRWH&RQWURO 1. Press F.F . to fast forward through the disc. The fast forward speed changes based on how many times you pressed the button. The speed will increase through the following 11 English 5 Playback Advanced Playback English 12 DISPLAY Press this button and the screen will display VRPHLQIRUPDWLRQDERXWGLVFVXFKDV7LWOH number, Chapter number, Track number, (ODSVHG7LPH0RGH$XGLR$QJOHDQG Subtitle languages. Press this button again to turn off the information display. REPEAT Press REPEAT repeatedly to select different repeat modes. '9'5HSHDW&KDSWHU5HSHDW7LWOHDQG$OO 9&'3%&2II&'-3(*035HSHDW7UDFNDQG All. A-B To play certain section within the video or song, press A-B button to set the start point. Then, press A-B button again to set the end point and complete the setting. The selected section will be played repeatedly. Press A-B button the third time to cancel this function. The end point cannot be set until 5 seconds of playback has elapsed from the start point. SEARCH 'XULQJSOD\EDFNSUHVV6($5&+EXWWRQWR edit Title, Chapter, and Time. Press W/XDQG2.EXWWRQRQWKHUHPRWH control to select Title, Chapter, or Time. Then press the numeric buttons or S/T and then SUHVV2.7KHSOD\EDFNZLOOVNLS to the desired location. For Time Search, press S/T to select Title or Chapter time search. SUBTITLE Press this button repeatedly and the screen ZLOOGLVSOD\³;;;;;;´RU³2II´7KH³;´ indicates the current number of this ODQJXDJH³;;´LQGLFDWHVWKHWRWDOQXPEHURI ODQJXDJH³;;;´LQGLFDWHVWKHODQJXDJH The number of available languages depends on the disc. RETURN Press this button to return to the previous on-screen menu in setup menu such as ([WHUQDO0HPRU\,QIRUPDWLRQ3DUHQWDO Control, Country Code, etc. 'XULQJ03-3(*9,'(2SOD\EDFNSUHVV 5(7851RQFHLWZLOOUHWXUQEDFNWR0HGLD Center page. During VCD disc playback and PBC On is selected, press the button to return to PBC 0HQX ANGLE During playback, press this button to change the angle of the picture. The screen will GLVSOD\³$QJOH;;´7KH¿UVW³;´LQGLFDWHVWKH FXUUHQWQXPEHURIDQJOHDQGWKHVHFRQG³;´ indicates total number of angle. 1RWDOO%OXUD\70 or DVD has the multi-angle feature. The screen will take around 5 seconds to change. TOP MENU <RXPD\SUHVVWKLVEXWWRQDWDQ\WLPHDQG the Blu-ray Disc70 or DVD video disc playback will pop up the disc menu. POP MENU0(18 During Blu-ray Disc70 playback, press POP 0(180(18WRGLVSOD\WKHGLVFWLWOHDQGWKH playback will not be stopped even the menu is on the screen. 1. Press the S/T/W/X buttons to select an RSWLRQWKHQSUHVV2.WRFRQ¿UP 3UHVV3230(180(18WRFORVHWKH menu. 'XULQJ '9' SOD\EDFN SUHVV 323 0(18 0(18WRRSHQWKHGLVFPHQX 'XULQJ9&'SOD\EDFNSUHVV3230(180(18 to switch PBC On/Off. 'XULQJ GLVSOD\LQJ 86% DQG 'DWD 'LVF ¿OH FRQWHQW LQ PHGLD FHQWHU SUHVV 323 0(18 0(18 WR DGG WKH 3KRWR0XVLF9LGHR ¿OHV WR the playlist. 1.Press S/T/W/X buttons to select an RSWLRQXQGHUWKH3KRWR0XVLF9LGHR¿OHV ,QWKH¿OHEURZVHUSUHVVX to select the ¿OHVWREHDGGHGWRWKHSOD\OLVW¥ ZLOODSSHDUEHVLGHWKHVHOHFWHG¿OHV 3UHVV3230(180(18EXWWRQDSRSXS menu will appear, then press S/T DQG 2. button to select "Add to Playlist" to add the ¿OHVWRWKH3OD\OLVW6HOHFWDOODQG&OHDUDOO options are also available. Select "Cancel" to H[LWWKHSRSXSPHQX $OO WKH VHOHFWHG ¿OHV ZLOO EH DGGHG WR WKe 3OD\OLVW IROGHU <RX FDQ SOD\ RU GHOHWH WKH ¿OHVLQWKHSOD\OLVW 3UHVV3230(180(18WRGHOHWHWKH VHOHFWHG¿OHVLQ3OD\OLVW SETUP Press the SETUP button, and the screen will display some information about the player, VXFKDV General Setting Display Setting Audio Setting 6\VWHP,QIRUPDWLRQ PROGRAM During CD/DVD/VCD playback, you can press this button to edit the sequence of the playlist. BOOKMARK During VCD/DVD'LY;® disc playback, press WKH%22.0$5.EXWWRQWRDGGWKH ERRNPDUNSUHVVDQGKROGIRUDIHZ seconds to display the list of bookmark which you added before on the screen, WKHQ\RXFDQSUHVVWKH2.EXWWRQWRVHOHFW WKHERRNPDUNRU&/($5EXWWRQWRGHOHWH the bookmark. AUDIO 3UHVV$8',2EXWWRQRQWKHUHPRWHFRQWUROWR select the audio streams that set within the Blu-ray70 or DVD disc. 7KHVFUHHQZLOOGLVSOD\ $8',2;;;;;;;;;; ³;´TKH&XUUHQW$XGLR6WUHDP1XPEHU >6XEWLWOH6W\OH@:KHQ\RXSOD\WKH%OXUD\'LVF70 or '9'GLVFDQGLILWKDVH[WHUQDOVXEWLWOH\RXZLOOVHHLW in OSC menu >%LWUDWH@8VHS/Tto select your desired Bitrate. >6WLOO2II@&ORVHWKH6WLOOIHDWXUHRI'9'GLVF For some DVD discs, a certain video picture will be frozen as a still picture during the process of playback to let the user has a better view of certain picture. To continue playback, select Still Off. >,QVWDQW6HDUFK@,QVWDQWVHDUFKVHFRQGV forward. >,QVWDQW5HSOD\@5HSOD\WKHFRQWHQWIURPVHFRQGV before. dŝƉƐ͗ -‐ dŚĞƐƉĞĐŝĮĞĚŽƉĞƌĂƟŽŶĨŽƌĞĂĐŚŝƚĞŵǁŝůůǀĂƌLJǁŝƚŚ ĚŝƐĐƚLJƉĞƐ͘ŶĚƐŽŵĞŝƚĞŵƐĂƌĞĂǀĂŝůĂďůĞŽŶůLJǁŚĞŶ ƚŚĞĚŝƐĐŝƐƐƵƉƉŽƌƚĂďůĞ͘ ͲdŚĞŝǀyΠƐƵďƟƚůĞĮůĞŶĂŵĞ;͘ƐƵďͿŚĂƐƚŽďĞƐĂǀĞĚ ƵŶĚĞƌƚŚĞƐĂŵĞĮůĞŶĂŵĞĂƐƚŚĞŵŽǀŝĞ;͘ĂǀŝͿŝŶƚŚĞ ƐĂŵĞĨŽůĚĞƌ;Ğ͘Ő͘&ŽůĚĞƌ͗ĂďĐ͘ĂǀŝĂŶĚĂďĐ͘ƐƵďͿ͘ Blu-ray Disc70 BONUSVIEW70 Playing Secondary Video (Picture-in-Picture) and Secondary Audio is for Blu-ray Disc70 only. Secondary video can be played from a disc FRPSDWLEOHZLWKWKH3LFWXUHLQ3LFWXUH3,3IXQFWLRQ For the playback method, refer to the instructions for the disc. 7XUQRQVHFRQGDU\YLGHRE\SUHVVLQJWKH3,3 button. 2. Press the 3,3$8',2EXWWRQWRVHOHFWWKH VHFRQGDU\DXGLRDQGVHOHFWDQRSWLRQH[FHSW2II The secondary audio is opened, you can hear the disc secondary video sound. ,QRUGHUWRKHDUWKHVHFRQGDU\DXGLRWKH3,3 feature on the disc must be turned on. 3UHVVWKH3,3EXWWRQDJDLQWRWXUQRIIWKH secondary video. Primary video Secondary video with Secondary Audio This function is not available when the primary YLGHRLVSOD\HGLQ6HDUFK6ORZ0RWLRQRU)UDPH by-Frame or Fast Forward/ Reverse mode. To listen to the secondary audio, the digital audio output must be set to "Bitstream", "Re-encode" or 3&02WKHUZLVHRQO\WKHprimary audio can be heard. Notes: ͲEŽƚĂůůƚŚĞůƵͲƌĂLJΡĚŝƐĐƐĐĂŶƐƵƉƉŽƌƚƚŚŝƐ ĨƵŶĐƟŽŶ͘ Ͳ,ŝŐŚĞĮŶŝƟŽŶW/W;^ĞĐŽŶĚsŝĚĞŽͿŝƐŶŽƚƐƵƉƉŽƌƚĞĚ͘ 13 English ³;;´7KHWRWDOQXPEHURI$XGLR6WUHDP ³;;;´$XGLR/DQJXDJH ³;;;;´$XGLR7HFKQRORJ\ MC 3UHVVWKLVEXWWRQWRSOD\PHGLD¿OHVLQWKH86% ZOOM 3UHVV=220EXWWRQUHSHDWHGO\WR=RRPLQRXW playback in the video. =RRPPRGH=RRP[!=RRP[!=RRP [!=RRP!=RRP!=RRP DIGEST During playback of -3(*GLVFSUHVV',*(67 to view a page of 12 thumbnail images. - Use S/T/W/X to select an image. 3UHVV2.WRYLHZWKHVHOHFWHGLPDJHLQIXOO screen and subsequent images will be displayed one after another automatically. - Press PREV 1(;7 to view the SUHYLRXVRUQH[WWKXPEQDLOVFUHHQ PIP AUDIO 3UHVV3,3$8',2EXWWRQWRRSHQWKH VHFRQGDU\DXGLRRIVHFRQGDU\YLGHR3,3¶V sub-window video). OSC Press OSC to open On Screen Control menu GXULQJSOD\EDFN,QWKLVPHQX\RXFDQPDNH some playback-related control. The on screen control contains following LWHPV >7LWOH@7KHWLWOHLQFXUUHQWSOD\EDFNWLWOHVLQ total. Select your desired title to playback. >&KDSWHU@7KHFKDSWHULQFXUUHQWSOD\EDFN chapters in total. Select your desired chapter to playback. >7LPH@9LHZWKHHODSVHGUHPDLQLQJSOD\EDFN time of title/chapter. Use S/T WRYLHZWKH elapsed playback time of title, the remaining playback time of title, the elapsed playback time of chapter, and the remaining playback time of chapter. >0RGH@6HOHFWSOD\EDFNPRGHDPRQJ VKXIÀHUDQGRPDQGQRUPDO >$XGLR@7KH%OXUD\'LVF70'9'GLVF¶V soundtrack language. Use S/T to view the audio available in the disc and select your desired Audio type. >$QJOH@7KHDQJOHYLHZRIFXUUHQWSOD\EDFN the angles in total. Please reference Playback > Angle to see more detailed info. Use S/T to select your desired angle view. >6XEWLWOH@7KH6XEWLWOHLQFXUUHQWSOD\EDFN Use S/T to view the subtitles available in the disc and select your desired subtitle type or turn it off. Note: Ͳ/ŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞĚŝīĞƌĞŶƚĚŝƐĐƐ͕ƚŚĞƌĞ ǁŽƵůĚďĞĚŝīĞƌĞŶƚƐƵďƟƚůĞƐ͘^ƵĐŚĂƐ ĞŶƚƌĂůƵƌŽƉĞ LJƌŝůůŝĐ >ĂƟŶ/ 'ƌĞĞŬ dƵƌŬŝƐŚ ,ĞďƌĞǁ 6 Customizing English This section describes the various setting option of this Blu-ray Disc70 player. ,IWKHVHWXSRSWLRQLVJUH\HGRXWLWPHDQV the setting cannot be changed at the current state. General Setting 1. Press SETUP button on the remote FRQWURO7KH6HWXS0HQXDSSHDUV General Setting System Screen Saver On Language Disc Auto Playback On Playback CEC On Security Load Default More... Network Upgrade More... Move cursor key to select menu option then use “OK” key to select SETUP Exit 2. Press T to select an option, then press X to access. 3. Press S/T to select a setup option and press X 4. Select the setting you wish to change DQGSUHVV2.WRFRQ¿UP - Press W to return to the previous menu. [System] To change the following system option to personalize your Blu-ray Disc70 player r [Screen Saver] Turn On or Off the screen saver mode. ,WKHOSVWRSURWHFWWKH79VFUHHQ { On } – Set the screen saver active DIWHUDSSUR[LPDWHO\PLQXWHVZLWKQR RSHUDWLRQ<RXFDQWXUQRIIWKHVFUHHQ saver by pressing the SETUP button. - The Blu-ray Disc70 Player will switch to standby mode if there is no operation after the screen saver is engaged for DSSUR[LPDWHO\PLQXWHV { Off } – Turn off the screen saver mode. r [Disc Auto Playback] Turn On or Off the disc automatic playback switching mode. {On} – The disc playback automatically after loading. {Off} – Turn off disc auto playback mode. r [CEC] 7KLVSOD\HUVXSSRUWV5(*=$/,1.ZKLFK XVHVWKH+'0,&(&&RQVXPHU 14 (OHFWURQLFV&RQWUROSURWRFRO<RXFDQ use one single remote control to control DOO5(*=$/,1.FRPSOLDQWGHYLFHVWKDW DUHFRQQHFWHGWKURXJK+'0, connectors. {On`7XUQVRQ5(*=$/,1.IHDWXUHV :LWK&(&RQGXULQJ79VWDQGE\ZLWK the Blu-ray Disc70 Player on, pressing 6(7833/$<3$86(ZLOOSRZHURQWKH 79:KHQ\RXWXUQWKH79RIIWKLVXQLW will automatically turn off. {Off`'LVDEOHV5(*=$/,1.IHDWXUHV r [Load Default] Reset all settings of Blu-ray Disc70 Player to initial default state. - Follow the instruction on the TV screen WRFRQ¿UPWKHGHIDXOWVHWWLQJRSHUDWLRQ 1. Select Load Default. $GLDORJXHER[SRSVXSVKRZQDV EHORZ6HOHFW2. Load Default Do you want to load default? Cancel OK ,WPD\WDNHDZKLOHZKHQORDGLQJ default is in progress. Please wait... Load Default Loading default, please wait... 30% 79ZLOOGLVSOD\DVIROORZ Welcome to the Toshiba Blu-ray Disc Player Setting Wizard. Some simple settings are suggested before you begin. You can also access detailed settings from the Setup Menu. OK Next 3UHVV2.HQWHUODQJXDJHVHWWLQJ PressS/T to select a language option. Choose an OSD language before starting. The language selected will be applied not only here but also in other OSD windows, menus etc. English Français Deutsch Italiano Español Português Previous OK Next Auto Choose a resolution that fits your TV. 480i/576i Change will be applied immediately, you have 15s to determine whether to save the setting or rollback to prior resolution. Better performance will be provided by an HDMI connection! 480p/576p 720p 1080i 1080p Previous OK Next Press S/T WRVHOHFWDQRSWLRQ3UHVV2. 6HOHFW<HVRU1RXVLQJS/T. Resolution has been changed! 14s Yes Does everything looks all right with this resolution? Press Yes if you want to apply it. Press No to rollback to previous one. Previous No OK Next 3UHVV2.HQWHU$VSHFWUDWLRVHWWLQJ Choose an aspect ratio that fits your TV. The change will be applied in the next page. Determine whether to save the setting or rollback to the previous aspect ratio. Previous 16:9 Full 16:9 Normal 4:3 Pan&Scan 4:3 Letterbox OK Next Press S/T WRVHOHFWDQRSWLRQ3UHVV2. Setting Notes: Ͳ/ĨƐĞƚŝƐĐƵƚŽWůĂLJďĂĐŬƚŽKī͕ĂŌĞƌLJŽƵ ŝŶƐĞƌƚƚŚĞĚŝƐĐƚŚĂƚĐŽŶƚĂŝŶƐƚŚĞƵƉŐƌĂĚĞĚ ŝŶĨŽƌŵĂƟŽŶƚŽƵƉŐƌĂĚĞƐLJƐƚĞŵ͕LJŽƵŚĂǀĞƚŽƐƚĂƌƚ ƵƉŐƌĂĚĞĨƌŽŵƚŚŝƐŽƉƟŽŶŽĨ^dhWDĞŶƵ͘ Ͳ/ĨƚŚĞƵƉŐƌĂĚĞĮůĞƉĂĐŬĂŐĞĚŝĚŶŽƚƉĂƐƐƚŚĞ ǀĞƌŝĮĐĂƟŽŶ͕ĞƌƌŽƌƉƌŽŵƉƚŝƐĚŝƐƉůĂLJĞĚ͕ĐŚĞĐŬƚŚĞ ƉĂĐŬĂŐĞĂŐĂŝŶ;ƐƵĐŚĂƐƚŚĞƉĂĐŬĂŐĞŝƐŶŽƚ ĐŽŵƉůĞƚĞͿ ͲDĂŬĞƐƵƌĞƚŚĞĮƌŵǁĂƌĞǀĞƌƐŝŽŶŝƐŶŽƚĂŶŽůĚ ǀĞƌƐŝŽŶ͘ ͲtŚĞŶLJŽƵƵƉŐƌĂĚĞƚŚĞƐLJƐƚĞŵƵƐŝŶŐh^&ůĂƐŚ ĚĞǀŝĐĞ͕LJŽƵƐŚŽƵůĚŵĂŬĞĂŶĞǁĨŽůĚĞƌŶĂŵĞĚ hW'ͺ>>͕ĂŶĚĐŽƉLJƚŚĞƵƉŐƌĂĚĞĮůĞŝŶƚŽƚŚŝƐ ĨŽůĚĞƌ͘ SW upgrade by Network introduction There are two modes to upgrade via LQWHUQHW$XWRPDWLF0RGHDQG,QWHUDFWLYH 0RGH $XWRPDWLF0RGH The player will check the internet whether it is connected automatically when powered on. ,IFRQQHFWHGSOD\HUZLOOWU\WRFRQQHFWWKH Toshiba server to check if there is new ¿UPZDUHIRUWKHSOD\HU ,I\HVWKHSOD\HUZLOOSRSXSDPHVVDJHRQ the screen to inform you that an upgrading ¿UPZDUHLVDYDLODEOHRQWKHLQWHUQHW<RXFDQ choose whether to upgrade or not. Upgrade wizard is complete! Now press the OK button to finish and return to the Setup Menu. Previous New software found! Upgrade? OK Finish 3UHVV2.WRUHWXUQWR>*HQHUDO6HWWLQJ@ 0HQX r [Upgrade] For software upgrades to enhance performance, you could select the following upgrade method and start to upgrade. {Disc}/{USB Storage}/{Network} 6:XSJUDGHE\'LVF86%6WRUDJH Upgrade the software from the disc or USB Flash device. ,QVHUWWKHGLVFRUFRQQHFWWKH86%)ODVK GHYLFHZKLFKFRQWDLQVWKHXSJUDGH¿OH package. 2. Follow the instruction on the TV VFUHHQWRFRQ¿UPXSJUDGHRSHUDWLRQ - The system will reboot after 5 seconds or 2.NH\LVSUHVVHG Cancel OK Start ,QWHUDFWLYH0RGH: <RXFDQDOVRGRQHWZRUNXSJUDGHYLDVHWXS menu. <RXVKRXOGPDNHVXUHWKDWWKHSOD\HULV FRQQHFWHGWRWKHLQWHUQHW¿UVW Press "SETUP" button of the remote control, WKHQFKRRVH6\VWHP!8SJUDGH! 1HWZRUNDQGSUHVV2.EXWWRQ7KHQWKH player will connect the Toshiba server to FKHFNLIWKHUHLVQHZ¿UPZDUHIRUWKHSOD\HU Upgrade Connecting to the server. Please wait! ,I\HVWKHSOD\HUZLOOSRSXSDPHVVDJHRQ the screen and you can choose whether to 15 English 3UHVV2.HQWHU5HVROXWLRQVHWWLQJ upgrade or not. Upgrade English New software found! Upgrade? Cancel Start OK ,IQRWKHSOD\HUZLOOSRSXSDPHVVDJHRQ the screen to inform you that there is no new ¿UPZDUHIRUWKHSOD\HU Upgrade Current version is latest. Update is not available. 3UHVV2.WRVHOHFW(UDVHWKHGDWDLQ the BUDA folder will be cleared. [Language] 6HWXSWKH26'2Q6FUHHQ'LVSOD\0HQX Audio and Subtitle default language for the player. General Setting System OSD English Language Menu English Playback Audio English Security Subtitle English Network Move cursor key to select menu option then use “OK ” key to select SETUP Exit r[OSD] Cancel ZĞŵĂƌŬ͗ /ĨLJŽƵĐŚŽŽƐĞƚŽƵƉŐƌĂĚĞƚŚĞŶĞǁ&t͕ ϭ͘dŚĞƉůĂLJĞƌǁŝůůďĞŐŝŶƚŽĚŽǁŶůŽĂĚƚŚĞ ƵƉŐƌĂĚĞĨŝůĞĂŶĚƉŽƉƵƉĂŵĞƐƐĂŐĞƚŽƐŚŽǁ ƚŚĞƉƌŽŐƌĞƐƐ͘ Upgrade Downloading upgrade file.Please wait! Select the default on-screen display language. r [Menu] Select the default menu language. r[Audio] Select the default audio language. r[Subtitle] Select the default subtitle language. [Playback] General Setting Cancel Ϯ͘tŚĞŶĚŽǁŶůŽĂĚŝƐĨŝŶŝƐŚĞĚ͕ƚŚĞƉůĂLJĞƌǁŝůů ƉŽƉƵƉĂŵĞƐƐĂŐĞĨŽƌLJŽƵ͕ĂŶĚLJŽƵĐĂŶĐŚŽŽƐĞ ǁŚĞƚŚĞƌƚŽƉƌŽĐĞĞĚǁŝƚŚƚŚĞƵƉŐƌĂĚŝŶŐŽƌŶŽƚ͘ /ĨLJŽƵĐŚŽŽƐĞƚŽƵƉŐƌĂĚĞ͕ƚŚĞƉůĂLJĞƌǁŝůůďĞŐŝŶ ƚŽƵƉŐƌĂĚĞ͕ĂŶĚƉŽƉƵƉĂŵĞƐƐĂŐĞƚŽƐŚŽǁƚŚĞ ƉƌŽŐƌĞƐƐ͘tŚĞŶƵƉŐƌĂĚĞŝƐĚŽŶĞ͕ƚŚĞƉůĂLJĞƌ ǁŝůůƌĞƐƚĂƌƚ͘ $WWHQWLRQ'R127FXWRIIWKHSRZHUVXSSO\ ZKHQ WKH ILUPZDUH LV XSJUDGLQJ 2U WKH player might become unworkable. r >([WHUQDO0HPRU\@ ([WHUQDO 0HPRU\ ZRXOG EH XVHG LQ %' /LYH70 IXQFWLRQ :KHQ \RX SOXJ LQ WKH 86%ÀDVKGHYLFHZKLFKKDVDWOHDVW*% IUHH VSDFH WR SOD\ %'/LYH70 function, the Blu-ray Disc70 system would make a directory named BUDA automatically. ,QIRUPDWLRQZLOOGLVSOD\WKH)UHHVL]H 3UHVV2. 2. Follow the instruction on the TV VFUHHQWRVHOHFW^,QIRUPDWLRQ` General Setting Screen Save Information Disc Auto Playback Off Language Playback CEC On Security Disc Auto Upgrade On Network Load Default More... Erase System Free size is : 0MB Move cursor key to select menu option then use “OK ” key to select 16 On RETURN Return System Angle Mark On Language PIP Mark On Playback Secondary Audio... On Security Last Memory On Network PBC On Move cursor key to select menu option then use “OK ” key to select r [Angle Mark] SETUP Exit Some Blu-ray70 discs/DVDs contain the scenes recorded with multiple angles, which allow you to enjoy the videos with your desired angles, therefore the angle mark is displayed only when the Blu-ray Disc™/DVD disc is supportable for multiDQJOHDQG$QJOH0DUNLVVHWWR21 {On} – Display the angle mark. {Off`±+LGHWKHDQJOHPDUN r [PIP Mark] 7KH3LFWXUH,Q3LFWXUH3,3PRGHGLVSOD\ two pictures on the TV screen at the same WLPHWKHIXOOVFUHHQSLFWXUHLVFDOOHG0DLQ :LQGRZDQGWKHVPDOOLQVHWZLQGRZLV FDOOHG6XE:LQGRZ7KH3,3PDUNLV GLVSOD\HGZKHQLQ3,3PRGHDQG3,30DUN LVVHWWR21 {On`±'LVSOD\WKH3,3PDUN {Off`±+LGHWKH3,3PDUN Note: Ͳ,ŝŐŚĞĮŶŝƟŽŶW/W;^ĞĐŽŶĚsŝĚĞŽͿŝƐŶŽƚƐƵƉƉŽƌƚĞĚ͘ r [Secondary Audio Mark] {On`±'LVSOD\6HFRQGDU\$XGLR0DUN ,I\RXRSHQWKHGLVFWUD\RUVZLWFKWKLV Blu-ray Disc™ player to standby state during normal playback, the Blu-ray Disc™ player can memorize the end playing point, the player will start playback from WKHPHPRUL]HGSRLQWQH[WWLPH {On`±$FWLYH/DVW0HPRU\IHDWXUH {Off`±'LVDEOH/DVW0HPRU\IHDWXUH Note: ͲEŽƚĂůůƚŚĞůƵͲƌĂLJdDĚŝƐĐƐĐĂŶƐƵƉƉŽƌƚƚŚŝƐ ĨƵŶĐƟŽŶ͘ r [PBC] VCD2.0 has PBC control (Playback Control) menu, which allow you to interact with the system via menu. {On} – Display playback control menu, use 180%(5NH\VWRVHOHFWGHVLUHGRSWLRQ {Off`±+LGHSOD\EDFNFRQWUROPHQXDQG start playback from track1 automatically. r [Closed Caption] Allow people who are deaf or hearing impaired, to have access to television programming by displaying the audio SRUWLRQ RI D WHOHYLVLRQ SURJUDPPH DV WH[W on the screen. {On} – Display the Closed Caption . {Off`±+LGHWKH&ORVHG&DSWLRQ r [DivX(R) VOD DRM] 7KH'LY;592''50PHDQV'LY;59LGHR RQ'HPDQG'LJLWDO5LJKW0DQDJHPHQW 'LY;® is the name of a revolutionary new video codec which is based on the new 03(*FRPSUHVVLRQVWDQGDUGIRUYLGHR <RX ZLOO EH DEOH WR SOD\ 'LY;® movies using this player. <RXFDQRQO\SOD\'LY;® videos that ZHUHUHQWHGRUSXUFKDVHGZLWKWKH'LY;® registration code of this product. 6HOHFWWKH'LY;592''50RSWLRQ\RX FDQ¿QGWKLVSURGXFW VUHJLVWUDWLRQFRGH To learn more please visit KWWSZZZGLY[FRPYRG [Security] r [Change password] Follow the instruction on the TV set or change the password for locked discs and play restricted DVDs. General Setting System Language Playback Security Network Change Password Language Country Code Playback Parental Control Move cursor key to select menu option then use “OK ” key to select On Load Default More... RETURN Return General Setting System Language Playback Security Network Screen Save Off Change Password Disc Auto Playback On CEC On New password : Disc Auto Upgrade Confirm password : Load Default Move cursor key to select menu option then use “OK ” key to select On More... RETURN Return (QWHUWKHQHZSDVVZRUGDJDLQWRFRQ¿UP r [Country Code] This ensures that you will be able to see the scenes intended for your current residential Country/Area. 8VH180%(5.H\VWRHQWHU\RXU password, then you can choose your Country/Area. r [Parental Control] Restricts access to discs that are unsuitable for children. These discs must be recorded with rating. 3UHVV2. 8VH180%(5NH\VWRHQWHUWKH password General Setting System Language Playback Screen Save Off Parental Control Disc Auto Playback On Enter CECpassword: On Security Disc Auto Upgrade On Network Load Default More... Move cursor key to select menu option then use “OK ” key to select RETURN Return 6HOHFWDUDWLQJOHYHOWKHQSUHVV2. General Setting System Language Playback More... More... Off Network On Disc Auto Upgrade 8VH180%(5NH\VWRHQWHUIRXUGLJLW old password. The default password is "0000". 2. Enter the new password. More... Security CEC Please enter current password: Move cursor key to select menu option then use “OK ” key to select General Setting System Screen Save Off Change Password Disc Auto Playback On Screen Save Off Parental Control Disc Auto Playback On Select level: CEC Off On [1] KID SAFE Security [2] G Disc Auto Upgrade On Network Load Default More... RETURN Return SETUP Exit 17 English {Off`±+LGHWKH6HFRQGDU\$XGLR0DUN r [Last Memory] Items Description English KID SAFE Safe for kids G All children and general guidance PG Parental guidance PG-13 Parental guidance for children under 13 PGR Parental guidance Recommended R Restricted viewing NC-17 No one 17 and under allowed ADULT Adult only Notes: ͲZĂƚĞĚĚŝƐĐƐĂďŽǀĞƚŚĞůĞǀĞůLJŽƵƐĞƚŝŶWĂƌĞŶƚĂů ŽŶƚƌŽůƌĞƋƵŝƌĞĂƉĂƐƐǁŽƌĚƚŽďĞĞŶƚĞƌĞĚ͘ Ͳ dŚĞ ƌĂƟŶŐƐ ĂƌĞ ĐŽƵŶƚƌLJ ĚĞƉĞŶĚĞŶƚ͘ dŽ ĂůůŽǁ ĂůůĚŝƐĐƐƚŽƉůĂLJ͕ƐĞůĞĐƚΖKīΖ͘ [Network] General Setting System IP Setting Language Connection Test Playback BD-Live Connecti Security Information Network Move cursor key to select menu option then use “OK ” key to select SETUP Exit 7RHQMR\%'/LYHERQXVFRQWHQWVVHW up the network connection. Note: ͲŶƐƵƌĞƚŚĂƚƚŚĞŶĞƚǁŽƌŬĐĂďůĞŝƐƉƌŽƉĞƌůLJ ĐŽŶŶĞĐƚĞĚĂŶĚƚŚĞƌŽƵƚĞƌŝƐƐǁŝƚĐŚĞĚŽŶ͘ 1. Connect the Blu-ray Disc™ player to the broadband modem or router. ,QWKH6HWXSPHQXVHOHFW>1HWZRUN@ then press X. 6HOHFW>,36HWWLQJ@LQWKHPHQXWKHQ SUHVV2.WRVHOHFW>$XWR@$Q,3DGGUHVV is obtained automatically. ,IQR,3DGGUHVVLVREWDLQHGVHOHFW >0DQXDO@WRLQSXW,3$GGUHVV6XEQHW 0DVN'HIDXOW*DWHZD\'16'16 DQGSUHVV2.WRUHFRQQHFWDJDLQWRWKH QHWZRUN,WZLOOWU\WRREWDLQWKH,3 address again. 3UHVV5(7851RUSUHVV2.WRH[LW Notes: Ͳ ƵƌŝŶŐ DĂŶƵĂů ŵŽĚĞ͕ ŝĨ ƚŚĞ ŶƵŵďĞƌ ŝƐ ĞŶƚĞƌĞĚ ŝŶĐŽƌƌĞĐƚůLJ͕ƉƌĞƐƐdƚŽĞƌĂƐĞƚŚĞŶƵŵďĞƌ͘ ͲĐŽŶƚƌĂĐƚǁŝƚŚƚŚĞƉƌŽǀŝĚĞƌŝƐŶĞĞĚĞĚƚŽĐŽŶŶĞĐƚƚŽ ƚŚĞ/ŶƚĞƌŶĞƚ͘ ͲdŚŝƐƉůĂLJĞƌĚŽĞƐŶŽƚƐƵƉƉŽƌƚĂƵƚŽŵĂƟĐĚĞƚĞĐƟŽŶŽĨ ĐƌŽƐƐͲĐĂďůĞƐ͘hƐĞƚŚĞƐƚƌĂŝŐŚƚ;ƐƚĂŶĚĂƌĚͿ>EĐĂďůĞ͘ Ͳ >ŽĂĚŝŶŐ Ͳ>ŝǀĞΡ ĐŽŶƚĞŶƚ ĨƌŽŵ ƚŚĞ ŝŶƚĞƌŶĞƚ ŵĂLJ ƚĂŬĞƐŽŵĞƟŵĞ͕ĚĞƉĞŶĚŝŶŐŽŶƚŚĞĮůĞƐŝnjĞĂŶĚƚŚĞ ƐƉĞĞĚŽĨƚŚĞŝŶƚĞƌŶĞƚĐŽŶŶĞĐƟŽŶ͘ 18 r [IP Setting] {Auto} – Auto obtain network information. {Manual}±0DQXDOVHWXSQHWZRUN information. r [Connection Test] 'LVSOD\1HWZRUNFRQQHFWLRQVWDWXV information. r [BD-Live Connection] {Permitted} – During playback of %'/LYHGLVFWKHGLVFPD\ automatically download all information from appointed network. {Partial Permitted} – During SOD\EDFNRI%'/LYHGLVFWKHGLVFPD\ automatically download partial of the information from appointed network. {Prohibited} – Disable downloading information from network. r [Information] 'LVSOD\DOO1HWZRUN,QIRUPDWLRQ Display Setting 1. Press SETUP, [General Setting] menu is displayed. 2. Press X to select [Display Setting], then press T. 3. Select an option, press X to access. Display Setting TV TV Screen Video Process Resolution Auto Color Space YCbCr422 16:9 Full HDMI Deep Color Off HDMI 1080/24p On Move cursor key to select menu option then use “OK ” key to select SETUP Exit 4. Press S/T to select a setup option and press X 5. Select the setting you wish to change DQGSUHVV2.WRFRQ¿UP - Press W to return to the previous menu. - Press 6(783WRH[LWWKHPHQX [TV] r [TV Screen] Select the screen format according to how you want the picture to appear on the TV. {16:9 Full} – For a disc with the aspect UDWLRRIWKHRXWSXWYLGHRLV VWUHWFKHGLQWRIXOOVFUHHQ {16:9 Normal} – For a disc with the DVSHFWUDWLRRIWKHRXWSXWYLGHRLV resized vertically to match what will be seen on the display. {4:3 Pan&Scan} – For standard TV, it r [HDMI Deep Color] This feature is available only when the GLVSOD\GHYLFHLVFRQQHFWHGE\D+'0, cable, and when it supports Deep Colour feature. {30 bits} – Output 30 bits Colour. {36 bits} – Output 36 bits Colour. {Off} – Output standard 24 bits Colour. Note: ͲtŚĞŶƚŚĞĐŽůŽƵƌƐƉĂĐĞŝƐΗzďƌϰϮϮΗ͕ĞǀĞŶŝĨ ,D/ĞĞƉŽůŽƌŝƐƐĞƚƚŽϯϬďŝƚƐͬϯϲďŝƚƐ͕ŝƚŝƐŶŽƚ ŽƵƚƉƵƚǁŝƚŚĞĞƉŽůŽƵƌ͘ r [HDMI 1080 24p] {On} – Enable 1080/24p video resolution setting. {Off} – Disable 1080/24p video resolution setting. Notes about HDMI 1080/24p: ,I\RXZDQWWKH+]RXWSXWLWVKRXOGIXO¿OOEHORZ 3 conditions: 1.TV supports the 24Hz display; 2.Player choose the 24Hz option in the setup menu; 3.Media must be the 24Hz video. ƚŚĞƉůĂLJŝŶŐůƵͲƌĂLJŝƐĐΡĐŽŶƚĞŶƚƐĂƌĞ&ŝůŵ ƐŽƵƌĐĞ͘ ͲƵƌŝŶŐ,D/ϭϬϴϬͬϮϰƉƉůĂLJďĂĐŬ͕ƚŚĞƌĞǁŝůů ďĞŶŽĐŽŵƉŽƐŝƚĞŽƵƚƉƵƚ͘ [Video Process] Display Setting TV Video Adjust More... Video Process Sharpness Low Move cursor key to select menu option then use “OK ” key to select SETUP Exit r [Video Adjust] 6HOHFWDSUHGH¿QHGVHWWLQJRIWKHYLGHR 3UHVV2. 2. PressW/X to adjust the video %ULJKWQHVV&RQWUDVW+XHDQG Saturation. {Brightness} - Press W/X to adjust the brightness of display, goes left means dark and right means bright. {Contrast} - Press W/X to adjust the contrast of display, goes left means low contrast and right means high contrast. {Hue} - Press W/XWRDGMXVWWKH+XH of display, goes left means low hue and right means high hue. {Saturation} - Press W/X to adjust the saturation of display, goes left means low Saturation and right means high saturation. 3UHVV5(7851WRH[LW Brightness Contrast Hue Saturation Change RETURN Exit r [Sharpness] 6HOHFWWKHOHYHORIVKDUSQHVV+LJK 0LGGOH/RZ {High`6HOHFW+LJKVKDUSQHVVOHYHO {Middle`6HOHFW0LGGOHVKDUSQHVV level. {Low`6HOHFW/RZVKDUSQHVVOHYHO Notes: ͲdŚŝƐƌĞƐŽůƵƟŽŶďĞĐŽŵĞƐĞīĞĐƟǀĞŽŶůLJǁŚĞŶ 19 English displays a wide picture on the entire screen and cuts off the redundant portions. {/HWWHUER[} – For standard TV, it displays a wide picture with two black ERUGHUVRQWKHWRSDQGERWWRPRI screen. r [Resolution] Select a video output resolution that is compatible with your TV display capability. {Auto} – Select the most suitable resolution according to the TV . {LL}, {SS}, {720p}, {1080i}, {1080p} – Select a video resolution setting that is best supported by the TV See TV manual for details. r [Color Space] 6HOHFWDSUHGH¿QHG&RORXUVSDFHRI picture. {RGB} – Select RGB Colour space. {YCbCr`±6HOHFW<&E&U&RORXUVSDFH {YCbCr422`±6HOHFW<&E&U&RORXU space. {Full RGB} – Select Full RGB Colour space. Audio Setting English 1. Press SETUP, [General Setting] menu is displayed. 2. Press X to select [Audio Setting], then press T . 3. Select an option, press X to access. Audio Setting Audio Output Spdif PCM HDMI PCM Down_samp 48K Dolby DRC Auto Move cursor key to select menu option then use “OK ” key to select 20 SETUP Exit 4. Press S/T to select a setup option and press X 5. Select the setting you wish to change DQGSUHVV2.WRFRQ¿UP - Press W to return to the previous menu. - Press 6(783WRH[LWWKHPHQX [Audio Output] r [Spdif] 6HOHFWWKHRXWSXWPRGHRI&2$;,$/ MDFNRSWLRQVLQFOXGH%LWVWUHDP3&0 Re-encode and Off. {Bitstream} – Output digital signal without any processing. {PCM} – Output digital signal with SURFHVVLQJRQO\WZRFKDQQHOVH[SRUW {Re-encode} – Auto select signal type IURP&2$;,$/MDFNDFFRUGLQJWRWKH Audio stream on disc. {Off`±1RRXWSXWIRU63',) r [HDMI] 6HOHFWWKHRXWSXWPRGHRI+'0,2XW MDFNRSWLRQVLQFOXGH%LWVWUHDP3&0 Re-encode and Off. {Bitstream`±2XWSXW+'0,GLJLWDO signal without any processing. {PCM`±2XWSXW+'0,GLJLWDOVLJQDO with processing, only two channels H[SRUW {Re-encode} – Auto select signal type IURP+'0,2XWMDFNDFFRUGLQJWRWKH Audio stream on disc. {Off`±1RRXWSXWIRU+'0, r [Down_samp] Select the digital audio signal sampling frequency. {48K} – For discs recorded at sampling UDWHRIN+] {96K} – For discs recorded at sampling UDWHRIN+] {192K} – For discs recorded at sampling UDWHRIN+] r [Dolby DRC] Select the Dynamic Range Control mode which makes it available to listen to a movie at a low volume without losing sound clarity. {Off`±1RQG\QDPLFUDQJHFRPSUHVV {On} – Dynamic range compress. {Auto} – Adjust the DRC according to input audio. The setting of Auto is effective for Dolby 7UXH+' System Information 1. Press SETUP, [General Setting] menu is displayed. 2. Press X to select [System Information]. 7KHFXUUHQWVRIWZDUHYHUVLRQDQG0$& address will be displayed. - Press W to return to the previous menu. - Press 6(783WRH[LWWKHPHQX System Information Software version: V XX MAC: E8-9D-87-XX-XX-XX Move cursor key to select menu option then use “OK ” key to select SETUP Exit Playable media 7KLVSURGXFWFDQSOD\ %OXUD\'LVF9LGHR%'55(%'$9 '9''9'9LGHR'9'55: '9'55:'9'55'/'XDO/D\HU 9LGHR&'69&' $XGLR&'&'5&'5: $9&+' 86%ÀDVKGHYLFH ŽŵƉĂƟďůĞĮůĞĨŽƌŵĂƚƐ Video 6LJQDOV\VWHP3$/176& +'0,2XWSXWLLSS 720p, 1080i, 1080p, 1080/24p. JPEG 6XSSRUWHG¿OHH[WHQVLRQ MSJ RUµMSHJ -3(*,62IRUPDW 'RHVQRWVXSSRUW3LFWXUH&' Audio 'LJLWDORXWSXW&RD[LDO 0.5 Vp-p (75 ohm) +'0,RXWSXW DivX® 6XSSRUWHG¿OHH[WHQVLRQ ',9; 'LY;+' LAN r /$1WHUPLQDO%$6(7%$6(7; USB 86%86%)XOOVSHHG86% +LJKVSHHG 6XSSRUWLQJUDQJH)ODVKGLVNFDUG UHDGHUSRUWV86%+8%86%0DVV Storage Class Device. 6XSSRUWHG¿OHV\VWHP)$7 0D[LPXPVL]HVXSSRUWHG*% 'RHVQRWVXSSRUWXQSRZHUHG+'' Main Unit 3RZHUVXSSO\UDWLQJ 99+] 3RZHUFRQVXPSWLRQ: 3RZHUFRQVXPSWLRQLQVWDQGE\PRGH : 'LPHQVLRQVZ[K[G 360 × 38.5 × 205 (mm) 1HW:HLJKWNJ 2SHUDWLQJWHPSHUDWXUH&WR& 2SHUDWLQJKXPLGLW\/HVVWKDQ (no condensation) MP3 tracks 6XSSRUWHG¿OHH[WHQVLRQ PS 6XSSRUWHGDXGLRFRGHF03 ,62IRUPDW 6XSSRUWHGFRUUHVSRQGLQJELWUDWHNESV 320 kbps 6XSSRUWHGVDPSOLQJIUHTXHQFLHVN+] N+]N+] MKV 6XSSRUWHG¿OHH[WHQVLRQV 0.9 6XSSRUWHGYLGHRFRGHFV+03+3 'LY;03(*63$6303(*03(* 6XSSRUWHGDXGLRFRGHFV$$&FK FK03$&'76/3&0 6XSSRUWHGVXEWLWOHV7H[W87)66$ 60,68%657$66 3OD\EDFNRI0.9¿OHVLQ&'55:PD\ not be compatible 6RPH0.9IRUPDWGLVFVPD\QRWSOD\ depending on the video resolution and frame rate condition Other formats 03 PS PRY $9, DYL 03(* PSJ PSHJ Accessories supplied 5HPRWHFRQWURO One R03 (AAA size) battery 6LPSOH,% 21 English 7 6SHFL¿FDWLRQ 8 Troubleshooting English ,I\RXH[SHULHQFHDQ\RIWKHIROORZLQJGLI¿FXOWLHVZKLOHXVLQJWKLVXQLWFKHFNWKHOLVWEHORZ EHIRUHFRQVXOWLQJ\RXUQHDUHVW726+,%$GHDOHU Problem Tip 1RUHDFWLRQWRWKH remote control. Connect the product to the power outlet. Point the remote control at the product. ,QVHUWWKHEDWWHU\FRUUHFWO\ ,QVHUWQHZEDWWHU\LQWKHUHPRWHFRQWURO 1RYLGHRVLJQDORQWKH display device. Turn on the TV. 6HWWKH79WRWKHFRUUHFWH[WHUQDOLQSXW Select the correct video resolution. Set TV System of TV correctly. ,QFRUUHFWRUQRDXGLR video signal on the DPSOL¿HUGLVSOD\GHYLFH YLD+'0,FDEOH ,IWKHXQLWLVFRQQHFWHGWRWKHXQDXWKRUL]HGGLVSOD\GHYLFHZLWK DQ+'0,FDEOHWKHDXGLRYLGHRVLJQDOPD\QRWEHRXWSXW 1RKLJKGH¿QLWLRQYLGHR signal on the TV. 'RHVWKHGLVFFRQWDLQKLJKGH¿QLWLRQYLGHR"+LJKGH¿QLWLRQ video is not available when the disc does not contain it. (QVXUHWKHDPSOL¿HUGLVSOD\GHYLFHVVHWWLQJPDWFKWKH%OXUD\ Disc™ player. 'RHVWKH79VXSSRUWKLJKGH¿QLWLRQYLGHR"+LJKGH¿QLWLRQYLGHR is not available when the TV does not support it. 1RDXGLRVLJQDOIURPWKH loudspeakers of the audio system. Turn on the audio system. 6HWWKHDXGLRV\VWHPWRWKHFRUUHFWH[WHUQDOLQSXW ,QFUHDVHWKHYROXPHOHYHORIWKHDXGLRV\VWHP Cannot play back a disc. 0DNHVXUHWKDWWKH%OXUD\'LVFSOD\HUVXSSRUWVWKHGLVF 0DNHVXUHWKDWWKH%OXUD\'LVFSOD\HUVXSSRUWVWKHUHJLRQ code of the DVD or Blu-ray Disc™. )RU'9'5:5RU'9'5:5PDNHVXUHWKDWWKHGLVFLV ¿QDOL]HG Clean the disc. &DQQRWSOD\EDFN-3(* ¿OHVIURPDGLVF 0DNHVXUHWKDWWKHGLVFZDVUHFRUGHGLQWKH-3(*,62IRUPDW &DQQRWSOD\'LY;®¿OHV 0DNHVXUHWKDWWKH¿OHZDVUHFRUGHGLQWKH+RU03(* format. &DQQRWSOD\03¿OHV from a disc. 0DNHVXUHWKDWWKHGLVFZDVUHFRUGHGLQWKH,62IRUPDW 0DNHVXUHWKDWWKHELWUDWHRIWKH03¿OHVLVEHWZHHQDQG 320 kbps. 0DNHVXUHWKDWWKHVDPSOHUDWHRIWKH03¿OHVLVN+] N+]RUN+] 22 0DNHVXUHWKDWWKHVHOHFWHGJURXSIROGHUGRHVQRWFRQWDLQ PRUHWKDQ¿OHVIRU'9'DQG¿OHVIRU&' 0DNHVXUHWKDWWKH¿OHH[WHQVLRQLVMSJ-3*MSHJRU-3(* &DQQRW¿QGD03¿OH 0DNHVXUHWKDWWKHVHOHFWHGIROGHUGRHVQRWFRQWDLQPRUHWKDQ ¿OHVIRU'9'DQG¿OHVIRU&' 0DNHVXUHWKDWWKH¿OHH[WHQVLRQLVPSRU03 &DQQRWXSJUDGH6: :KHQ\RXXSJUDGHWKHV\VWHPZLWK86%)ODVKGHYLFH\RX VKRXOGPDNHDQHZIROGHUQDPHG83*B$//DQGFRS\WKH XSJUDGH¿OHLQWRWKLVIROGHU :KHQ\RXXSJUDGHWKHV\VWHPE\QHWZRUNSOHDVHPDNHVXUH WKHSOD\HULVFRQQHFWHGWRWKHLQWHUQHWZKHQXSJUDGLQJWKH6: Sometimes the options of setup menu cannot be selected. :KHQSOD\LQJD'9'GLVFRU%OXUD\'LVF™, press STOP button once, the player will go into stop resume mode, meanwhile you cannot change some settings in setup menu such as language subitem menu, audio, subtitle etc. ,I\RXZDQWWRFKDQJHWKDWSUHVV6723EXWWRQWZLFHWKH player will go into full stop mode, then you can do it. 23 English &DQQRW¿QGD-3(*¿OH 9 Glossary English Aspect ratio Aspect ratio refers to the length to height ratio of TV screens. The ratio of a standard 79LVZKLOHWKHUDWLRRIDKLJK GH¿QLWLRQRUZLGH79LV7KHOHWWHUER[ allows you to enjoy a picture with a wider SHUVSHFWLYHRQDVWDQGDUGVFUHHQ $9, $XGLR9LGHR,QWHUOHDYHNQRZQE\LWV DFURQ\P$9,LVDPXOWLPHGLDFRQWDLQHU RUPDW$9,¿OHVFDQFRQWDLQERWKDXGLRDQG YLGHRGDWDLQD¿OHFRQWDLQHUWKDWDOORZV synchronous audio-with-video playback. Blu-ray Disc70 Blu-ray Disc70LVDQH[WJHQHUDWLRQRSWLFDO YLGHRGLVFFDSDEOHRIVWRULQJ¿YHWLPHV more data than a conventional DVD. The ODUJHFDSDFLW\PDNHVLWSRVVLEOHWREHQH¿W IURPWKHIHDWXUHVVXFKDVKLJKGH¿QLWLRQ videos, multichannel surround sound, interactive menus and so on. %21869,(:70 This is a Blu-ray Disc70-Video (Final Standard 3UR¿OHRU3UR¿OHWKDWVXSSRUWV interactive content encoded on the disc, such as picture-in-picture. This means you can play the primary video and secondary video simultaneously. Digital Audio Digital Audio is a sound signal that has been converted into numerical values. Digital sound can be transmitted through multiple channels. Analogue sound can only be transmitted through two channels. 'LY;® 'LY;® is a codec (compression/decompression) that can compress images to a very small amount of data. 'LY;&HUWL¿HG®WRSOD\'LY;®YLGHRXSWR+' 1080p, including premium content. $%287',9;9,'(2 'LY;® is a digital video format created by 'LY;,QF7KLVLVDQRI¿FLDO'LY;&HUWL¿HG® 24 GHYLFHWKDWSOD\V'LY;YLGHR9LVLW GLY[FRPIRUPRUHLQIRUPDWLRQDQG VRIWZDUHWRROVWRFRQYHUW\RXU¿OHVLQWR'LY; video. $%287',9;9,'(221'(0$1' 7KLV'LY;&HUWL¿HG® device must be UHJLVWHUHGLQRUGHUWRSOD\SXUFKDVHG'LY; Video-on-Demand (VOD) movies. To obtain \RXUUHJLVWUDWLRQFRGHORFDWHWKH'LY;92' section in your device setup menu. Go to YRGGLY[FRPIRUPRUHLQIRUPDWLRQRQKRZ to complete your registration. Dolby® Digital The system to compress digital sound GHYHORSHGE\'ROE\/DERUDWRULHV,WRIIHUV you sound of stereo (2ch) or multichannel audio. Dolby® Digital Plus 'ROE\'LJLWDO3OXVLVWKHQH[WJHQHUDWLRQ digital audio compression technology GHYHORSHGDVDQH[WHQVLRQWR'ROE\'LJLWDO Blu-ray Disc™ supports 7.1 multi-channel surround sound output. Dolby®7UXH+' 'ROE\7UXH+'LVDORVVOHVVFRGLQJ WHFKQRORJ\GHYHORSHGIRUQH[WJHQHUDWLRQ optical discs. Blu-ray Disc70 supports 7.1 multi-channel surround sound output. DTS® DTS is a multi-channel surround sound system. By connecting to DTS decoder, you can enjoy movie dynamic and realistic sound like movie theater. DTS surround sound technologies were developed by '76,QF '76+'® '76+'LVDORVVOHVVFRGLQJWHFKQRORJ\ GHYHORSHGDVDQH[WHQVLRQRIWKHRULJLQDO DTS Coherent Acoustics format. Blu-ray Disc™ supports 7.1 multi-channel surround sound output. +'&3 +LJKEDQGZLGWK'LJLWDO&RQWHQW3URWHFWLRQ 7KLVLVDVSHFL¿FDWLRQWKDWSURYLGHVD secure transmission of digital contents between different devices (to prevent unauthorized copyright.) +'0,® +LJK'H¿QLWLRQ0XOWLPHGLD,QWHUIDFH+'0, is a high-speed digital interface that can WUDQVPLWXQFRPSUHVVHGKLJKGH¿QLWLRQ YLGHRDQGGLJLWDOPXOWLFKDQQHODXGLR,W delivers high quality picture and sound TXDOLW\+'0,LVIXOO\EDFNZDUGFRPSDWLEOH ZLWK'9,$VUHTXLUHGE\WKH+'0,VWDQGDUG FRQQHFWLQJWR+'0,RU'9,SURGXFWVZLWKRXW +'&3+LJKEDQGZLGWK'LJLWDO&RQWHQW Protection) will result in no Video or Audio output. -3(* A very common digital still picture format. A still-picture data compression system SURSRVHGE\WKH-RLQW3KRWRJUDSKLF([SHUW Group, which features small decrease in image quality in spite of its high compression UDWLR)LOHVDUHUHFRJQL]HGE\WKHLU¿OH H[WHQVLRQµMSJ¶RUµMSHJ¶ /$1/RFDO$UHD1HWZRUN A group of linked devices in a company, VFKRRORUKRPH,QGLFDWHVWKHERXQGDULHV of a particular network. /RFDOVWRUDJH This storage area is used as destination for VWRULQJDGGLWLRQDOFRQWHQWVIURP%'/LYH™ enabled Blu-ray Disc™-Video. 0.9 7KH 0DWURVND 0XOWLPHGLD &RQWDLQHU LV DQ RSHQVWDQGDUGIUHHFRQWDLQHUIRUPDWD¿OH format that can hold an unlimited number of video, audio, picture or subtitle tracks LQVLGHDVLQJOH¿OH,WLVLQWHQGHGWRVHUYHDV a universal format for storing common multimedia content, like movies or TV shows. 03 $¿OHIRUPDWZLWKDVRXQGGDWD FRPSUHVVLRQV\VWHP03LVWKH DEEUHYLDWLRQRI0RWLRQ3LFWXUH([SHUWV *URXSRU03(*$XGLR/D\HU:LWK WKH03IRUPDWRQH&'5RU&'5:FDQ contain about 10 times more data than a regular CD. 03 03 ¿OH IRUPDW LV D PXOWLPHGLD FRQWDLQHU IRUPDW VWDQGDUG VSHFL¿HG DV D SDUW RI 03(*,WLVPRVWFRPPRQO\XVHGWRVWRUH digital video and digital audio streams, HVSHFLDOO\WKRVHGH¿QHGE\03(*03(* +«EXWFDQDOVREHXVHGWRVWRUHRWKHU data such as subtitles and still images. PBC Playback Control. A system where you navigate through a Video CD/Super VCD with on-screen menus that are recorded RQWRWKHGLVF<RXFDQHQMR\LQWHUDFWLYH playback and search. 3&0 3XOVH&RGH0RGXODWLRQ$GLJLWDODXGLR encoding system. Region code A system that allows discs to be played only in the region designated. This unit only plays discs that have compatible UHJLRQFRGHV<RXFDQ¿QGWKHUHJLRQFRGH of your unit on the product label. Some discs are compatible with more than one UHJLRQRU$//UHJLRQV 25 English '76+'0DVWHU$XGLR70 $GLVFHQFRGHGZLWK'76+'0DVWHU$XGLR GHOLYHUV$//RIWKHLQIRUPDWLRQIURPWKH RULJLQDOPDVWHUUHFRUGLQJ²ELWIRUELWLW V identical to what the sound engineers laid GRZQ$XGLRGRHVQ WJHWDQ\EHWWHUWKDQ this. License Information on the Software Used in This Product English This document is statement purpose only. Not concerned with operation of this product. The software pre-installed in this product consists of multiple, independent software components. Each software component is copyrighted by a third party. This product uses software components that are distributed as freeware XQGHUDWKLUGSDUW\HQGXVHUOLFHQVHDJUHHPHQWRUFRS\ULJKWQRWLFHKHUHLQDIWHUUHIHUUHGWRDVD³(8/$´ 6RPH(8/$VUHTXLUHWKDWWKHVRXUFHFRGHRIWKHDSSOLFDEOHFRPSRQHQWEHGLVFORVHGDVWKHFRQGLWLRQIRUGLVWULEXWLQJWKHVRIWZDUHFRPSRQHQWLQH[HFXWDEOHIRUPDW<RXFDQFKHFNWKHVRIWZDUHFRPSRQHQWVVXEMHFWWRVXFK(8/$ UHTXLUHPHQWVRQWKHIROORZLQJHPDLODGGUHVV (PDLODGGUHVVOLQX[#WRVKLEDGPHFRMS 726+,%$SURYLGHVDZDUUDQW\IRUWKLVSURGXFW\RXKDYHSXUFKDVHGXQGHUFRQGLWLRQVVHWIRUWKE\726+,%$+RZHYHU VRPHRIWKHVRIWZDUHFRPSRQHQWVGLVWULEXWHGXQGHUDQ(8/$DUHPDGHDYDLODEOHIRUXVHE\WKHXVHURQWKHDVVXPStion that they are not copyrighted or warranted by a third party. These software components are licensed to the user free of charge and therefore not covered by any warranty within the scope of the applicable laws. These software FRPSRQHQWVDUHQRWVXEMHFWWRDQ\FRS\ULJKWVRURWKHUWKLUGSDUW\ULJKWVDQGDUHSURYLGHGLQ³DVLV´FRQGLWLRQZLWKRXW DQ\ZDUUDQW\ZKHWKHUH[SUHVVRULPSOLHG³:DUUDQW\´KHUHLQFOXGHVEXWQRWOLPLWHGWRDQLPSOLHGZDUUDQW\IRUPDUNHWDELOLW\RU¿WQHVVIRUVSHFL¿FXVHV$OOULVNVDVVRFLDWHGZLWKWKHTXDOLW\RUSHUIRUPDQFHRIWKHVHVRIWZDUHFRPSRQHQWVDUHDVVXPHGE\WKHXVHU726+,%$VKDOOQRWEHOLDEOHZKDWVRHYHUIRUDQ\FRVWRIUHSDLURUFRUUHFWLRQRURWKHU LQFLGHQWDOH[SHQVHLQFXUUHGLQFRQQHFWLRQZLWKDGHIHFWIRXQGLQDQ\RIWKHVHVRIWZDUHFRPSRQHQWV8QOHVVVSHFL¿HG under the applicable laws or in a written agreement, a party who changes or redistributes the software with consent from the copyright holders or based on the aforementioned licenses shall not be held liable whatsoever for any loss arising from the use of or inability to use such software components. The same applies even when the copyright KROGHUVRUUHOHYDQWWKLUGSDUWLHVKDYHEHHQLQIRUPHGRIWKHSRVVLELOLW\RIVXFKORVV³/RVV´KHUHLQFOXGHVQRUPDO VSHFLDOLQFLGHQWDODQGLQGLUHFWORVVLQFOXGLQJEXWQRWOLPLWHGWRWKHORVVRIGDWDRULWVDFFXUDF\ORVVLQFXUUHGE\WKH XVHURUDQ\WKLUGSDUW\DQGLQWHUIDFHLQFRPSDWLELOLW\ZLWKRWKHUVRIWZDUH3OHDVHUHDGHDFK(8/$IRUGHWDLOVRQWKH use conditions and items that must be observed regarding these software components. 7KHWDEOHEHORZOLVWVWKHVRIWZDUHFRPSRQHQWVSUHLQVWDOOHGLQWKLVSURGXFWZKLFKDUHVXEMHFWWR(8/$V7KHXVHU VKRXOGUHDGWKHDSSOLFDEOH(8/$VFDUHIXOO\EHIRUHXVLQJWKHVHVRIWZDUHFRPSRQHQWV7KH(8/$VDUHH[KLELWHGLQWKHLU RULJLQDOWH[W(QJOLVKDVH[DFWO\ZULWWHQE\WKHUHVSHFWLYHSDUWLHV 26 Project name Project license Linux kernel GPLv2 SquashFS GPLv2 Busybox GPLv2 Das U-boot GPLv2 gcc libgcc GPLv3.txt and gcc-exception.txt (GPLv3 with GCC Runtime Library Exception) gcc libstdc++ GPLv3.txt and gcc-exception.txt (GPLv3 with GCC Runtime Library Exception) glibc LGPLv2.1 LIRC GPLv2 International Components for Unicode ICULicense.txt OpenSSL openssl.txt zlib zlib.txt FreeType FreeType.txt Expat expat.txt libcurl libcurl.txt Independent JPEG group libjpeg-7.txt c-ares c-arse.txt mtd-utils GPLv2 libmtp LGPLv2.1 libusb LGPLv2.1 libusb-compat LGPLv2.1 Unicode Bidirectional Algorithm Unicode_Bidirectional_Algorithm.txt HarfBuzz HarfBuzz.txt $FWLYLWLHVRWKHUWKDQFRS\LQJGLVWULEXWLRQDQGPRGL¿FDWLRQDUH QRWFRYHUHGE\WKLV/LFHQVHWKH\DUHRXWVLGHLWVVFRSH7KHDFW of running the Program is not restricted, and the output from the Program is covered only if its contents constitute a work based on the Program (independent of having been made by UXQQLQJWKH3URJUDP:KHWKHUWKDWLVWUXHGHSHQGVRQZKDW the Program does. The licenses for most software are designed to take away your IUHHGRPWRVKDUHDQGFKDQJHLW%\FRQWUDVWWKH*18*HQHUDO 3XEOLF/LFHQVHLVLQWHQGHGWRJXDUDQWHH\RXUIUHHGRPWRVKDUH and change free software--to make sure the software is free for DOOLWVXVHUV7KLV*HQHUDO3XEOLF/LFHQVHDSSOLHVWRPRVWRIWKH )UHH6RIWZDUH)RXQGDWLRQ VVRIWZDUHDQGWRDQ\RWKHUSURJUDP whose authors commit to using it. (Some other Free Software )RXQGDWLRQVRIWZDUHLVFRYHUHGE\WKH*18/HVVHU*HQHUDO3XEOLF/LFHQVHLQVWHDG<RXFDQDSSO\LWWR\RXUSURJUDPVWRR <RX PD\ FRS\ DQG GLVWULEXWH YHUEDWLP FRSLHV RI WKH 3URJUDP VVRXUFHFRGHDV\RXUHFHLYHLWLQDQ\PHGLXPSURYLGHG that you conspicuously and appropriately publish on each copy DQ DSSURSULDWH FRS\ULJKW QRWLFH DQG GLVFODLPHU RI ZDUUDQW\ NHHSLQWDFWDOOWKHQRWLFHVWKDWUHIHUWRWKLV/LFHQVHDQGWRWKH DEVHQFH RI DQ\ ZDUUDQW\DQG JLYH DQ\ RWKHU UHFLSLHQWV RI WKH 3URJUDPDFRS\RIWKLV/LFHQVHDORQJZLWKWKH3URJUDP :KHQZHVSHDNRIIUHHVRIWZDUHZHDUHUHIHUULQJWRIUHHGRP QRWSULFH2XU*HQHUDO3XEOLF/LFHQVHVDUHGHVLJQHGWRPDNH sure that you have the freedom to distribute copies of free software (and charge for this service if you wish), that you receive source code or can get it if you want it, that you can FKDQJHWKHVRIWZDUHRUXVHSLHFHVRILWLQQHZIUHHSURJUDPV and that you know you can do these things. To protect your rights, we need to make restrictions that forbid anyone to deny you these rights or to ask you to surrender the rights. These restrictions translate to certain responsibilities for you if you distribute copies of the software, or if you modify it. )RU H[DPSOH LI \RX GLVWULEXWH FRSLHV RI VXFK D SURJUDP whether gratis or for a fee, you must give the recipients all WKHULJKWVWKDW\RXKDYH<RXPXVWPDNHVXUHWKDWWKH\WRR receive or can get the source code. And you must show them these terms so they know their rights. :HSURWHFW\RXUULJKWVZLWKWZRVWHSVFRS\ULJKWWKHVRIWware, and (2) offer you this license which gives you legal permission to copy, distribute and/or modify the software. $OVRIRUHDFKDXWKRU VSURWHFWLRQDQGRXUVZHZDQWWRPDNH certain that everyone understands that there is no warranty for WKLVIUHHVRIWZDUH,IWKHVRIWZDUHLVPRGL¿HGE\VRPHRQHHOVH and passed on, we want its recipients to know that what they have is not the original, so that any problems introduced by RWKHUVZLOOQRWUHÀHFWRQWKHRULJLQDODXWKRUV UHSXWDWLRQV Finally, any free program is threatened constantly by software SDWHQWV :H ZLVK WR DYRLG WKH GDQJHU WKDW UHGLVWULEXWRUV RI D free program will individually obtain patent licenses, in effect making the program proprietary. To prevent this, we have PDGHLWFOHDUWKDWDQ\SDWHQWPXVWEHOLFHQVHGIRUHYHU\RQH V free use or not licensed at all. The precise terms and conditions for copying, distribution and PRGL¿FDWLRQIROORZ *18*(1(5$/38%/,&/,&(16( 7(506 $1' &21',7,216 )25 &23<,1* ',675,%87,21 $1'02',),&$7,21 7KLV/LFHQVHDSSOLHVWRDQ\SURJUDPRURWKHUZRUNZKLFK contains a notice placed by the copyright holder saying it may EHGLVWULEXWHGXQGHUWKHWHUPVRIWKLV*HQHUDO3XEOLF/LFHQVH The "Program", below, refers to any such program or work, and a "work based on the Program" means either the Program RU DQ\ GHULYDWLYH ZRUN XQGHU FRS\ULJKW ODZ WKDW LV WR VD\ D work containing the Program or a portion of it, either verbatim RUZLWKPRGL¿FDWLRQVDQGRUWUDQVODWHGLQWRDQRWKHUODQJXDJH +HUHLQDIWHU WUDQVODWLRQ LV LQFOXGHG ZLWKRXW OLPLWDWLRQ LQ WKH WHUPPRGL¿FDWLRQ(DFKOLFHQVHHLVDGGUHVVHGDV\RX <RXPD\FKDUJHDIHHIRUWKHSK\VLFDODFWRIWUDQVIHUULQJDFRS\ DQG \RX PD\ DW \RXU RSWLRQ RIIHU ZDUUDQW\ SURWHFWLRQ LQ H[change for a fee. <RX PD\ PRGLI\ \RXU FRS\ RU FRSLHV RI WKH 3URJUDP RU any portion of it, thus forming a work based on the Program, DQGFRS\DQGGLVWULEXWHVXFKPRGL¿FDWLRQVRUZRUNXQGHUWKH terms of Section 1 above, provided that you also meet all of WKHVHFRQGLWLRQV D <RX PXVW FDXVH WKH PRGL¿HG ¿OHV WR FDUU\ SURPLQHQW QRWLFHVVWDWLQJWKDW\RXFKDQJHGWKH¿OHVDQGWKHGDWHRIDQ\ change. E<RXPXVWFDXVHDQ\ZRUNWKDW\RXGLVWULEXWHRUSXEOLVK that in whole or in part contains or is derived from the Program or any part thereof, to be licensed as a whole at no charge to all WKLUGSDUWLHVXQGHUWKHWHUPVRIWKLV/LFHQVH F ,I WKH PRGL¿HG SURJUDP QRUPDOO\ UHDGV FRPPDQGV interactively when run, you must cause it, when started running for such interactive use in the most ordinary way, to print or display an announcement including an appropriate copyright notice and a notice that there is no warranty (or else, saying that you provide a warranty) and that users may redistribute the program under these conditions, and telling the user how to YLHZDFRS\RIWKLV/LFHQVH([FHSWLRQLIWKH3URJUDPLWVHOILV interactive but does not normally print such an announcement, your work based on the Program is not required to print an announcement.) 7KHVHUHTXLUHPHQWVDSSO\WRWKHPRGL¿HGZRUNDVDZKROH ,I LGHQWL¿DEOH VHFWLRQV RI WKDW ZRUN DUH QRW GHULYHG IURP WKH Program, and can be reasonably considered independent and VHSDUDWHZRUNVLQWKHPVHOYHVWKHQWKLV/LFHQVHDQGLWVWHUPV do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the Program, the GLVWULEXWLRQRIWKHZKROHPXVWEHRQWKHWHUPVRIWKLV/LFHQVH ZKRVH SHUPLVVLRQV IRU RWKHU OLFHQVHHV H[WHQG WR WKH HQWLUH whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest \RXUULJKWVWRZRUNZULWWHQHQWLUHO\E\\RXUDWKHUWKHLQWHQWLV WRH[HUFLVHWKHULJKWWRFRQWUROWKHGLVWULEXWLRQRIGHULYDWLYHRU collective works based on the Program. ,Q DGGLWLRQ PHUH DJJUHJDWLRQ RI DQRWKHU ZRUN QRW EDVHG RQ the Program with the Program (or with a work based on the Program) on a volume of a storage or distribution medium does QRWEULQJWKHRWKHUZRUNXQGHUWKHVFRSHRIWKLV/LFHQVH <RXPD\FRS\DQGGLVWULEXWHWKH3URJUDPRUDZRUNEDVHG RQLWXQGHU6HFWLRQLQREMHFWFRGHRUH[HFXWDEOHIRUPXQGHU the terms of Sections 1 and 2 above provided that you also do RQHRIWKHIROORZLQJ 27 English *18*(1(5$/38%/,&/,&(16( 9HUVLRQ-XQH &RS\ULJKW&)UHH6RIWZDUH)RXQGDWLRQ,QF )UDQNOLQ6WUHHW)LIWK)ORRU%RVWRQ0$86$ Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble English a) Accompany it with the complete corresponding machinereadable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used IRUVRIWZDUHLQWHUFKDQJHRU b) Accompany it with a written offer, valid for at least three years, to give any third party, for a charge no more than your cost of physically performing source distribution, a complete machine-readable copy of the corresponding source code, to be distributed under the terms of Sections 1 and 2 above on a PHGLXPFXVWRPDULO\XVHGIRUVRIWZDUHLQWHUFKDQJHRU c) Accompany it with the information you received as to the offer to distribute corresponding source code. (This alternative is allowed only for non-commercial distribution and only if you UHFHLYHGWKHSURJUDPLQREMHFWFRGHRUH[HFXWDEOHIRUPZLWK such an offer, in accord with Subsection b above.) The source code for a work means the preferred form of the ZRUNIRUPDNLQJPRGL¿FDWLRQVWRLW)RUDQH[HFXWDEOHZRUN complete source code means all the source code for all modules LW FRQWDLQV SOXV DQ\ DVVRFLDWHG LQWHUIDFH GH¿QLWLRQ ¿OHV SOXV the scripts used to control compilation and installation of WKH H[HFXWDEOH +RZHYHU DV D VSHFLDO H[FHSWLRQ WKH VRXUFH code distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the operating V\VWHPRQZKLFKWKHH[HFXWDEOHUXQVXQOHVVWKDWFRPSRQHQW LWVHOIDFFRPSDQLHVWKHH[HFXWDEOH ,IGLVWULEXWLRQRIH[HFXWDEOHRUREMHFWFRGHLVPDGHE\RIIHULQJ access to copy from a designated place, then offering equivalent access to copy the source code from the same place counts as distribution of the source code, even though third parties are not compelled to copy the source along with the object code. <RX PD\ QRW FRS\ PRGLI\ VXEOLFHQVH RU GLVWULEXWH WKH 3URJUDPH[FHSWDVH[SUHVVO\SURYLGHGXQGHUWKLV/LFHQVH$Q\ attempt otherwise to copy, modify, sublicense or distribute the Program is void, and will automatically terminate your rights XQGHUWKLV/LFHQVH +RZHYHUSDUWLHVZKRKDYHUHFHLYHGFRSLHVRUULJKWVIURP\RX XQGHU WKLV /LFHQVH ZLOO QRW KDYH WKHLU OLFHQVHV WHUPLQDWHG VR long as such parties remain in full compliance. <RXDUHQRWUHTXLUHGWRDFFHSWWKLV/LFHQVHVLQFH\RXKDYH QRWVLJQHGLW+RZHYHUQRWKLQJHOVHJUDQWV\RXSHUPLVVLRQWR modify or distribute the Program or its derivative works. These DFWLRQVDUHSURKLELWHGE\ODZLI\RXGRQRWDFFHSWWKLV/LFHQVH Therefore, by modifying or distributing the Program (or any work based on the Program), you indicate your acceptance RI WKLV /LFHQVH WR GR VR DQG DOO LWV WHUPV DQG FRQGLWLRQV IRU copying, distributing or modifying the Program or works based on it. 6. Each time you redistribute the Program (or any work based on the Program), the recipient automatically receives a license from the original licensor to copy, distribute or modify the 3URJUDPVXEMHFWWRWKHVHWHUPVDQGFRQGLWLRQV<RXPD\QRW LPSRVH DQ\ IXUWKHU UHVWULFWLRQV RQ WKH UHFLSLHQWV H[HUFLVH RI WKHULJKWVJUDQWHGKHUHLQ<RXDUHQRWUHVSRQVLEOHIRUHQIRUFLQJ FRPSOLDQFHE\WKLUGSDUWLHVWRWKLV/LFHQVH ,I DV D FRQVHTXHQFH RI D FRXUW MXGJPHQW RU DOOHJDWLRQ of patent infringement or for any other reason (not limited to patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the FRQGLWLRQV RI WKLV /LFHQVH WKH\ GR QRW H[FXVH \RX IURP WKH FRQGLWLRQV RI WKLV /LFHQVH ,I \RX FDQQRW GLVWULEXWH VR DV WR VDWLVI\VLPXOWDQHRXVO\\RXUREOLJDWLRQVXQGHUWKLV/LFHQVHDQG any other pertinent obligations, then as a consequence you may QRWGLVWULEXWHWKH3URJUDPDWDOO)RUH[DPSOHLIDSDWHQW license would not permit royalty-free redistribution of the Program by all those who receive copies directly or indirectly 28 through you, then the only way you could satisfy both it and WKLV/LFHQVHZRXOGEHWRUHIUDLQHQWLUHO\IURPGLVWULEXWLRQRIWKH Program. ,I DQ\ SRUWLRQ RI WKLV VHFWLRQ LV KHOG LQYDOLG RU XQHQIRUFHDEOH under any particular circumstance, the balance of the section is intended to apply and the section as a whole is intended to apply in other circumstances. ,WLVQRWWKHSXUSRVHRIWKLVVHFWLRQWRLQGXFH\RXWRLQIULQJHDQ\ patents or other property right claims or to contest validity of DQ\VXFKFODLPVWKLVVHFWLRQKDVWKHVROHSXUSRVHRISURWHFWLQJ the integrity of the free software distribution system, which is LPSOHPHQWHG E\ SXEOLF OLFHQVH SUDFWLFHV 0DQ\ SHRSOH KDYH made generous contributions to the wide range of software distributed through that system in reliance on consistent DSSOLFDWLRQRIWKDWV\VWHPLWLVXSWRWKHDXWKRUGRQRUWRGHFLGH if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is EHOLHYHGWREHDFRQVHTXHQFHRIWKHUHVWRIWKLV/LFHQVH ,IWKHGLVWULEXWLRQDQGRUXVHRIWKH3URJUDPLVUHVWULFWHGLQ certain countries either by patents or by copyrighted interfaces, the original copyright holder who places the Program under this /LFHQVHPD\DGGDQH[SOLFLWJHRJUDSKLFDOGLVWULEXWLRQOLPLWDWLRQ H[FOXGLQJWKRVHFRXQWULHVVRWKDWGLVWULEXWLRQLVSHUPLWWHGRQO\ LQ RU DPRQJ FRXQWULHV QRW WKXV H[FOXGHG ,Q VXFK FDVH WKLV /LFHQVHLQFRUSRUDWHVWKHOLPLWDWLRQDVLIZULWWHQLQWKHERG\RI WKLV/LFHQVH 9. The Free Software Foundation may publish revised and/or QHZYHUVLRQVRIWKH*HQHUDO3XEOLF/LFHQVHIURPWLPHWRWLPH Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. (DFK YHUVLRQ LV JLYHQ D GLVWLQJXLVKLQJ YHUVLRQ QXPEHU ,I WKH 3URJUDP VSHFL¿HV D YHUVLRQ QXPEHU RI WKLV /LFHQVH ZKLFK applies to it and "any later version", you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation. ,I WKH 3URJUDP GRHV QRW VSHFLI\ D YHUVLRQ QXPEHU RI WKLV /LFHQVH \RX PD\ FKRRVH DQ\ YHUVLRQ HYHU SXEOLVKHG E\ WKH Free Software Foundation. ,I\RXZLVKWRLQFRUSRUDWHSDUWVRIWKH3URJUDPLQWRRWKHU free programs whose distribution conditions are different, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the )UHH6RIWZDUH)RXQGDWLRQZHVRPHWLPHVPDNHH[FHSWLRQVIRU this. Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. 12:$55$17< %(&$86(7+(352*5$0,6/,&(16(')5((2)&+$5*( 7+(5(,612:$55$17<)257+(352*5$0727+((;7(17 3(50,77('%<$33/,&$%/(/$:(;&(37:+(127+(5:,6( 67$7(' ,1 :5,7,1* 7+( &23<5,*+7 +2/'(56 $1'25 27+(5 3$57,(6 3529,'( 7+( 352*5$0 $6 ,6 :,7+287 :$55$17< 2) $1< .,1' (,7+(5 (;35(66(' 25 ,03/,(' ,1&/8',1*%87127/,0,7('727+(,03/,(':$55$17,(6 2) 0(5&+$17$%,/,7< $1' ),71(66 )25 $ 3$57,&8/$5 385326( 7+( (17,5( 5,6. $6 72 7+( 48$/,7< $1' 3(5)250$1&( 2) 7+( 352*5$0 ,6 :,7+ <28 6+28/' 7+( 352*5$0 3529( '()(&7,9( <28 $6680( 7+( &267 2)$//1(&(66$5<6(59,&,1*5(3$,525&255(&7,21 ,112(9(1781/(665(48,5('%<$33/,&$%/(/$:25 $*5(('72,1:5,7,1*:,//$1<&23<5,*+7+2/'(525 $1<27+(53$57<:+20$<02',)<$1'255(',675,%87( 7+(352*5$0$63(50,77('$%29(%(/,$%/(72<28)25 7KLV *HQHUDO 3XEOLF /LFHQVH GRHV QRW SHUPLW LQFRUSRUDWLQJ \RXU SURJUDP LQWR SURSULHWDU\ SURJUDPV ,I \RXU SURJUDP LV a subroutine library, you may consider it more useful to permit OLQNLQJSURSULHWDU\DSSOLFDWLRQVZLWKWKHOLEUDU\,IWKLVLVZKDW \RX ZDQW WR GR XVH WKH *18 /HVVHU *HQHUDO 3XEOLF /LFHQVH LQVWHDGRIWKLV/LFHQVH (1'2)7(506$1'&21',7,216 *18/(66(5*(1(5$/38%/,&/,&(16( Version 2.1, February 1999 &RS\ULJKW&)UHH6RIWZDUH)RXQGDWLRQ,QF )UDQNOLQ6WUHHW)LIWK)ORRU%RVWRQ0$86$ +RZWR$SSO\7KHVH7HUPVWR<RXU1HZ3URJUDPV ,I\RXGHYHORSDQHZSURJUDPDQG\RXZDQWLWWREHRIWKH greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. 7RGRVRDWWDFKWKHIROORZLQJQRWLFHVWRWKHSURJUDP,WLV VDIHVWWRDWWDFKWKHPWRWKHVWDUWRIHDFKVRXUFH¿OHWRPRVW HIIHFWLYHO\ FRQYH\ WKH H[FOXVLRQ RI ZDUUDQW\ DQG HDFK ¿OH should have at least the "copyright" line and a pointer to where the full notice is found. RQHOLQHWRJLYHWKHSURJUDP VQDPHDQGDEULHILGHDRI ZKDWLWGRHV! &RS\ULJKW&\HDU!QDPHRIDXWKRU! 7KLVSURJUDPLVIUHHVRIWZDUH\RXFDQUHGLVWULEXWHLWDQGRU PRGLI\LWXQGHUWKHWHUPVRIWKH*18*HQHUDO3XEOLF/LFHQVHDV SXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQHLWKHUYHUVLRQRI WKH/LFHQVHRUDW\RXURSWLRQDQ\ODWHUYHUVLRQ This program is distributed in the hope that it will be XVHIXO EXW :,7+287 $1< :$55$17< ZLWKRXW HYHQ WKH LPSOLHG ZDUUDQW\ RI 0(5&+$17$%,/,7< RU ),71(66 )25 $ 3$57,&8/$5385326(6HHWKH*18*HQHUDO3XEOLF/LFHQVH for more details. <RX VKRXOG KDYH UHFHLYHG D FRS\ RI WKH *18 *HQHUDO 3XEOLF /LFHQVH DORQJ ZLWK WKLV SURJUDP LI QRW ZULWH WR WKH )UHH6RIWZDUH)RXQGDWLRQ,QF)UDQNOLQ6WUHHW)LIWK)ORRU %RVWRQ0$86$ Also add information on how to contact you by electronic and paper mail. ,IWKHSURJUDPLVLQWHUDFWLYHPDNHLWRXWSXWDVKRUWQRWLFHOLNH WKLVZKHQLWVWDUWVLQDQLQWHUDFWLYHPRGH Gnomovision version 69, Copyright (C) year name of author *QRPRYLVLRQFRPHVZLWK$%62/87(/<12:$55$17<IRU GHWDLOVW\SHCVKRZZ This is free software, and you are welcome to redistribute it XQGHUFHUWDLQFRQGLWLRQVW\SHCVKRZF IRUGHWDLOV 7KH K\SRWKHWLFDO FRPPDQGV CVKRZ Z DQG CVKRZ F VKRXOG VKRZWKHDSSURSULDWHSDUWVRIWKH*HQHUDO3XEOLF/LFHQVH2I course, the commands you use may be called something other WKDQCVKRZZ DQGCVKRZF WKH\FRXOGHYHQEHPRXVHFOLFNV or menu items--whatever suits your program. <RXVKRXOGDOVRJHW\RXUHPSOR\HULI\RXZRUNDVDSURJUDPPHU or your school, if any, to sign a "copyright disclaimer" for the SURJUDPLIQHFHVVDU\+HUHLVDVDPSOHDOWHUWKHQDPHV <R\RG\QH,QFKHUHE\GLVFODLPVDOOFRS\ULJKWLQWHUHVWLQWKH SURJUDP µ*QRPRYLVLRQ¶ ZKLFK PDNHV SDVVHV DW FRPSLOHUV ZULWWHQE\-DPHV+DFNHU VLJQDWXUHRI7\&RRQ!$SULO Ty Coon, President of Vice LGPLv2.1 Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. >7KLV LV WKH ¿UVW UHOHDVHG YHUVLRQ RI WKH /HVVHU *3/ ,W DOVR FRXQWV DV WKH VXFFHVVRU RI WKH *18 /LEUDU\ 3XEOLF /LFHQVH version 2, hence the version number 2.1.] Preamble The licenses for most software are designed to take away your IUHHGRPWRVKDUHDQGFKDQJHLW%\FRQWUDVWWKH*18*HQHUDO 3XEOLF /LFHQVHV DUH LQWHQGHG WR JXDUDQWHH \RXU IUHHGRP WR share and change free software--to make sure the software is free for all its users. 7KLVOLFHQVHWKH/HVVHU*HQHUDO3XEOLF/LFHQVHDSSOLHVWRVRPH specially designated software packages--typically libraries--of the Free Software Foundation and other authors who decide WR XVH LW <RX FDQ XVH LW WRR EXW ZH VXJJHVW \RX ¿UVW WKLQN carefully about whether this license or the ordinary General 3XEOLF /LFHQVH LV WKH EHWWHU VWUDWHJ\ WR XVH LQ DQ\ SDUWLFXODU FDVHEDVHGRQWKHH[SODQDWLRQVEHORZ :KHQZHVSHDNRIIUHHVRIWZDUHZHDUHUHIHUULQJWRIUHHGRP RIXVHQRWSULFH2XU*HQHUDO3XEOLF/LFHQVHVDUHGHVLJQHGWR make sure that you have the freedom to distribute copies of IUHHVRIWZDUHDQGFKDUJHIRUWKLVVHUYLFHLI\RXZLVKWKDW\RX UHFHLYHVRXUFHFRGHRUFDQJHWLWLI\RXZDQWLWWKDW\RXFDQ FKDQJHWKHVRIWZDUHDQGXVHSLHFHVRILWLQQHZIUHHSURJUDPV and that you are informed that you can do these things. To protect your rights, we need to make restrictions that forbid distributors to deny you these rights or to ask you to surrender these rights. These restrictions translate to certain responsibilities for you if you distribute copies of the library or if you modify it. )RUH[DPSOHLI\RXGLVWULEXWHFRSLHVRIWKHOLEUDU\ZKHWKHU gratis or for a fee, you must give the recipients all the ULJKWVWKDWZHJDYH\RX<RXPXVWPDNHVXUHWKDWWKH\ WRRUHFHLYHRUFDQJHWWKHVRXUFHFRGH,I\RXOLQNRWKHU code with the library, you must provide complete object ¿OHVWRWKHUHFLSLHQWVVRWKDWWKH\FDQUHOLQNWKHPZLWKWKH library after making changes to the library and recompiling it. And you must show them these terms so they know their rights. :H SURWHFW \RXU ULJKWV ZLWK D WZRVWHS PHWKRG ZH copyright the library, and (2) we offer you this license, which gives you legal permission to copy, distribute and/or modify the library. To protect each distributor, we want to make it very clear that there is no warranty for the free library. Also, LIWKHOLEUDU\LVPRGL¿HGE\VRPHRQHHOVHDQGSDVVHGRQ the recipients should know that what they have is not the RULJLQDOYHUVLRQVRWKDWWKHRULJLQDODXWKRU VUHSXWDWLRQ will not be affected by problems that might be introduced by others. Finally, software patents pose a constant threat WRWKHH[LVWHQFHRIDQ\IUHHSURJUDP:HZLVKWRPDNH sure that a company cannot effectively restrict the users 29 English '$0$*(6,1&/8',1*$1<*(1(5$/63(&,$/,1&,'(17$/ 25 &216(48(17,$/ '$0$*(6 $5,6,1* 287 2) 7+( 86( 25 ,1$%,/,7< 72 86( 7+( 352*5$0 ,1&/8',1* %87 127/,0,7('72/2662)'$7$25'$7$%(,1*5(1'(5(' ,1$&&85$7( 25 /266(6 6867$,1(' %< <28 25 7+,5' 3$57,(625$)$,/85(2)7+(352*5$07223(5$7(:,7+ $1<27+(5352*5$06(9(1,)68&++2/'(52527+(5 3$57< +$6 %((1 $'9,6(' 2) 7+( 3266,%,/,7< 2) 68&+ '$0$*(6 English of a free program by obtaining a restrictive license from a patent holder. Therefore, we insist that any patent license obtained for a version of the library must be FRQVLVWHQWZLWKWKHIXOOIUHHGRPRIXVHVSHFL¿HG in this license. 0RVW*18VRIWZDUHLQFOXGLQJVRPHOLEUDULHVLV FRYHUHGE\WKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVH7KLVOLFHQVHWKH*18/HVVHU*HQHUDO3XEOLF /LFHQVHDSSOLHVWRFHUWDLQGHVLJQDWHGOLEUDULHVDQG is quite different from the ordinary General PubOLF/LFHQVH:HXVHWKLVOLFHQVHIRUFHUWDLQOLEUDULHV in order to permit linking those libraries into nonfree programs. :KHQDSURJUDPLVOLQNHGZLWKDOLEUDU\ZKHWKHU statically or using a shared library, the combination of the two is legally speaking a combined work, a derivative of the original library. The ordinary General Public /LFHQVHWKHUHIRUHSHUPLWVVXFKOLQNLQJRQO\LIWKH HQWLUHFRPELQDWLRQ¿WVLWVFULWHULDRIIUHHGRP7KH/HVVHU *HQHUDO3XEOLF/LFHQVHSHUPLWVPRUHOD[FULWHULDIRUOLQNLQJ RWKHUFRGHZLWKWKHOLEUDU\:HFDOOWKLVOLFHQVHWKH/HVVHU *HQHUDO3XEOLF/LFHQVHEHFDXVHLWGRHV/HVVWRSURWHFWWKH XVHU VIUHHGRPWKDQWKHRUGLQDU\*HQHUDO3XEOLF/LFHQVH ,WDOVRSURYLGHVRWKHUIUHHVRIWZDUHGHYHORSHUV/HVVRI an advantage over competing non-free programs. These disadvantages are the reason we use the ordinary General 3XEOLF/LFHQVHIRUPDQ\OLEUDULHV+RZHYHUWKH/HVVHUOLFHQVH provides advantages in certain special circumstances. For H[DPSOHRQUDUHRFFDVLRQVWKHUHPD\EHDVSHFLDOQHHG to encourage the widest possible use of a certain library, so that it becomes a de-facto standard. To achieve this, non-free programs must be allowed to use the library. A more frequent case is that a free library does the same MREDVZLGHO\XVHGQRQIUHHOLEUDULHV,QWKLVFDVHWKHUH is little to gain by limiting the free library to free software RQO\VRZHXVHWKH/HVVHU*HQHUDO3XEOLF/LFHQVH,QRWKHU cases, permission to use a particular library in non-free programs enables a greater number of people to use a large ERG\RIIUHHVRIWZDUH)RUH[DPSOHSHUPLVVLRQWRXVHWKH *18&/LEUDU\LQQRQIUHHSURJUDPVHQDEOHVPDQ\PRUH SHRSOHWRXVHWKHZKROH*18RSHUDWLQJV\VWHPDVZHOODV LWVYDULDQWWKH*18/LQX[RSHUDWLQJV\VWHP$OWKRXJKWKH /HVVHU*HQHUDO3XEOLF/LFHQVHLV/HVVSURWHFWLYHRIWKH XVHUV IUHHGRPLWGRHVHQVXUHWKDWWKHXVHURIDSURJUDP WKDWLVOLQNHGZLWKWKH/LEUDU\KDVWKHIUHHGRPDQGWKH ZKHUHZLWKDOWRUXQWKDWSURJUDPXVLQJDPRGL¿HGYHUVLRQ RIWKH/LEUDU\7KHSUHFLVHWHUPVDQGFRQGLWLRQVIRUFRS\LQJ GLVWULEXWLRQDQGPRGL¿FDWLRQIROORZ3D\FORVHDWWHQWLRQWR the difference between a "work based on the library" and a "work that uses the library". The former contains code derived from the library, whereas the latter must be combined with the library in order to run. *18/(66(5*(1(5$/38/,&/,&(16( 7(506$1'&21',7,216)25&23<,1*',675,%87,21 $1'02',),&$7,21 7KLV/LFHQVH$JUHHPHQWDSSOLHVWRDQ\VRIWZDUHOLEUDU\ or other program which contains a notice placed by the copyright holder or other authorized party saying it may be GLVWULEXWHGXQGHUWKHWHUPVRIWKLV/HVVHU*HQHUDO3XEOLF /LFHQVHDOVRFDOOHGWKLV/LFHQVH(DFKOLFHQVHHLVDGGUHVVHG as "you". A "library" means a collection of software functions and/or data prepared so as to be conveniently linked with application programs (which use some of those functions DQGGDWDWRIRUPH[HFXWDEOHV 7KH/LEUDU\EHORZUHIHUVWRDQ\VXFKVRIWZDUHOLEUDU\ or work which has been distributed under these terms. A ZRUNEDVHGRQWKH/LEUDU\PHDQVHLWKHUWKH/LEUDU\RUDQ\ GHULYDWLYHZRUNXQGHUFRS\ULJKWODZWKDWLVWRVD\DZRUN FRQWDLQLQJWKH/LEUDU\RUDSRUWLRQRILWHLWKHUYHUEDWLP RUZLWKPRGL¿FDWLRQVDQGRUWUDQVODWHGVWUDLJKWIRUZDUGO\ LQWRDQRWKHUODQJXDJH+HUHLQDIWHUWUDQVODWLRQLVLQFOXGHG 30 ZLWKRXWOLPLWDWLRQLQWKHWHUPPRGL¿FDWLRQ "Source code" for a work means the preferred form of the ZRUNIRUPDNLQJPRGL¿FDWLRQVWRLW)RUDOLEUDU\FRPSOHWH source code means all the source code for all modules it FRQWDLQVSOXVDQ\DVVRFLDWHGLQWHUIDFHGH¿QLWLRQ¿OHVSOXV the scripts used to control compilation and installation of the library. Activities other than copying, distribution and PRGL¿FDWLRQDUHQRWFRYHUHGE\WKLV/LFHQVHWKH\DUH outside its scope. The act of running a program using the /LEUDU\LVQRWUHVWULFWHGDQGRXWSXWIURPVXFKDSURJUDPLV covered only if its contents constitute a work based on the /LEUDU\LQGHSHQGHQWRIWKHXVHRIWKH/LEUDU\LQDWRROIRU ZULWLQJLW:KHWKHUWKDWLVWUXHGHSHQGVRQZKDWWKH/LEUDU\ GRHVDQGZKDWWKHSURJUDPWKDWXVHVWKH/LEUDU\GRHV <RXPD\FRS\DQGGLVWULEXWHYHUEDWLPFRSLHVRIWKH /LEUDU\ VFRPSOHWHVRXUFHFRGHDV\RXUHFHLYHLWLQDQ\ medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice DQGGLVFODLPHURIZDUUDQW\NHHSLQWDFWDOOWKHQRWLFHV WKDWUHIHUWRWKLV/LFHQVHDQGWRWKHDEVHQFHRIDQ\ ZDUUDQW\DQGGLVWULEXWHDFRS\RIWKLV/LFHQVHDORQJ ZLWKWKH/LEUDU\ <RXPD\FKDUJHDIHHIRUWKHSK\VLFDODFWRI transferring a copy, and you may at your option RIIHUZDUUDQW\SURWHFWLRQLQH[FKDQJHIRUDIHH <RXPD\PRGLI\\RXUFRS\RUFRSLHVRIWKH/LEUDU\RU DQ\SRUWLRQRILWWKXVIRUPLQJDZRUNEDVHGRQWKH/LEUDU\ DQGFRS\DQGGLVWULEXWHVXFKPRGL¿FDWLRQVRUZRUNXQGHUWKH terms of Section 1 above, provided that you also meet all of WKHVHFRQGLWLRQV D7KHPRGL¿HGZRUNPXVWLWVHOIEHDVRIWZDUH library. E<RXPXVWFDXVHWKH¿OHVPRGL¿HGWRFDUU\ prominent notices stating that you changed WKH¿OHVDQGWKHGDWHRIDQ\FKDQJH F<RXPXVWFDXVHWKHZKROHRIWKHZRUNWREHOLFHQVHGDW QRFKDUJHWRDOOWKLUGSDUWLHVXQGHUWKHWHUPVRIWKLV/LFHQVH G,IDIDFLOLW\LQWKHPRGL¿HG/LEUDU\UHIHUVWRDIXQFWLRQ or a table of data to be supplied by an application program that uses the facility, other than as an argument passed when the facility is invoked, then you must make a good faith effort to ensure that, in the event an application does not supply such function or table, the facility still operates, and performs whatever part of its purpose remains meaningful. )RUH[DPSOHDIXQFWLRQLQDOLEUDU\WRFRPSXWHVTXDUH URRWVKDVDSXUSRVHWKDWLVHQWLUHO\ZHOOGH¿QHGLQGHSHQGHQW of the application. Therefore, Subsection 2d requires that any application-supplied function or table used by this function PXVWEHRSWLRQDOLIWKHDSSOLFDWLRQGRHVQRWVXSSO\LWWKH square root function must still compute square roots.) These UHTXLUHPHQWVDSSO\WRWKHPRGL¿HGZRUNDVDZKROH,I LGHQWL¿DEOHVHFWLRQVRIWKDWZRUNDUHQRWGHULYHGIURPWKH /LEUDU\DQGFDQEHUHDVRQDEO\FRQVLGHUHGLQGHSHQGHQWDQG VHSDUDWHZRUNVLQWKHPVHOYHVWKHQWKLV/LFHQVHDQGLWV terms, do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the /LEUDU\WKHGLVWULEXWLRQRIWKHZKROHPXVWEHRQWKHWHUPVRI WKLV/LFHQVHZKRVHSHUPLVVLRQVIRURWKHUOLFHQVHHVH[WHQGWR the entire whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely E\\RXUDWKHUWKHLQWHQWLVWRH[HUFLVHWKHULJKWWRFRQWURO the distribution of derivative or collective works based on the /LEUDU\,QDGGLWLRQPHUHDJJUHJDWLRQRIDQRWKHUZRUNQRW EDVHGRQWKH/LEUDU\ZLWKWKH/LEUDU\RUZLWKDZRUNEDVHGRQ WKH/LEUDU\RQDYROXPHRIDVWRUDJHRUGLVWULEXWLRQPHGLXP GRHVQRWEULQJWKHRWKHUZRUNXQGHUWKHVFRSHRIWKLV/LFHQVH <RXPD\RSWWRDSSO\WKHWHUPVRIWKHRUGLQDU\*18 *HQHUDO3XEOLF/LFHQVHLQVWHDGRIWKLV/LFHQVHWRDJLYHQ FRS\RIWKH/LEUDU\7RGRWKLV\RXPXVWDOWHUDOOWKH QRWLFHVWKDWUHIHUWRWKLV/LFHQVHVRWKDWWKH\UHIHUWRWKH RUGLQDU\*18*HQHUDO3XEOLF/LFHQVHYHUVLRQLQVWHDG LQWKH/LEUDU\ZLOOQRWQHFHVVDULO\EHDEOHWRUHFRPSLOHWKH DSSOLFDWLRQWRXVHWKHPRGL¿HGGH¿QLWLRQVE8VH a suitable shared library mechanism for linking with the /LEUDU\$VXLWDEOHPHFKDQLVPLVRQHWKDWXVHVDWUXQ WLPHDFRS\RIWKHOLEUDU\DOUHDG\SUHVHQWRQWKHXVHU V computer system, rather than copying library functions into WKHH[HFXWDEOHDQGZLOORSHUDWHSURSHUO\ZLWKDPRGL¿HG version of the library, if the user installs one, as long as the PRGL¿HGYHUVLRQLVLQWHUIDFHFRPSDWLEOHZLWKWKHYHUVLRQ that the work was made with. c) Accompany the work with a written offer, valid for at least three years, to give the same XVHUWKHPDWHULDOVVSHFL¿HGLQ6XEVHFWLRQDDERYHIRUD charge no more than the cost of performing this distribution. G,IGLVWULEXWLRQRIWKHZRUNLVPDGHE\RIIHULQJDFFHVVWR copy from a designated place, offer equivalent access to copy WKHDERYHVSHFL¿HGPDWHULDOVIURPWKHVDPHSODFH e) Verify that the user has already received a copy of these materials or that you have already sent this user a FRS\)RUDQH[HFXWDEOHWKHUHTXLUHGIRUPRIWKHZRUN WKDWXVHVWKH/LEUDU\PXVWLQFOXGHDQ\GDWDDQGXWLOLW\ SURJUDPVQHHGHGIRUUHSURGXFLQJWKHH[HFXWDEOHIURP LW+RZHYHUDVDVSHFLDOH[FHSWLRQWKHPDWHULDOVWREH distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the RSHUDWLQJV\VWHPRQZKLFKWKHH[HFXWDEOHUXQVXQOHVV WKDWFRPSRQHQWLWVHOIDFFRPSDQLHVWKHH[HFXWDEOH ,WPD\KDSSHQWKDWWKLVUHTXLUHPHQWFRQWUDGLFWVWKH license restrictions of other proprietary libraries that do not normally accompany the operating system. Such a contradiction means you cannot use both them DQGWKH/LEUDU\WRJHWKHULQDQH[HFXWDEOHWKDW\RX distribute. <RXPD\SODFHOLEUDU\IDFLOLWLHVWKDWDUHDZRUNEDVHG RQWKH/LEUDU\VLGHE\VLGHLQDVLQJOHOLEUDU\WRJHWKHUZLWK RWKHUOLEUDU\IDFLOLWLHVQRWFRYHUHGE\WKLV/LFHQVHDQG distribute such a combined library, provided that the separate GLVWULEXWLRQRIWKHZRUNEDVHGRQWKH/LEUDU\DQGRIWKHRWKHU library facilities is otherwise permitted, and provided that you GRWKHVHWZRWKLQJV a) Accompany the combined library with a copy of the VDPHZRUNEDVHGRQWKH/LEUDU\XQFRPELQHGZLWKDQ\ other library facilities. This must be distributed under the terms of the Sections above. b) Give prominent notice with the combined library of the fact that part of it is a work based RQWKH/LEUDU\DQGH[SODLQLQJZKHUHWR¿QGWKH accompanying uncombined form of the same work. <RXPD\QRWFRS\PRGLI\VXEOLFHQVHOLQNZLWKRU GLVWULEXWHWKH/LEUDU\H[FHSWDVH[SUHVVO\SURYLGHGXQGHU WKLV/LFHQVH$Q\DWWHPSWRWKHUZLVHWRFRS\PRGLI\ VXEOLFHQVHOLQNZLWKRUGLVWULEXWHWKH/LEUDU\LVYRLGDQG ZLOODXWRPDWLFDOO\WHUPLQDWH\RXUULJKWVXQGHUWKLV/LFHQVH +RZHYHUSDUWLHVZKRKDYHUHFHLYHGFRSLHVRUULJKWVIURP \RXXQGHUWKLV/LFHQVHZLOOQRWKDYHWKHLUOLFHQVHVWHUPLQDWHG so long as such parties remain in full compliance. <RXDUHQRWUHTXLUHGWRDFFHSWWKLV/LFHQVHVLQFH \RXKDYHQRWVLJQHGLW+RZHYHUQRWKLQJHOVHJUDQWV \RXSHUPLVVLRQWRPRGLI\RUGLVWULEXWHWKH/LEUDU\RULWV derivative works. These actions are prohibited by law if \RXGRQRWDFFHSWWKLV/LFHQVH7KHUHIRUHE\PRGLI\LQJRU GLVWULEXWLQJWKH/LEUDU\RUDQ\ZRUNEDVHGRQWKH/LEUDU\ \RXLQGLFDWH\RXUDFFHSWDQFHRIWKLV/LFHQVHWRGRVRDQG all its terms and conditions for copying, distributing or PRGLI\LQJWKH/LEUDU\RUZRUNVEDVHGRQLW (DFKWLPH\RXUHGLVWULEXWHWKH/LEUDU\RUDQ\ZRUN EDVHGRQWKH/LEUDU\WKHUHFLSLHQWDXWRPDWLFDOO\UHFHLYHVD license from the original licensor to copy, distribute, link with RUPRGLI\WKH/LEUDU\VXEMHFWWRWKHVHWHUPVDQGFRQGLWLRQV <RXPD\QRWLPSRVHDQ\IXUWKHUUHVWULFWLRQVRQWKHUHFLSLHQWV H[HUFLVHRIWKHULJKWVJUDQWHGKHUHLQ<RXDUHQRWUHVSRQVLEOH IRUHQIRUFLQJFRPSOLDQFHE\WKLUGSDUWLHVZLWKWKLV/LFHQVH ,IDVDFRQVHTXHQFHRIDFRXUWMXGJPHQWRUDOOHJDWLRQ of patent infringement or for any other reason (not limited 31 English RIWRWKLV/LFHQVH,IDQHZHUYHUVLRQWKDQYHUVLRQRI WKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVHKDVDSSHDUHG then you can specify that version instead if you wish.) Do not make any other change in these notices. Once this change is made in a given copy, it is irreversible for that FRS\VRWKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVHDSSOLHVWR all subsequent copies and derivative works made from that copy. This option is useful when you wish to copy part of WKHFRGHRIWKH/LEUDU\LQWRDSURJUDPWKDWLVQRWDOLEUDU\ <RXPD\FRS\DQGGLVWULEXWHWKH/LEUDU\RUDSRUtion or derivative of it, under Section 2) in object code RUH[HFXWDEOHIRUPXQGHUWKHWHUPVRI6HFWLRQVDQG above provided that you accompany it with the complete corresponding machine-readable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange. ,IGLVWULEXWLRQRIREMHFWFRGHLVPDGHE\RIIHULQJ access to copy from a designated place, then offering equivalent access to copy the source code from the VDPHSODFHVDWLV¿HVWKHUHTXLUHPHQWWRGLVWULEXWHWKH source code, even though third parties are not compelled to copy the source along with the object code. 5. A program that contains no derivative of any portion of WKH/LEUDU\EXWLVGHVLJQHGWRZRUNZLWKWKH/LEUDU\E\EHLQJ compiled or linked with it, is called a "work that uses the /LEUDU\6XFKDZRUNLQLVRODWLRQLVQRWDGHULYDWLYHZRUN RIWKH/LEUDU\DQGWKHUHIRUHIDOOVRXWVLGHWKHVFRSHRIWKLV /LFHQVH+RZHYHUOLQNLQJDZRUNWKDWXVHVWKH/LEUDU\ ZLWKWKH/LEUDU\FUHDWHVDQH[HFXWDEOHWKDWLVDGHULYDWLYH RIWKH/LEUDU\EHFDXVHLWFRQWDLQVSRUWLRQVRIWKH/LEUDU\ UDWKHUWKDQDZRUNWKDWXVHVWKHOLEUDU\7KHH[HFXWDEOH LVWKHUHIRUHFRYHUHGE\WKLV/LFHQVH6HFWLRQVWDWHVWHUPV IRUGLVWULEXWLRQRIVXFKH[HFXWDEOHV:KHQDZRUNWKDW XVHVWKH/LEUDU\XVHVPDWHULDOIURPDKHDGHU¿OHWKDWLV SDUWRIWKH/LEUDU\WKHREMHFWFRGHIRUWKHZRUNPD\EHD GHULYDWLYHZRUNRIWKH/LEUDU\HYHQWKRXJKWKHVRXUFHFRGH LVQRW:KHWKHUWKLVLVWUXHLVHVSHFLDOO\VLJQL¿FDQWLIWKH ZRUNFDQEHOLQNHGZLWKRXWWKH/LEUDU\RULIWKHZRUNLVLWVHOI a library. The threshold for this to be true is not precisely GH¿QHGE\ODZ,IVXFKDQREMHFW¿OHXVHVRQO\QXPHULFDO parameters, data structure layouts and accessors, and small macros and small inline functions (ten lines or less in length), WKHQWKHXVHRIWKHREMHFW¿OHLVXQUHVWULFWHGUHJDUGOHVV RIZKHWKHULWLVOHJDOO\DGHULYDWLYHZRUN([HFXWDEOHV FRQWDLQLQJWKLVREMHFWFRGHSOXVSRUWLRQVRIWKH/LEUDU\ will still fall under Section 6.) Otherwise, if the work is a GHULYDWLYHRIWKH/LEUDU\\RXPD\GLVWULEXWHWKHREMHFWFRGH IRUWKHZRUNXQGHUWKHWHUPVRI6HFWLRQ$Q\H[HFXWDEOHV containing that work also fall under Section 6, whether RUQRWWKH\DUHOLQNHGGLUHFWO\ZLWKWKH/LEUDU\LWVHOI $VDQH[FHSWLRQWRWKH6HFWLRQVDERYH\RXPD\ DOVRFRPELQHRUOLQNDZRUNWKDWXVHVWKH/LEUDU\ZLWK WKH/LEUDU\WRSURGXFHDZRUNFRQWDLQLQJSRUWLRQVRIWKH /LEUDU\DQGGLVWULEXWHWKDWZRUNXQGHUWHUPVRI\RXU FKRLFHSURYLGHGWKDWWKHWHUPVSHUPLWPRGL¿FDWLRQ RIWKHZRUNIRUWKHFXVWRPHU VRZQXVHDQGUHYHUVH HQJLQHHULQJIRUGHEXJJLQJVXFKPRGL¿FDWLRQV <RXPXVWJLYHSURPLQHQWQRWLFHZLWKHDFKFRS\RIWKH ZRUNWKDWWKH/LEUDU\LVXVHGLQLWDQGWKDWWKH/LEUDU\DQG LWVXVHDUHFRYHUHGE\WKLV/LFHQVH<RXPXVWVXSSO\D FRS\RIWKLV/LFHQVH,IWKHZRUNGXULQJH[HFXWLRQGLVSOD\V copyright notices, you must include the copyright notice for WKH/LEUDU\DPRQJWKHPDVZHOODVDUHIHUHQFHGLUHFWLQJWKH XVHUWRWKHFRS\RIWKLV/LFHQVH$OVR\RXPXVWGRRQHRI WKHVHWKLQJVD$FFRPSDQ\WKHZRUNZLWKWKHFRPSOHWH FRUUHVSRQGLQJPDFKLQHUHDGDEOHVRXUFHFRGHIRUWKH/LEUDU\ including whatever changes were used in the work (which PXVWEHGLVWULEXWHGXQGHU6HFWLRQVDQGDERYHDQGLI WKHZRUNLVDQH[HFXWDEOHOLQNHGZLWKWKH/LEUDU\ZLWKWKH FRPSOHWHPDFKLQHUHDGDEOHZRUNWKDWXVHVWKH/LEUDU\ as object code and/or source code, so that the user can PRGLI\WKH/LEUDU\DQGWKHQUHOLQNWRSURGXFHDPRGL¿HG H[HFXWDEOHFRQWDLQLQJWKHPRGL¿HG/LEUDU\,WLVXQGHUVWRRG WKDWWKHXVHUZKRFKDQJHVWKHFRQWHQWVRIGH¿QLWLRQV¿OHV English to patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the FRQGLWLRQVRIWKLV/LFHQVHWKH\GRQRWH[FXVH\RXIURPWKH FRQGLWLRQVRIWKLV/LFHQVH,I\RXFDQQRWGLVWULEXWHVRDVWR VDWLVI\VLPXOWDQHRXVO\\RXUREOLJDWLRQVXQGHUWKLV/LFHQVHDQG any other pertinent obligations, then as a consequence you PD\QRWGLVWULEXWHWKH/LEUDU\DWDOO)RUH[DPSOHLIDSDWHQW license would not permit royalty-free redistribution of the /LEUDU\E\DOOWKRVHZKRUHFHLYHFRSLHVGLUHFWO\RULQGLUHFWO\ through you, then the only way you could satisfy both it and WKLV/LFHQVHZRXOGEHWRUHIUDLQHQWLUHO\IURPGLVWULEXWLRQ RIWKH/LEUDU\ ,IDQ\SRUWLRQRIWKLVVHFWLRQLVKHOGLQYDOLGRUXQHQIRUFHable under any particular circumstance, the balance of the section is intended to apply, and the section as a whole LVLQWHQGHGWRDSSO\LQRWKHUFLUFXPVWDQFHV,WLVQRWWKH purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any VXFKFODLPVWKLVVHFWLRQKDVWKHVROHSXUSRVHRISURWHFWLQJ the integrity of the free software distribution system which is LPSOHPHQWHGE\SXEOLFOLFHQVHSUDFWLFHV0DQ\SHRSOHKDYH made generous contributions to the wide range of software distributed through that system in reliance on consistent DSSOLFDWLRQRIWKDWV\VWHPLWLVXSWRWKHDXWKRUGRQRUWR decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is EHOLHYHGWREHDFRQVHTXHQFHRIWKHUHVWRIWKLV/LFHQVH ,IWKHGLVWULEXWLRQDQGRUXVHRIWKH/LEUDU\LVUHVWULFWHG in certain countries either by patents or by copyrighted interfaces, the original copyright holder who places the /LEUDU\XQGHUWKLV/LFHQVHPD\DGGDQH[SOLFLWJHRJUDSKLFDO GLVWULEXWLRQOLPLWDWLRQH[FOXGLQJWKRVHFRXQWULHVVRWKDW distribution is permitted only in or among countries not WKXVH[FOXGHG,QVXFKFDVHWKLV/LFHQVHLQFRUSRUDWHV WKHOLPLWDWLRQDVLIZULWWHQLQWKHERG\RIWKLV/LFHQVH 13. The Free Software Foundation may publish revised DQGRUQHZYHUVLRQVRIWKH/HVVHU*HQHUDO3XEOLF/LFHQVH from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns.Each version is given DGLVWLQJXLVKLQJYHUVLRQQXPEHU,IWKH/LEUDU\VSHFL¿HVD YHUVLRQQXPEHURIWKLV/LFHQVHZKLFKDSSOLHVWRLWDQGDQ\ later version", you have the option of following the terms and conditions either of that version or of any later version SXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQ,IWKH/LEUDU\ does not specify a license version number, you may choose any version ever published by the Free Software Foundation. ,I\RXZLVKWRLQFRUSRUDWHSDUWVRIWKH/LEUDU\LQWR other free programs whose distribution conditions are incompatible with these, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the Free Software )RXQGDWLRQZHVRPHWLPHVPDNHH[FHSWLRQVIRUWKLV2XU decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. 12:$55$17< %(&$86(7+(/,%5$5<,6/,&(16(')5((2)&+$5*( 7+(5(,612:$55$17<)257+(/,%5$5<727+((;7(17 3(50,77('%<$33/,&$%/(/$:(;&(37:+(127+(5:,6( 67$7(' ,1 :5,7,1* 7+( &23<5,*+7 +2/'(56 $1'25 27+(5 3$57,(6 3529,'( 7+( /,%5$5< $6 ,6 :,7+287 :$55$17< 2) $1< .,1' (,7+(5 (;35(66(' 25 ,03/,(' ,1&/8',1* %87 127 /,0,7(' 72 7+( ,03/,(' :$55$17,(6 2) 0(5&+$17$%,/,7< $1' ),71(66 )25 $ 3$57,&8/$5 385326( 7+( (17,5( 5,6. $6 72 7+( 48$/,7< $1' 3(5)250$1&(2)7+(/,%5$5<,6:,7+<286+28/'7+( /,%5$5<3529('()(&7,9(<28$6680( 7+( &267 2) $// 1(&(66$5< 6(59,&,1* 5(3$,5 25 &255(&7,21 ,112(9(1781/(665(48,5('%<$33/,&$%/(/$:25 32 $*5(('72,1:5,7,1*:,//$1<&23<5,*+7+2/'(525 $1<27+(53$57<:+20$<02',)<$1'255(',675,%87( 7+(/,%5$5<$63(50,77('$%29(%(/,$%/(72<28)25 '$0$*(6,1&/8',1*$1<*(1(5$/63(&,$/,1&,'(17$/ 25&216(48(17,$/'$0$*(6$5,6,1*2872)7+(86(25 ,1$%,/,7<7286(7+(/,%5$5<,1&/8',1*%87127/,0,7('72/2662)'$7$25'$7$%(,1*5(1'(5(',1$&&85$7(25/266(66867$,1('%<<28257+,5'3$57,(625 $)$,/85(2)7+(/,%5$5<7223(5$7(:,7+$1<27+(5 62)7:$5((9(1,) 68&+ +2/'(5 25 27+(5 3$57< +$6 %((1 $'9,6(' 2) 7+( 3266,%,/,7< 2) 68&+ '$0$*ES. (1'2)7(506$1'&21',7,216 +RZ WR $SSO\7KHVH7HUPVWR<RXU1HZ/LEUDULHV ,I \RX GHYHORS D QHZ OLEUDU\ DQG \RX ZDQW LW WR EH RI WKH greatest possible use to the public, we recommend making it IUHHVRIWZDUHWKDWHYHU\RQHFDQUHGLVWULEXWHDQGFKDQJH<RX can do so by permitting redistribution under these terms (or, alternatively, under the terms of the ordinary General PubOLF/LFHQVH7RDSSO\WKHVHWHUPVDWWDFKWKHIROORZLQJQRWLFHV WRWKHOLEUDU\,WLVVDIHVWWRDWWDFKWKHPWRWKHVWDUWRIHDFK VRXUFH¿OHWRPRVWHIIHFWLYHO\FRQYH\WKHH[FOXVLRQRIZDUUDQW\ DQG HDFK ¿OH VKRXOG KDYH DW OHDVW WKH FRS\ULJKW OLQH DQG D pointer to where the full notice is found. RQHOLQHWRJLYHWKHOLEUDU\ VQDPHDQGDEULHILGHDRIZKDW LWGRHV! &RS\ULJKW&\HDU!QDPHRIDXWKRU! 7KLVOLEUDU\LVIUHHVRIWZDUH\RXFDQUHGLVWULEXWHLWDQGRU PRGLI\LWXQGHUWKHWHUPVRIWKH*18/HVVHU*HQHUDO3XEOLF/LFHQVHDVSXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQHLWKHUYHUVLRQRIWKH/LFHQVHRUDW\RXURSWLRQDQ\ODWHUYHUVLRQ This library is distributed in the hope that it will be useful, EXW:,7+287$1<:$55$17<ZLWKRXWHYHQWKHLPSOLHGZDUUDQW\ RI 0(5&+$17$%,/,7< RU ),71(66 )25 $ 3$57,&8/$5 385326(6HHWKH*18/HVVHU*HQHUDO3XEOLF/LFHQVHIRUPRUH GHWDLOV <RX VKRXOG KDYH UHFHLYHG D FRS\ RI WKH *18 /HVVHU *HQHUDO3XEOLF/LFHQVHDORQJZLWKWKLVOLEUDU\LIQRWZULWHWRWKH )UHH6RIWZDUH)RXQGDWLRQ,QF)UDQNOLQ6WUHHW)LIWK)ORRU %RVWRQ0$86$$OVRDGGLQIRUPDWLRQRQKRZWR FRQWDFW\RXE\HOHFWURQLFDQGSDSHUPDLO<RXVKRXOGDOVRJHW your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the library, if necessary. +HUH LV D VDPSOH DOWHU WKH QDPHV <R\RG\QH ,QF KHUHE\ GLVFODLPVDOOFRS\ULJKWLQWHUHVWLQWKHOLEUDU\C)URE DOLEUDU\IRU WZHDNLQJNQREVZULWWHQE\-DPHV5DQGRP+DFNHU VLJQDWXUHRI7\&RRQ!$SULO 7\ &RRQ 3UHVLGHQW RI 9LFH7KDW VDOOWKHUHLVWRLW ICU License - ICU 1.8.1 and later &23<5,*+7$1'3(50,66,21127,&( &RS\ULJKWF,QWHUQDWLRQDO%XVLQHVV0DFKLQHV&RUporation and others All rights reserved. Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation ¿OHV WKH 6RIWZDUH WR GHDO LQ WKH 6RIWZDUH ZLWKRXW UHVWULFtion, including without limitation the rights to use, copy, modify, merge, publish, distribute, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, provided that the above copyright notice(s) and this permission notice appear in all copies of the Software and that both the above copyright notice(s) and this permission notice appear in supporting documentation. 7+(62)7:$5(,63529,'('$6,6:,7+287:$55$17< 2) $1< .,1' (;35(66 25 ,03/,(' ,1&/8',1* %87 127 /,0,7(' 72 7+( :$55$17,(6 2) 0(5&+$17$%,/,7< ),71(66)25$3$57,&8/$5385326($1'121,1)5,1*(0(17 2) 7+,5' 3$57< 5,*+76 ,1 12 (9(17 6+$// 7+( &23<5,*+7 +2/'(5 25 +2/'(56 ,1&/8'(' ,1 7+,6 127,&( %( /,$%/( )25 $1< &/$,0 25 $1< 63(&,$/ ,1',5(&7 25 ([FHSW DV FRQWDLQHG LQ WKLV QRWLFH WKH QDPH RI D FRS\ULJKW holder shall not be used in advertising or otherwise to promote the sale, use or other dealings in this Software without prior written authorization of the copyright holder. All trademarks and registered trademarks mentioned herein are the property of their respective owners. LICENSE ISSUES /,&(16(,668(6 ============== 7KH2SHQ66/WRRONLWVWD\VXQGHUDGXDOOLFHQVHLHERWKWKH conditions of WKH 2SHQ66/ /LFHQVH DQG WKH RULJLQDO 66/HD\ OLFHQVH DSSO\ to the toolkit. 6HHEHORZIRUWKHDFWXDOOLFHQVHWH[WV$FWXDOO\ERWKOLFHQVHV are BSD-style 2SHQ 6RXUFH OLFHQVHV ,Q FDVH RI DQ\ OLFHQVH LVVXHV UHODWHG WR2SHQ66/ SOHDVHFRQWDFWRSHQVVOFRUH#RSHQVVORUJ 2SHQ66//LFHQVH --------------/* ==================================== ================================ &RS\ULJKW F 7KH 2SHQ66/ 3URMHFW $OO ULJKWV reserved. * * Redistribution and use in source and binary forms, with or without PRGL¿FDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQditions DUHPHW * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. All advertising materials mentioning features or use of this VRIWZDUHPXVWGLVSOD\WKHIROORZLQJDFNQRZOHGJPHQW 7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH2SHQ66/ Project IRU XVH LQ WKH 2SHQ66/ 7RRONLW KWWSZZZRSHQVVO org/)" * 7KHQDPHV2SHQ66/7RRONLWDQG2SHQ66/3URMHFWPXVW not be used to * endorse or promote products derived from this software without * prior written permission. For written permission, please contact RSHQVVOFRUH#RSHQVVORUJ * * 5. Products derived from this software may not be called 2SHQ66/ QRUPD\2SHQ66/DSSHDULQWKHLUQDPHVZLWKRXWSULRU written SHUPLVVLRQRIWKH2SHQ66/3URMHFW * * 6. Redistributions of any form whatsoever must retain the following DFNQRZOHGJPHQW 7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH2SHQ66/ Project IRUXVHLQWKH2SHQ66/7RRONLWKWWSZZZRSHQVVORUJ * 7+,662)7:$5(,63529,'('%<7+(2SHQ66/352-(&7 CC$6,6 $1'$1< (;35(66(' 25 ,03/,(' :$55$17,(6 ,1&/8',1* %87 127/,0,7('727+( ,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66 )25$3$57,&8/$5 385326( $5( ',6&/$,0(' ,1 12 (9(17 6+$// 7+( 2SHQ66/352-(&725 ,76&2175,%87256%(/,$%/()25$1<',5(&7,1',5(&7 ,1&,'(17$/ 63(&,$/(;(03/$5<25&216(48(17,$/'$0$*(6,1&/8',1*%87 127/,0,7('72352&85(0(172)68%67,787(*22'6 256(59,&(6 /266 2) 86( '$7$ 25 352),76 25 %86,1(66 ,17(55837,21 +2:(9(5 &$86(' $1' 21 $1< 7+(25< 2) /,$%,/,7< :+(7+(5,1&2175$&7 675,&7/,$%,/,7<257257,1&/8',1*1(*/,*(1&(25 27+(5:,6( $5,6,1* ,1 $1< :$< 287 2) 7+( 86( 2) 7+,6 62)7:$5((9(1,)$'9,6(' 2)7+(3266,%,/,7<2)68&+'$0$*( * ==================================== ================================ * * This product includes cryptographic software written by Eric <RXQJ HD\#FU\SWVRIWFRP7KLVSURGXFWLQFOXGHVVRIWZDUHZULWten by Tim +XGVRQWMK#FU\SWVRIWFRP * */ 2ULJLQDO66/HD\/LFHQVH ----------------------&RS\ULJKW&(ULF<RXQJHD\#FU\SWVRIWFRP * All rights reserved. * 7KLVSDFNDJHLVDQ66/LPSOHPHQWDWLRQZULWWHQ E\(ULF<RXQJHD\#FU\SWVRIWFRP * The implementation was written so as to conform with 1HWVFDSHV66/ * * This library is free for commercial and non-commercial use as long as * the following conditions are adhered to. The following conditions * apply to all code found in this distribution, be it the RC4, RSA, OKDVK'(6HWFFRGHQRWMXVWWKH66/FRGH7KH66/GRFXmentation * included with this distribution is covered by the same copyright terms H[FHSWWKDWWKHKROGHULV7LP+XGVRQWMK#FU\SWVRIWFRP * &RS\ULJKWUHPDLQV(ULF<RXQJ VDQGDVVXFKDQ\&RS\ULJKW notices in * the code are not to be removed. ,IWKLVSDFNDJHLVXVHGLQDSURGXFW(ULF<RXQJVKRXOGEH given attribution * as the author of the parts of the library used. 7KLV FDQ EH LQ WKH IRUP RI D WH[WXDO PHVVDJH DW SURJUDP startup or LQGRFXPHQWDWLRQRQOLQHRUWH[WXDOSURYLGHGZLWKWKHSDFN- 33 English &216(48(17,$/'$0$*(625$1<'$0$*(6:+$762(9(5 5(68/7,1*)520/2662)86('$7$25352),76:+(7+(5 ,1$1$&7,212)&2175$&71(*/,*(1&(2527+(57257,286$&7,21$5,6,1*2872)25,1&211(&7,21:,7+ 7+(86(253(5)250$1&(2)7+,662)7:$5( English age. * * Redistribution and use in source and binary forms, with or without PRGL¿FDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQditions DUHPHW * 1. Redistributions of source code must retain the copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. All advertising materials mentioning features or use of this software PXVWGLVSOD\WKHIROORZLQJDFNQRZOHGJHPHQW * "This product includes cryptographic software written by (ULF<RXQJHD\#FU\SWVRIWFRP 7KH ZRUG FU\SWRJUDSKLF FDQ EH OHIW RXW LI WKH URXWLQHV from the library EHLQJXVHGDUHQRWFU\SWRJUDSKLFUHODWHG ,I\RXLQFOXGHDQ\:LQGRZVVSHFL¿FFRGHRUDGHULYDWLYH thereof) from * the apps directory (application code) you must include an DFNQRZOHGJHPHQW 7KLV SURGXFW LQFOXGHV VRIWZDUH ZULWWHQ E\ 7LP +XGVRQ WMK#FU\SWVRIWFRP * 7+,6 62)7:$5( ,6 3529,'(' %< (5,& <281* CC$6 ,6 $1' $1<(;35(6625,03/,(':$55$17,(6,1&/8',1*%87 127/,0,7('727+( ,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66 )25$3$57,&8/$5385326( $5(',6&/$,0(',112(9(176+$//7+($87+2525 &2175,%87256%(/,$%/( )25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/(;(03/$5<25&216(48(17,$/ '$0$*(6,1&/8',1*%87127/,0,7('72352&85(0(172)68%67,787(*22'6 256(59,&(6/2662)86('$7$25352),7625%86,1(66,17(55837,21 +2:(9(5 &$86(' $1' 21 $1< 7+(25< 2) /,$%,/,7< :+(7+(5,1&2175$&7675,&7 /,$%,/,7<257257,1&/8',1*1(*/,*(1&(2527+(5:,6($5,6,1*,1$1<:$< 2872)7+(86(2)7+,662)7:$5((9(1,)$'9,6('2) 7+(3266,%,/,7<2) 68&+'$0$*( * * The licence and distribution terms for any publically available version or * derivative of this code cannot be changed. i.e. this code cannot simply be * copied and put under another distribution licence >LQFOXGLQJWKH*183XEOLF/LFHQFH@ */ zlib ]OLEKLQWHUIDFHRIWKH ]OLE JHQHUDOSXUSRVHFRPSUHVVLRQ library YHUVLRQ-XO\WK &RS\ULJKW&-HDQORXS*DLOO\DQG0DUN$GOHU 7KLV VRIWZDUH LV SURYLGHG DVLV ZLWKRXW DQ\ H[SUHVV RU LPSOLHGZDUUDQW\,QQRHYHQWZLOOWKHDXWKRUVEHKHOGOLDEOHIRU any damages arising from the use of this software. Permission is granted to anyone to use this software for any 34 purpose, including commercial applications, and to alter it and UHGLVWULEXWHLWIUHHO\VXEMHFWWRWKHIROORZLQJUHVWULFWLRQV 7KHRULJLQRIWKLVVRIWZDUHPXVWQRWEHPLVUHSUHVHQWHG\RX PXVWQRWFODLPWKDW\RXZURWHWKHRULJLQDOVRIWZDUH,I\RXXVH this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. -HDQORXS*DLOO\MORXS#J]LSRUJ 0DUN$GOHUPDGOHU#DOXPQLFDOWHFKHGX */ The FreeType Project LICENSE -DQ &RS\ULJKW E\ 'DYLG 7XUQHU 5REHUW :LOKHOP DQG:HUQHU/HPEHUJ ,QWURGXFWLRQ ============ The FreeType Project is distributed in several archive packDJHV some of them may contain, in addition to the FreeType font engine,various tools and contributions which rely on, or relate to, the FreeType Project. 7KLV OLFHQVH DSSOLHV WR DOO ¿OHV IRXQG LQ VXFK SDFNDJHV DQG ZKLFK GR QRW IDOO XQGHU WKHLU RZQ H[SOLFLW OLFHQVH 7KH license affects thus the FreeType font engine, the test SURJUDPVGRFXPHQWDWLRQDQGPDNH¿OHVDWWKHYHU\OHDVW 7KLVOLFHQVHZDVLQVSLUHGE\WKH%6'$UWLVWLFDQG,-* ,QGHSHQGHQW-3(**URXSOLFHQVHVZKLFKDOOHQFRXUDJHLQFOXsion and use of free software in commercial and freeware SURGXFWVDOLNH$VDFRQVHTXHQFHLWVPDLQSRLQWVDUHWKDW :HGRQ WSURPLVHWKDWWKLVVRIWZDUHZRUNV+RZHYHUZHZLOO EHLQWHUHVWHGLQDQ\NLQGRIEXJUHSRUWVCDVLV GLVWULEXWLRQ <RXFDQXVHWKLVVRIWZDUHIRUZKDWHYHU\RXZDQWLQSDUWVRU IXOOIRUPZLWKRXWKDYLQJWRSD\XVCUR\DOW\IUHH XVDJH <RXPD\QRWSUHWHQGWKDW\RXZURWHWKLVVRIWZDUH,I\RX use it, or only parts of it, in a program, you must acknowledge somewhere in your documentation that you have used the )UHH7\SHFRGHCFUHGLWV :HVSHFL¿FDOO\SHUPLWDQGHQFRXUDJHWKHLQFOXVLRQRIWKLV VRIWZDUHZLWKRUZLWKRXWPRGL¿FDWLRQVLQFRPPHUFLDOSURGXFWV:HGLVFODLPDOOZDUUDQWLHVFRYHULQJ7KH)UHH7\SH3URMect and assume no liability related to The FreeType Project. Finally, many people asked us for a preferred form for DFUHGLWGLVFODLPHUWRXVHLQFRPSOLDQFHZLWKWKLVOLFHQVH:H WKXVHQFRXUDJH\RXWRXVHWKHIROORZLQJWH[W """ 3RUWLRQVRIWKLVVRIWZDUHDUHFRS\ULJKW\HDU!7KH)UHH7\SH Project (www.freetype.org). All rights reserved. """ 3OHDVH UHSODFH \HDU! ZLWK WKH YDOXH IURP WKH )UHH7\SH version you actually use. /HJDO7HUPV =========== 'H¿QLWLRQV C<RX UHIHUV WR WKH OLFHQVHH RU SHUVRQ XVLQJ WKH SURMHFW ZKHUHCXVLQJ LVDJHQHULFWHUPLQFOXGLQJFRPSLOLQJWKHSURMHFW V VRXUFH FRGH DV ZHOO DV OLQNLQJ LW WR IRUP D CSURJUDP RU CH[HFXWDEOH This program is referred to as `a program using the )UHH7\SHHQJLQH 7KLVOLFHQVHDSSOLHVWRDOO¿OHVGLVWULEXWHGLQWKHRULJLQDO FreeType Project, including all source code, binaries and GRFXPHQWDWLRQXQOHVVRWKHUZLVHVWDWHGLQWKH¿OHLQLWV RULJLQDOXQPRGL¿HGIRUPDVGLVWULEXWHGLQWKHRULJLQDODUFKLYH ,I\RXDUHXQVXUHZKHWKHURUQRWDSDUWLFXODU¿OHLVFRYHUHG by this license, you must contact us to verify this. The FreeType Project is copyright (C) 1996-2000 by David Turner, 5REHUW :LOKHOP DQG :HUQHU /HPEHUJ $OO ULJKWV UHVHUYHG H[FHSWDV VSHFL¿HGEHORZ 1R:DUUDQW\ 7+( )5((7<3( 352-(&7 ,6 3529,'(' C$6 ,6 :,7+287 :$55$17<2)$1< .,1'(,7+(5(;35(6625,03/,(',1&/8',1*%87127 /,0,7('72 :$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25 $3$57,&8/$5 385326( ,1 12 (9(17 :,// $1< 2) 7+( $87+256 25 &23<5,*+7+2/'(56 %( /,$%/( )25 $1< '$0$*(6 &$86(' %< 7+( 86( 25 7+(,1$%,/,7<72 86(2)7+()5((7<3(352-(&7 2. Redistribution This license grants a worldwide, royalty-free, perpetual DQG LUUHYRFDEOH ULJKW DQG OLFHQVH WR XVH H[HFXWH SHUIRUP compile,display, copy, create derivative works of, distribute and sublicense the FreeType Project (in both source and object FRGHIRUPVDQGGHULYDWLYHZRUNVWKHUHRIIRUDQ\SXUSRVH DQGWRDXWKRUL]HRWKHUVWRH[HUFLVHVRPHRUDOORIWKHULJKWV JUDQWHGKHUHLQVXEMHFWWRWKHIROORZLQJFRQGLWLRQV Redistribution of source code must retain this license ¿OH C)7/7;7 XQDOWHUHG DQ\ DGGLWLRQV GHOHWLRQV RU FKDQJHV WR WKH RULJLQDO ¿OHV PXVW EH FOHDUO\ LQGLFDWHG LQ accompanying documentation. The copyright notices of the XQDOWHUHGRULJLQDO ¿OHV PXVW EH SUHVHUYHG LQ DOO FRSLHV RI VRXUFH¿OHV Redistribution in binary form must provide a disclaimer that states that the software is based in part of the work of the )UHH7\SH7HDPLQWKHGLVWULEXWLRQGRFXPHQWDWLRQ:HDOVR HQFRXUDJH\RXWRSXWDQ85/WRWKH)UHH7\SHZHESDJHLQ\RXU GRFXPHQWDWLRQWKRXJKWKLVLVQ WPDQGDWRU\ These conditions apply to any software derived from or EDVHGRQWKH)UHH7\SH3URMHFWQRWMXVWWKHXQPRGL¿HG¿OHV ,I\RXXVHRXUZRUN\RXPXVWDFNQRZOHGJHXV+RZHYHUQR fee need be paid to us. 3. Advertising 1HLWKHUWKH)UHH7\SHDXWKRUVDQGFRQWULEXWRUVQRU\RXVKDOO use the name of the other for commercial, advertising, or SURPRWLRQDOSXUSRVHVZLWKRXWVSHFL¿FSULRUZULWWHQSHUPLVVLRQ more of the following phrases to refer to this software in \RXU GRFXPHQWDWLRQ RU DGYHUWLVLQJ PDWHULDOV C)UHH7\SH 3URMHFW C)UHH7\SH (QJLQH C)UHH7\SH OLEUDU\ RU C)UHH7\SH 'LVWULEXWLRQ As you have not signed this license, you are not required to DFFHSWLW+RZHYHUDVWKH)UHH7\SH3URMHFWLVFRS\ULJKWHG material, only this license, or another one contracted with the authors, grants you the right to use, distribute, and modify it. Therefore, by using, distributing, or modifying the FreeType Project, you indicate that you understand and accept all the terms of this license. 4. Contacts 7KHUHDUHWZRPDLOLQJOLVWVUHODWHGWR)UHH7\SH IUHHW\SH#QRQJQXRUJ Discusses general use and applications of FreeType, as well as future and wanted additions to the library and distribution. ,I\RXDUHORRNLQJIRUVXSSRUWVWDUWLQWKLVOLVWLI\RX KDYHQ WIRXQGDQ\WKLQJWRKHOS\RXLQWKHGRFXPHQWDWLRQ IUHHW\SHGHYHO#QRQJQXRUJ Discusses bugs, as well as engine internals, LVVXHVVSHFL¿FOLFHQVHVSRUWLQJHWF design Our home page can be found at KWWSZZZIUHHW\SHRUJ ([SDW Copyright (c) 1998, 1999, 2000 Thai Open Source Software &HQWHU/WGDQG&ODUN&RRSHU &RS\ULJKW F ([SDW maintainers. Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation ¿OHVWKH6RIWZDUHWRGHDOLQWKH6RIWZDUHZLWKRXWUHVWULFWLRQ including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is IXUQLVKHGWRGRVRVXEMHFWWRWKHIROORZLQJFRQGLWLRQV The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software. 7+(62)7:$5(,63529,'('$6,6:,7+287:$55$17< 2)$1<.,1' (;35(6625,03/,(',1&/8',1*%87127/,0,7('727+( :$55$17,(62) 0(5&+$17$%,/,7< ),71(66 )25 $ 3$57,&8/$5 385326( $1'121,1)5,1*(0(17 ,112(9(176+$//7+($87+25625&23<5,*+7+2/'(56 %(/,$%/()25$1< &/$,0 '$0$*(6 25 27+(5 /,$%,/,7< :+(7+(5 ,1 $1 $&7,212)&2175$&7 7257 25 27+(5:,6( $5,6,1* )520 287 2) 25 ,1 &211(&7,21:,7+7+( 62)7:$5( 25 7+( 86( 25 27+(5 '($/,1*6 ,1 7+( 62)7:$5( Curl &23<5,*+7$1'3(50,66,21127,&( &RS\ULJKW F 'DQLHO 6WHQEHUJ GDQLHO#KD[[ VH! :H VXJJHVW EXW GR QRW UHTXLUH WKDW \RX XVH RQH RU 35 English 7KURXJKRXWWKLVOLFHQVHWKHWHUPVCSDFNDJH C)UHH7\SH3URMHFW DQGC)UHH7\SHDUFKLYH UHIHUWRWKHVHWRI¿OHVRULJLQDOO\ GLVWULEXWHG E\ WKH DXWKRUV 'DYLG 7XUQHU 5REHUW :LOKHOP DQG:HUQHU/HPEHUJDVWKHC)UHH7\SH3URMHFW EHWKH\QDPHG DVDOSKDEHWDRU¿QDOUHOHDVH All rights reserved. English Permission to use, copy, modify, and distribute this software for any purpose with or without fee is hereby granted, provided that the above copyright notice and this permission notice appear in all copies. 7+(62)7:$5(,63529,'('$6,6:,7+287:$55$17< 2)$1<.,1'(;35(6625 ,03/,(' ,1&/8',1* %87 127 /,0,7(' 72 7+( :$55$17,(62)0(5&+$17$%,/,7< ),71(66 )25 $ 3$57,&8/$5 385326( $1' 121,1)5,1*(0(172)7+,5'3$57<5,*+76,1 12(9(176+$//7+($87+25625&23<5,*+7+2/'(56%( /,$%/()25$1<&/$,0 '$0$*(62527+(5/,$%,/,7<:+(7+(5,1$1$&7,212) &2175$&7725725 27+(5:,6( $5,6,1* )520 287 2) 25 ,1 &211(&7,21 :,7+7+(62)7:$5(257+(86(2527+(5'($/,1*6,1 7+(62)7:$5( ([FHSW DV FRQWDLQHG LQ WKLV QRWLFH WKH QDPH RI D FRS\ULJKW holder shall not be used in advertising or otherwise to promote the sale, use or other dealings in this Software without prior written authorization of the copyright holder. IJG :HGRQ WSURPLVHWKDWWKLVVRIWZDUHZRUNV%XWLI\RX¿QG DQ\EXJVSOHDVHOHWXVNQRZ <RXFDQXVHWKLVVRIWZDUHIRUZKDWHYHU\RXZDQW<RXGRQ W have to pay us. <RXPD\QRWSUHWHQGWKDW\RXZURWHWKLVVRIWZDUH,I\RX use it in a program, you must acknowledge somewhere in your GRFXPHQWDWLRQWKDW\RX YHXVHGWKH,-*FRGH ,QOHJDOHVH 7KH DXWKRUV PDNH 12 :$55$17< RU UHSUHVHQWDWLRQ HLWKHU H[SUHVV RU LPSOLHGZLWK UHVSHFW WR WKLV VRIWZDUH LWV TXDOLW\ DFFXUDF\ PHUFKDQWDELOLW\ RU ¿WQHVV IRU D SDUWLFXODU SXUSRVH 7KLVVRIWZDUHLVSURYLGHG$6,6DQG\RXLWVXVHUDVVXPHWKH entire risk as to its quality and accuracy. 7KLVVRIWZDUHLVFRS\ULJKW&7KRPDV*/DQH $OO5LJKWV5HVHUYHGH[FHSWDVVSHFL¿HGEHORZ Permission is hereby granted to use, copy, modify, and distribute this software (or portions thereof) for any purpose, without fee, VXEMHFWWRWKHVHFRQGLWLRQV ,IDQ\SDUWRIWKHVRXUFHFRGHIRUWKLVVRIWZDUHLVGLVWULEXWHG WKHQWKLV5($'0(¿OHPXVWEHLQFOXGHGZLWKWKLVFRS\ULJKWDQG QRZDUUDQW\ QRWLFH XQDOWHUHG DQG DQ\ DGGLWLRQV GHOHWLRQV RU FKDQJHV WR WKH RULJLQDO ¿OHV PXVW EH FOHDUO\ LQGLFDWHG LQ accompanying documentation. ,IRQO\H[HFXWDEOHFRGHLVGLVWULEXWHGWKHQWKHDFFRPSDQ\LQJ documentation must state that "this software is based in part RQWKHZRUNRIWKH,QGHSHQGHQW-3(**URXS (3) Permission for use of this software is granted only if the user DFFHSWV IXOO UHVSRQVLELOLW\ IRU DQ\ XQGHVLUDEOH FRQVHTXHQFHV WKHDXWKRUVDFFHSW12/,$%,/,7<IRUGDPDJHVRIDQ\NLQG These conditions apply to any software derived from or based RQWKH,-*FRGHQRWMXVWWRWKHXQPRGL¿HGOLEUDU\,I\RXXVH our work, you ought to acknowledge us. 3HUPLVVLRQLV127JUDQWHGIRUWKHXVHRIDQ\,-*DXWKRU VQDPH or company name in advertising or publicity relating to this software or products derived from it. This software may be UHIHUUHGWRRQO\DVWKH,QGHSHQGHQW-3(**URXS V software". :HVSHFL¿FDOO\SHUPLWDQGHQFRXUDJHWKHXVHRIWKLVVRIWZDUH 36 as the basis of commercial products, provided that all warranty or liability claims are assumed by the product vendor. DQVLNQUF LV LQFOXGHG LQ WKLV GLVWULEXWLRQ E\ SHUPLVVLRQ RI / Peter Deutsch, sole proprietor of its copyright holder, Aladdin (QWHUSULVHV RI 0HQOR 3DUN &$ DQVLNQUF LV 127 FRYHUHG by the above copyright and conditions, but instead by the XVXDO GLVWULEXWLRQ WHUPV RI WKH )UHH 6RIWZDUH )RXQGDWLRQ principally,that you must include source code if you redistribute LW 6HH WKH ¿OH DQVLNQUF IRU IXOO GHWDLOV +RZHYHU VLQFH ansi2knr.c is not needed as part of any program generated IURP WKH ,-* FRGH WKLV GRHV QRW OLPLW \RX PRUH WKDQ WKH foregoing paragraphs do. 7KH 8QL[ FRQ¿JXUDWLRQ VFULSW FRQ¿JXUH ZDV SURGXFHG ZLWK *18$XWRFRQI ,W LV FRS\ULJKW E\ WKH )UHH 6RIWZDUH )RXQGDWLRQ EXW LV IUHHO\ distributable. 7KHVDPHKROGVIRULWVVXSSRUWLQJVFULSWVFRQ¿JJXHVVFRQ¿J VXEOWFRQ¿J OWPDLQVK $QRWKHU VXSSRUW VFULSW LQVWDOOVK LV copyright E\0,7EXWLVDOVRIUHHO\GLVWULEXWDEOH ,WDSSHDUVWKDWWKHDULWKPHWLFFRGLQJRSWLRQRIWKH-3(*VSHFLV FRYHUHGE\SDWHQWVRZQHGE\,%0$77DQG0LWVXELVKL+HQFH arithmetic coding cannot legally be used without obtaining one or more licenses. For this reason,support for arithmetic coding KDVEHHQUHPRYHGIURPWKHIUHH-3(*VRIWZDUH (Since arithmetic coding provides only a marginal gain over WKH XQSDWHQWHG +XIIPDQ PRGH LW LV XQOLNHO\ WKDW YHU\ PDQ\ implementations will support it.) So far as we are aware, there are no patent restrictions on the remaining code. 7KH,-*GLVWULEXWLRQIRUPHUO\LQFOXGHGFRGHWRUHDGDQGZULWH *,)¿OHV 7R DYRLG HQWDQJOHPHQW ZLWK WKH 8QLV\V /=: SDWHQW *,) reading support has EHHQUHPRYHGDOWRJHWKHUDQGWKH*,)ZULWHUKDVEHHQVLPSOL¿HG WRSURGXFHXQFRPSUHVVHG*,)V7KLVWHFKQLTXHGRHVQRWXVH WKH/=:DOJRULWKPWKHUHVXOWLQJ*,)¿OHVDUHODUJHUWKDQXVXDO EXWDUHUHDGDEOHE\DOOVWDQGDUG*,)GHFRGHUV :H DUH UHTXLUHG WR VWDWH WKDW 7KH *UDSKLFV ,QWHUFKDQJH Format(c) is the Copyright property of CompuServe ,QFRUSRUDWHG *,)VP LV D 6HUYLFH 0DUN SURSHUW\ RI &RPSX6HUYH,QFRUSRUDWHG CharisSIL OFL 6,/23(1)217/,&(16(9HUVLRQ)HEUXDU\ 35($0%/( 7KH JRDOV RI WKH 2SHQ )RQW /LFHQVH 2)/ DUH WR VWLPXODWH worldwide development of collaborative font projects, to support the font creation efforts of academic and linguistic communities, and to provide a free and open framework in which fonts may be shared and improved in partnership with others. 7KH 2)/ DOORZV WKH OLFHQVHG IRQWV WR EH XVHG VWXGLHG PRGL¿HGDQGUHGLVWULEXWHGIUHHO\DVORQJDVWKH\DUHQRWVROG by themselves. The fonts, including any derivative works, can be bundled, embedded, redistributed and/or sold with any software provided that any reserved names are not used by derivative works. The fonts and derivatives,however, cannot be released under any other type of license. The requirement for fonts to remain under this license does not apply to any document created using the fonts or their derivatives. '(),1,7,216 )RQW6RIWZDUHUHIHUVWRWKHVHWRI¿OHVUHOHDVHGE\WKH&RS\ULJKW 5HVHUYHG)RQW1DPHUHIHUVWRDQ\QDPHVVSHFL¿HGDVVXFKDIWHU the copyright statement(s). Original Version refers to the collection of Font Software compoQHQWVDVGLVWULEXWHGE\WKH&RS\ULJKW+ROGHUV 0RGL¿HG 9HUVLRQ UHIHUV WR DQ\ GHULYDWLYH PDGH E\ DGGLQJ WR deleting,or substituting -- in part or in whole -- any of the components of the Original Version, by changing formats or by porting the Font Software to a new environment. Author refers to any designer, engineer, programmer, technical writer or other person who contributed to the Font Software. 3(50,66,21&21',7,216 Permission is hereby granted, free of charge, to any person obtaining a copy of the Font Software, to use, study, copy, PHUJH HPEHG PRGLI\ UHGLVWULEXWH DQG VHOO PRGL¿HG DQG XQPRGL¿HGFRSLHVRIWKH)RQW6RIWZDUHVXEMHFWWRWKHIROORZLQJ FRQGLWLRQV 1HLWKHU WKH )RQW 6RIWZDUH QRU DQ\ RI LWV LQGLYLGXDO FRPSRQHQWVLQ 2ULJLQDO RU 0RGL¿HG 9HUVLRQV PD\ EH VROG E\ itself. 2ULJLQDO RU 0RGL¿HG 9HUVLRQV RI WKH )RQW 6RIWZDUH PD\ EH bundled,redistributed and/or sold with any software, provided that each copy contains the above copyright notice and this OLFHQVH 7KHVH FDQ EH LQFOXGHG HLWKHU DV VWDQGDORQH WH[W ¿OHVKXPDQUHDGDEOHKHDGHUVRULQWKHDSSURSULDWHPDFKLQH UHDGDEOHPHWDGDWD¿HOGVZLWKLQWH[WRUELQDU\¿OHVDVORQJDV WKRVH¿HOGVFDQEHHDVLO\YLHZHGE\WKHXVHU 1R 0RGL¿HG 9HUVLRQ RI WKH )RQW 6RIWZDUH PD\ XVH WKH 5HVHUYHG )RQW 1DPHV XQOHVV H[SOLFLW ZULWWHQ SHUPLVVLRQ LV JUDQWHGE\WKHFRUUHVSRQGLQJ&RS\ULJKW+ROGHU7KLVUHVWULFWLRQ only applies to the primary font name as presented to the users. 7KH QDPHV RI WKH &RS\ULJKW +ROGHUV RU WKH $XWKRUV of the Font Software shall not be used to promote, endorse RUDGYHUWLVHDQ\0RGL¿HG9HUVLRQH[FHSWWRDFNQRZOHGJHWKH FRQWULEXWLRQVRIWKH&RS\ULJKW+ROGHUVDQGWKH$XWKRUVRU ZLWKWKHLUH[SOLFLWZULWWHQSHUPLVVLRQ 7KH )RQW 6RIWZDUH PRGL¿HG RU XQPRGL¿HG LQ SDUW RU LQ whole,must be distributed entirely under this license, and must not be distributed under any other license. The requirement for fonts to remain under this license does not apply to any document created using the Font Software. 7(50,1$7,21 This license becomes null and void if any of the above conditions are not met. ',6&/$,0(5 7+( )217 62)7:$5( ,6 3529,'(' $6 ,6 :,7+287 :$55$17< 2) $1< .,1'(;35(66 25 ,03/,(' ,1&/8',1* %87 127 /,0,7(' 72 $1< :$55$17,(6 2) 0(5&+$17$%,/,7< ),71(66 )25 $ 3$57,&8/$5 385326( $1' 121,1)5,1*(0(17 2) &23<5,*+7 3$7(17 75$'(0$5. 25 27+(5 5,*+7 ,1 12 (9(17 6+$// 7+( &23<5,*+7 +2/'(5 %( /,$%/( )25 $1< &/$,0 '$0$*(6 25 27+(5 /,$%,/,7<,1&/8',1* $1< *(1(5$/ 63(&,$/ ,1',5(&7,1&,'(17$/25&216(48(17,$/ '$0$*(6:+(7+(5,1$1$&7,212)&2175$&7725725 27+(5:,6($5,6,1*)5202872)7+(86(25,1$%,/,7< 7286(7+()21762)7:$5(25)52027+(5'($/,1*6,1 7+()21762)7:$5( &RS\ULJKWE\WKH0DVVDFKXVHWWV,QVWLWXWHRI7HFKQRORJ\ Permission to use, copy, modify, and distribute this software and its documentation for any purpose and without fee is hereby granted, provided that the above copyright notice appear in all copies and that both that copyright notice and this permission notice appear in VXSSRUWLQJGRFXPHQWDWLRQDQGWKDWWKHQDPHRI0,7QRWEH used in advertising or publicity pertaining to distribution of the VRIWZDUHZLWKRXWVSHFL¿FZULWWHQSULRUSHUPLVVLRQ 0,7 PDNHV QR UHSUHVHQWDWLRQV DERXW WKH VXLWDELOLW\ RI WKLV VRIWZDUHIRUDQ\SXUSRVH,WLVSURYLGHGDVLVZLWKRXWH[SUHVV or implied warranty. JFFH[FHSWLRQ *&& 5817,0( /,%5$5< (;&(37,21 9HUVLRQ 0DUFK &RS\ULJKW & )UHH 6RIWZDUH )RXQGDWLRQ ,QF KWWSIVIRUJ!(YHU\RQHLVSHUPLWWHGWRFRS\DQGGLVWULEXWH verbatim copies of this license document, but changing it is not DOORZHG 7KLV *&& 5XQWLPH /LEUDU\ ([FHSWLRQ ([FHSWLRQ LV DQ DGGLWLRQDO SHUPLVVLRQ XQGHU VHFWLRQ RI WKH *18 *HQHUDO 3XEOLF /LFHQVH YHUVLRQ *3/Y ,W DSSOLHV WR D JLYHQ ¿OH WKH 5XQWLPH /LEUDU\ WKDW EHDUV D QRWLFH SODFHG E\ WKH FRS\ULJKWKROGHURIWKH¿OHVWDWLQJWKDWWKH¿OHLVJRYHUQHGE\ *3/YDORQJZLWKWKLV([FHSWLRQ :KHQ\RXXVH*&&WRFRPSLOHDSURJUDP*&&PD\FRPELQH SRUWLRQVRIFHUWDLQ*&& KHDGHU ¿OHV DQG UXQWLPH OLEUDULHV ZLWK WKHFRPSLOHGSURJUDP7KHSXUSRVHRIWKLV([FHSWLRQLVWRDOORZ FRPSLODWLRQRIQRQ*3/LQFOXGLQJSURSULHWDU\SURJUDPVWRXVH LQ WKLV ZD\ WKH KHDGHU ¿OHV DQG UXQWLPH OLEUDULHV FRYHUHG E\ WKLV([FHSWLRQ'H¿QLWLRQV$¿OHLVDQ,QGHSHQGHQW0RGXOH LI LW HLWKHU UHTXLUHV WKH 5XQWLPH /LEUDU\ IRU H[HFXWLRQ DIWHU D Compilation Process, or makes use of an interface provided E\ WKH 5XQWLPH /LEUDU\ EXW LV QRW RWKHUZLVH EDVHG RQ WKH 5XQWLPH/LEUDU\*&&PHDQVDYHUVLRQRIWKH*18&RPSLOHU &ROOHFWLRQZLWKRUZLWKRXWPRGL¿FDWLRQVJRYHUQHGE\YHUVLRQ RU D VSHFL¿HG ODWHU YHUVLRQ RI WKH *18 *HQHUDO 3XEOLF /LFHQVH*3/ZLWKWKHRSWLRQRIXVLQJDQ\VXEVHTXHQWYHUVLRQV SXEOLVKHG E\ WKH )6) *3/FRPSDWLEOH 6RIWZDUH LV VRIWZDUH ZKRVHFRQGLWLRQVRISURSDJDWLRQPRGL¿FDWLRQDQGXVHZRXOG permit combination with GCC in accord with the license of GCC. "Target Code" refers to output from any compiler for a real RU YLUWXDOWDUJHW SURFHVVRU DUFKLWHFWXUH LQ H[HFXWDEOH IRUP RU VXLWDEOHIRULQSXWWRDQDVVHPEOHUORDGHUOLQNHUDQGRUH[HFXWLRQ SKDVH 1RWZLWKVWDQGLQJ WKDW 7DUJHW &RGH GRHV QRW LQFOXGH data in any format that is used as a compiler intermediate representation, or used for producing a compiler intermediate representation. The "Compilation Process" transforms code entirely represented in non-intermediate languages designed IRU KXPDQZULWWHQ FRGH DQGRU LQ -DYD 9LUWXDO 0DFKLQH E\WH FRGHLQWR7DUJHW&RGH7KXVIRUH[DPSOHXVHRIVRXUFHFRGH generators and preprocessors need not be considered part of the Compilation Process, since the Compilation Process can be understood as starting with the output of the generators or preprocessors. A Compilation Process is "Eligible" if it is done XVLQJ*&&DORQHRUZLWKRWKHU*3/FRPSDWLEOHVRIWZDUHRULI LWLVGRQHZLWKRXWXVLQJDQ\ZRUNEDVHGRQ*&&)RUH[DPSOH XVLQJ QRQ*3/FRPSDWLEOH 6RIWZDUH WR RSWLPL]H DQ\ *&& intermediate representations would not qualify as an Eligible Compilation Process. *UDQW RI $GGLWLRQDO 3HUPLVVLRQ <RX KDYH SHUPLVVLRQ WR propagate a work of Target Code formed by combining WKH 5XQWLPH /LEUDU\ ZLWK ,QGHSHQGHQW 0RGXOHV HYHQ LI such propagation would otherwise violate the terms of *3/Y SURYLGHG WKDW DOO 7DUJHW &RGH ZDV JHQHUDWHG E\ (OLJLEOH &RPSLODWLRQ 3URFHVVHV <RX PD\ WKHQ FRQYH\ VXFK D combination under terms of your choice, consistent with the OLFHQVLQJRIWKH,QGHSHQGHQW0RGXOHV 1R:HDNHQLQJRI*&&&RS\OHIW 7KHDYDLODELOLW\RIWKLV([FHSWLRQGRHVQRWLPSO\DQ\JHQHUDO presumption that third-party software is unaffected by the copyleft requirements of the license of GCC. c-ares 37 English +ROGHUV XQGHU WKLV OLFHQVH DQG FOHDUO\ PDUNHG DV VXFK 7KLV PD\LQFOXGHVRXUFH¿OHVEXLOGVFULSWVDQGGRFXPHQWDWLRQ GPLv2 *18*(1(5$/38%/,&/,&(16( 9HUVLRQ-XQH 1991 English &RS\ULJKW&)UHH6RIWZDUH)RXQGDWLRQ,QF )UDQNOLQ6WUHHW)LIWK)ORRU%RVWRQ0$86$ Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble The licenses for most software are designed to take away \RXU IUHHGRP WR VKDUH DQG FKDQJH LW %\ FRQWUDVW WKH *18 *HQHUDO3XEOLF/LFHQVHLVLQWHQGHGWRJXDUDQWHH\RXUIUHHGRP to share and change free software--to make sure the software LVIUHHIRUDOOLWVXVHUV7KLV*HQHUDO3XEOLF/LFHQVHDSSOLHVWR PRVW RI WKH )UHH 6RIWZDUH )RXQGDWLRQ V VRIWZDUH DQG WR DQ\ other program whose authors commit to using it. (Some other )UHH 6RIWZDUH )RXQGDWLRQ VRIWZDUH LV FRYHUHG E\ WKH *18 /HVVHU *HQHUDO 3XEOLF /LFHQVH LQVWHDG <RX FDQ DSSO\ LW WR your programs, too. :KHQZHVSHDNRIIUHHVRIWZDUHZHDUHUHIHUULQJWRIUHHGRP QRWSULFH2XU*HQHUDO3XEOLF/LFHQVHVDUHGHVLJQHGWRPDNH sure that you have the freedom to distribute copies of free software (and charge for this service if you wish), that you receive source code or can get it if you want it, that you can FKDQJHWKHVRIWZDUHRUXVHSLHFHVRILWLQQHZIUHHSURJUDPV and that you know you can do these things. To protect your rights, we need to make restrictions that forbid anyone to deny you these rights or to ask you to surrender the rights. These restrictions translate to certain responsibilities for you if you distribute copies of the software, or if you modify it. )RU H[DPSOH LI \RX GLVWULEXWH FRSLHV RI VXFK D SURJUDP whether gratis or for a fee, you must give the recipients all WKHULJKWVWKDW\RXKDYH<RXPXVWPDNHVXUHWKDWWKH\WRR receive or can get the source code. And you must show them these terms so they know their rights. :H SURWHFW \RXU ULJKWV ZLWK WZR VWHSV FRS\ULJKW WKH software, and (2) offer you this license which gives you legal permission to copy, distribute and/or modify the software. $OVRIRUHDFKDXWKRU VSURWHFWLRQDQGRXUVZHZDQWWRPDNH certain that everyone understands that there is no warranty for WKLVIUHHVRIWZDUH,IWKHVRIWZDUHLVPRGL¿HGE\VRPHRQHHOVH and passed on, we want its recipients to know that what they have is not the original, so that any problems introduced by RWKHUVZLOOQRWUHÀHFWRQWKHRULJLQDODXWKRUV UHSXWDWLRQV Finally, any free program is threatened constantly by software SDWHQWV:HZLVKWRDYRLGWKHGDQJHUWKDWUHGLVWULEXWRUVRID free program will individually obtain patent licenses, in effect making the program proprietary. To prevent this, we have PDGHLWFOHDUWKDWDQ\SDWHQWPXVWEHOLFHQVHGIRUHYHU\RQH V free use or not licensed at all. The precise terms and conditions for copying, distribution and PRGL¿FDWLRQIROORZ *18*(1(5$/38%/,&/,&(16( 7(506 $1' &21',7,216 )25 &23<,1* ',675,%87,21 $1'02',),&$7,21 7KLV/LFHQVHDSSOLHVWRDQ\SURJUDPRURWKHUZRUNZKLFK contains a notice placed by the copyright holder saying it may EHGLVWULEXWHGXQGHUWKHWHUPVRIWKLV*HQHUDO3XEOLF/LFHQVH The "Program", below, refers to any such program or work, and a "work based on the Program" means either the Program RU DQ\ GHULYDWLYH ZRUN XQGHU FRS\ULJKW ODZ WKDW LV WR VD\ D work containing the Program or a portion of it, either verbatim RUZLWKPRGL¿FDWLRQVDQGRUWUDQVODWHGLQWRDQRWKHUODQJXDJH +HUHLQDIWHU WUDQVODWLRQ LV LQFOXGHG ZLWKRXW OLPLWDWLRQ LQ WKH WHUPPRGL¿FDWLRQ(DFKOLFHQVHHLVDGGUHVVHGDV\RX $FWLYLWLHVRWKHUWKDQFRS\LQJGLVWULEXWLRQDQGPRGL¿FDWLRQDUH QRWFRYHUHGE\WKLV/LFHQVHWKH\DUHRXWVLGHLWVVFRSH7KHDFW of running the Program is not restricted, and the output from the Program is covered only if its contents constitute a work based on the Program (independent of having been made by UXQQLQJWKH3URJUDP:KHWKHUWKDWLVWUXHGHSHQGVRQZKDW the Program does. <RXPD\FRS\DQGGLVWULEXWHYHUEDWLPFRSLHVRIWKH3URJUDP V source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy DQ DSSURSULDWH FRS\ULJKW QRWLFH DQG GLVFODLPHU RI ZDUUDQW\ NHHSLQWDFWDOOWKHQRWLFHVWKDWUHIHUWRWKLV/LFHQVHDQGWRWKH DEVHQFHRIDQ\ZDUUDQW\DQGJLYHDQ\RWKHUUHFLSLHQWVRIWKH 3URJUDPDFRS\RIWKLV/LFHQVHDORQJZLWKWKH3URJUDP <RX PD\ FKDUJH D IHH IRU WKH SK\VLFDO DFW RI WUDQVIHUULQJ D copy, and you may at your option offer warranty protection in H[FKDQJHIRUDIHH <RX PD\ PRGLI\ \RXU FRS\ RU FRSLHV RI WKH 3URJUDP RU any portion of it, thus forming a work based on the Program, DQGFRS\DQGGLVWULEXWHVXFKPRGL¿FDWLRQVRUZRUNXQGHUWKH terms of Section 1 above, provided that you also meet all of WKHVHFRQGLWLRQV D <RX PXVW FDXVH WKH PRGL¿HG ¿OHV WR FDUU\ SURPLQHQW QRWLFHVVWDWLQJWKDW\RXFKDQJHGWKH¿OHVDQGWKHGDWHRIDQ\ change. E<RXPXVWFDXVHDQ\ZRUNWKDW\RXGLVWULEXWHRUSXEOLVK that in whole or in part contains or is derived from the Program or any part thereof, to be licensed as a whole at no charge to DOOWKLUGSDUWLHVXQGHUWKHWHUPVRIWKLV/LFHQVH F ,I WKH PRGL¿HG SURJUDP QRUPDOO\ UHDGV FRPPDQGV interactively when run, you must cause it, when started running for such interactive use in the most ordinary way, to print or display an announcement including an appropriate copyright notice and a notice that there is no warranty (or else, saying that you provide a warranty) and that users may redistribute the program under these conditions, and telling the user how to YLHZDFRS\RIWKLV/LFHQVH([FHSWLRQLIWKH3URJUDPLWVHOILV interactive but does not normally print such an announcement, your work based on the Program is not required to print an announcement.) 7KHVHUHTXLUHPHQWVDSSO\WRWKHPRGL¿HGZRUNDVDZKROH,I LGHQWL¿DEOH VHFWLRQV RI WKDW ZRUN DUH QRW GHULYHG IURP WKH Program, and can be reasonably considered independent and VHSDUDWHZRUNVLQWKHPVHOYHVWKHQWKLV/LFHQVHDQGLWVWHUPV do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the Program, the distribution of the whole must be on the terms of this /LFHQVH ZKRVH SHUPLVVLRQV IRU RWKHU OLFHQVHHV H[WHQG WR WKH entire whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest \RXUULJKWVWRZRUNZULWWHQHQWLUHO\E\\RXUDWKHUWKHLQWHQWLV WRH[HUFLVHWKHULJKWWRFRQWUROWKHGLVWULEXWLRQRIGHULYDWLYHRU collective works based on the Program. ,Q DGGLWLRQ PHUH DJJUHJDWLRQ RI DQRWKHU ZRUN QRW EDVHG RQ the Program with the Program (or with a work based on the Program) on a volume of a storage or distribution medium does QRWEULQJWKHRWKHUZRUNXQGHUWKHVFRSHRIWKLV/LFHQVH <RXPD\FRS\DQGGLVWULEXWHWKH3URJUDPRUDZRUNEDVHG RQLWXQGHU6HFWLRQLQREMHFWFRGHRUH[HFXWDEOHIRUPXQGHU the terms of Sections 1 and 2 above provided that you also do RQHRIWKHIROORZLQJ a) Accompany it with the complete corresponding machine- 38 Program by all those who receive copies directly or indirectly through you, then the only way you could satisfy both it and WKLV /LFHQVH ZRXOG EH WR UHIUDLQ HQWLUHO\ IURP GLVWULEXWLRQ RI the Program. b) Accompany it with a written offer, valid for at least three years, to give any third party, for a charge no more than your cost of physically performing source distribution, a complete machine-readable copy of the corresponding source code, to be distributed under the terms of Sections 1 and 2 above on a PHGLXPFXVWRPDULO\XVHGIRUVRIWZDUHLQWHUFKDQJHRU ,I DQ\ SRUWLRQ RI WKLV VHFWLRQ LV KHOG LQYDOLG RU XQHQIRUFHDEOH under any particular circumstance, the balance of the section is intended to apply and the section as a whole is intended to apply in other circumstances. ,WLVQRWWKHSXUSRVHRIWKLVVHFWLRQWRLQGXFH\RXWRLQIULQJHDQ\ patents or other property right claims or to contest validity of DQ\VXFKFODLPVWKLVVHFWLRQKDVWKHVROHSXUSRVHRISURWHFWLQJ the integrity of the free software distribution system, which is LPSOHPHQWHG E\ SXEOLF OLFHQVH SUDFWLFHV 0DQ\ SHRSOH KDYH made generous contributions to the wide range of software distributed through that system in reliance on consistent DSSOLFDWLRQ RI WKDW V\VWHP LW LV XS WR WKH DXWKRUGRQRU WR decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. c) Accompany it with the information you received as to the offer to distribute corresponding source code. (This alternative is allowed only for noncommercial distribution and only if you UHFHLYHGWKHSURJUDPLQREMHFWFRGHRUH[HFXWDEOHIRUPZLWK such an offer, in accord with Subsection b above.) The source code for a work means the preferred form of the ZRUNIRUPDNLQJPRGL¿FDWLRQVWRLW)RUDQH[HFXWDEOHZRUN complete source code means all the source code for all modules LW FRQWDLQV SOXV DQ\ DVVRFLDWHG LQWHUIDFH GH¿QLWLRQ ¿OHV SOXV the scripts used to control compilation and installation of WKH H[HFXWDEOH +RZHYHU DV D VSHFLDO H[FHSWLRQ WKH VRXUFH code distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the operating V\VWHPRQZKLFKWKHH[HFXWDEOHUXQVXQOHVVWKDWFRPSRQHQW LWVHOIDFFRPSDQLHVWKHH[HFXWDEOH ,IGLVWULEXWLRQRIH[HFXWDEOHRUREMHFWFRGHLVPDGHE\RIIHULQJ access to copy from a designated place, then offering equivalent access to copy the source code from the same place counts as distribution of the source code, even though third parties are not compelled to copy the source along with the object code. <RX PD\ QRW FRS\ PRGLI\ VXEOLFHQVH RU GLVWULEXWH WKH 3URJUDPH[FHSWDVH[SUHVVO\SURYLGHGXQGHUWKLV/LFHQVH$Q\ attempt otherwise to copy, modify, sublicense or distribute the Program is void, and will automatically terminate your ULJKWVXQGHUWKLV/LFHQVH+RZHYHUSDUWLHVZKRKDYHUHFHLYHG FRSLHV RU ULJKWV IURP \RX XQGHU WKLV /LFHQVH ZLOO QRW KDYH their licenses terminated so long as such parties remain in full compliance. <RXDUHQRWUHTXLUHGWRDFFHSWWKLV/LFHQVHVLQFH\RXKDYH QRWVLJQHGLW+RZHYHUQRWKLQJHOVHJUDQWV\RXSHUPLVVLRQWR modify or distribute the Program or its derivative works. These DFWLRQVDUHSURKLELWHGE\ODZLI\RXGRQRWDFFHSWWKLV/LFHQVH Therefore, by modifying or distributing the Program (or any work based on the Program), you indicate your acceptance RI WKLV /LFHQVH WR GR VR DQG DOO LWV WHUPV DQG FRQGLWLRQV IRU copying, distributing or modifying the Program or works based on it. 6. Each time you redistribute the Program (or any work based on the Program), the recipient automatically receives a license from the original licensor to copy, distribute or modify the 3URJUDPVXEMHFWWRWKHVHWHUPVDQGFRQGLWLRQV<RXPD\QRW LPSRVH DQ\ IXUWKHU UHVWULFWLRQV RQ WKH UHFLSLHQWV H[HUFLVH RI the rights granted herein. <RX DUH QRW UHVSRQVLEOH IRU HQIRUFLQJ FRPSOLDQFH E\ WKLUG parties to WKLV/LFHQVH ,I DV D FRQVHTXHQFH RI D FRXUW MXGJPHQW RU DOOHJDWLRQ of patent infringement or for any other reason (not limited to patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the FRQGLWLRQV RI WKLV /LFHQVH WKH\ GR QRW H[FXVH \RX IURP WKH FRQGLWLRQV RI WKLV /LFHQVH ,I \RX FDQQRW GLVWULEXWH VR DV WR VDWLVI\VLPXOWDQHRXVO\\RXUREOLJDWLRQVXQGHUWKLV/LFHQVHDQG any other pertinent obligations, then as a consequence you PD\QRWGLVWULEXWHWKH3URJUDPDWDOO)RUH[DPSOHLIDSDWHQW license would not permit royalty-free redistribution of the This section is intended to make thoroughly clear what is EHOLHYHGWREHDFRQVHTXHQFHRIWKHUHVWRIWKLV/LFHQVH ,IWKHGLVWULEXWLRQDQGRUXVHRIWKH3URJUDPLVUHVWULFWHGLQ certain countries either by patents or by copyrighted interfaces, the original copyright holder who places the Program under this /LFHQVHPD\DGGDQH[SOLFLWJHRJUDSKLFDOGLVWULEXWLRQOLPLWDWLRQ H[FOXGLQJWKRVHFRXQWULHVVRWKDWGLVWULEXWLRQLVSHUPLWWHGRQO\ LQ RU DPRQJ FRXQWULHV QRW WKXV H[FOXGHG ,Q VXFK FDVH WKLV /LFHQVHLQFRUSRUDWHVWKHOLPLWDWLRQDVLIZULWWHQLQWKHERG\RI WKLV/LFHQVH 9. The Free Software Foundation may publish revised and/ RU QHZ YHUVLRQV RI WKH *HQHUDO 3XEOLF /LFHQVH IURP WLPH WR time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. (DFKYHUVLRQLVJLYHQDGLVWLQJXLVKLQJYHUVLRQQXPEHU,IWKH 3URJUDP VSHFL¿HV D YHUVLRQ QXPEHU RI WKLV /LFHQVH ZKLFK applies to it and "any later version", you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation. ,I WKH 3URJUDP GRHV QRW VSHFLI\ D YHUVLRQ QXPEHU RI WKLV /LFHQVH \RX PD\ FKRRVH DQ\ YHUVLRQ HYHU SXEOLVKHG E\ WKH Free Software Foundation. ,I\RXZLVKWRLQFRUSRUDWHSDUWVRIWKH3URJUDPLQWRRWKHU free programs whose distribution conditions are different, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the )UHH6RIWZDUH)RXQGDWLRQZHVRPHWLPHVPDNHH[FHSWLRQVIRU this. Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. 12:$55$17< %(&$86(7+(352*5$0,6/,&(16(')5((2)&+$5*( 7+(5( ,6 12 :$55$17< )25 7+( 352*5$0 72 7+( (;7(17 3(50,77(' %< $33/,&$%/( /$: (;&(37 :+(1 27+(5:,6(67$7(',1:5,7,1*7+(&23<5,*+7+2/'(56 $1'25 27+(5 3$57,(6 3529,'( 7+( 352*5$0 $6 ,6 :,7+287:$55$17<2)$1<.,1'(,7+(5(;35(66('25 ,03/,(' ,1&/8',1* %87 127 /,0,7(' 72 7+( ,03/,(' :$55$17,(6 2) 0(5&+$17$%,/,7< $1' ),71(66 )25 $ 3$57,&8/$5 385326( 7+( (17,5( 5,6. $6 72 7+( 48$/,7< $1' 3(5)250$1&( 2) 7+( 352*5$0 ,6 :,7+ <286+28/'7+( 352*5$03529('()(&7,9(<28$6680(7+(&2672)$// 1(&(66$5<6(59,&,1*5(3$,525&255(&7,21 ,112(9(1781/(665(48,5('%<$33/,&$%/(/$:25 39 English readable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software LQWHUFKDQJHRU English $*5(('72,1:5,7,1*:,//$1<&23<5,*+7+2/'(525 $1<27+(53$57<:+20$<02',)<$1'255(',675,%87( 7+(352*5$0$63(50,77('$%29(%(/,$%/(72<28)25 '$0$*(6,1&/8',1*$1<*(1(5$/63(&,$/,1&,'(17$/ 25 &216(48(17,$/ '$0$*(6 $5,6,1* 287 2) 7+( 86( 25 ,1$%,/,7< 72 86( 7+( 352*5$0 ,1&/8',1* %87 127/,0,7('72/2662)'$7$25'$7$%(,1*5(1'(5(' ,1$&&85$7( 25 /266(6 6867$,1(' %< <28 25 7+,5' 3$57,(625$)$,/85(2)7+(352*5$07223(5$7(:,7+ $1<27+(5352*5$06(9(1,)68&++2/'(52527+(5 3$57< +$6 %((1 $'9,6(' 2) 7+( 3266,%,/,7< 2) 68&+ '$0$*(6 (1'2)7(506$1'&21',7,216 +RZWR$SSO\7KHVH7HUPVWR<RXU1HZ3URJUDPV ,I\RXGHYHORSDQHZSURJUDPDQG\RXZDQWLWWREHRIWKH greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. 7RGRVRDWWDFKWKHIROORZLQJQRWLFHVWRWKHSURJUDP,WLV VDIHVWWRDWWDFKWKHPWRWKHVWDUWRIHDFKVRXUFH¿OHWRPRVW HIIHFWLYHO\ FRQYH\ WKH H[FOXVLRQ RI ZDUUDQW\ DQG HDFK ¿OH should have at least the "copyright" line and a pointer to where the full notice is found. RQHOLQHWRJLYHWKHSURJUDP VQDPHDQGDEULHILGHDRI ZKDWLWGRHV! &RS\ULJKW&\HDU!QDPHRIDXWKRU! 7KLVSURJUDPLVIUHHVRIWZDUH\RXFDQUHGLVWULEXWHLWDQGRU PRGLI\LWXQGHUWKHWHUPVRIWKH*18*HQHUDO3XEOLF/LFHQVHDV SXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQHLWKHUYHUVLRQRI WKH/LFHQVHRUDW\RXURSWLRQDQ\ODWHUYHUVLRQ This program is distributed in the hope that it will be useful, EXW :,7+287 $1< :$55$17< ZLWKRXW HYHQ WKH LPSOLHG ZDUUDQW\RI0(5&+$17$%,/,7<RU),71(66)25$3$57,&8/$5 385326( 6HH WKH *18 *HQHUDO 3XEOLF /LFHQVH IRU PRUH details. <RXVKRXOGKDYHUHFHLYHGDFRS\RIWKH*18*HQHUDO3XEOLF /LFHQVH DORQJ ZLWK WKLV SURJUDP LI QRW ZULWH WR WKH )UHH 6RIWZDUH)RXQGDWLRQ,QF )UDQNOLQ6WUHHW)LIWK)ORRU%RVWRQ0$86$ Also add information on how to contact you by electronic and paper mail. ,IWKHSURJUDPLVLQWHUDFWLYHPDNHLWRXWSXWDVKRUWQRWLFHOLNH this ZKHQLWVWDUWVLQDQLQWHUDFWLYHPRGH Gnomovision version 69, Copyright (C) year name of author *QRPRYLVLRQFRPHVZLWK$%62/87(/<12:$55$17<IRU GHWDLOVW\SHCVKRZZ This is free software, and you are welcome to redistribute it XQGHUFHUWDLQFRQGLWLRQVW\SHCVKRZF IRUGHWDLOV 7KH K\SRWKHWLFDO FRPPDQGV CVKRZ Z DQG CVKRZ F VKRXOG VKRZWKHDSSURSULDWHSDUWVRIWKH*HQHUDO3XEOLF/LFHQVH2I course, the commands you use may be called something other WKDQCVKRZZ DQGCVKRZF WKH\FRXOGHYHQEHPRXVHFOLFNV or menu items--whatever suits your program. <RXVKRXOGDOVRJHW\RXUHPSOR\HULI\RXZRUNDVDSURJUDPPHU or your school, if any, to sign a "copyright disclaimer" for the SURJUDPLIQHFHVVDU\+HUHLVDVDPSOHDOWHUWKHQDPHV <R\RG\QH,QFKHUHE\GLVFODLPVDOOFRS\ULJKWLQWHUHVWLQWKH SURJUDP C*QRPRYLVLRQ ZKLFK PDNHV SDVVHV DW FRPSLOHUV ZULWWHQE\-DPHV+DFNHU VLJQDWXUHRI7\&RRQ!$SULO 40 Ty Coon, President of Vice 7KLV*HQHUDO3XEOLF/LFHQVHGRHVQRWSHUPLWLQFRUSRUDWLQJ\RXU SURJUDPLQWRSURSULHWDU\SURJUDPV,I\RXUSURJUDPLVDVXEroutine library, you may consider it more useful to permit linkLQJSURSULHWDU\DSSOLFDWLRQVZLWKWKHOLEUDU\,IWKLVLVZKDW\RX ZDQWWRGRXVHWKH*18/HVVHU*HQHUDO3XEOLF/LFHQVHLQVWHDG RIWKLV/LFHQVH GPLv3 *18 *(1(5$/ 38%/,& /,&(16( 9HUVLRQ -XQH &RS\ULJKW & )UHH 6RIWZDUH )RXQGDWLRQ ,QF KWWS IVIRUJ! (YHU\RQH LV SHUPLWWHG WR FRS\ DQG GLVWULEXWH verbatim copies of this license document, but changing it is not allowed. 3UHDPEOH7KH*18*HQHUDO3XEOLF/LFHQVHLVDIUHHFRS\OHIW license for software and other kinds of works. The licenses for most software and other practical works are designed to take away your freedom to share and change the works. By FRQWUDVW WKH *18 *HQHUDO 3XEOLF /LFHQVH LV LQWHQGHG WR guarantee your freedom to share and change all versions of a program--to make sure it remains free software for all its users. :HWKH)UHH6RIWZDUH)RXQGDWLRQXVHWKH*18*HQHUDO3XEOLF /LFHQVHIRUPRVWRIRXUVRIWZDUHLWDSSOLHVDOVRWRDQ\RWKHU ZRUNUHOHDVHGWKLVZD\E\LWVDXWKRUV<RXFDQDSSO\LWWR\RXU SURJUDPV WRR :KHQ ZH VSHDN RI IUHH VRIWZDUH ZH DUH UHIHUULQJ WR IUHHGRP QRW SULFH 2XU *HQHUDO 3XEOLF /LFHQVHV are designed to make sure that you have the freedom to distribute copies of free software (and charge for them if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs, and that you know you can do these things. To protect your rights, we need to prevent others from denying you these rights or asking you to surrender the rights. Therefore, you have certain responsibilities if you distribute FRSLHV RI WKH VRIWZDUH RU LI \RX PRGLI\ LW UHVSRQVLELOLWLHV WR UHVSHFWWKHIUHHGRPRIRWKHUV)RUH[DPSOHLI\RXGLVWULEXWH copies of such a program, whether gratis or for a fee, you must pass on to the recipients the same freedoms that you received. <RX PXVW PDNH VXUH WKDW WKH\ WRR UHFHLYH RU FDQ JHW WKH source code. And you must show them these terms so they NQRZWKHLUULJKWV'HYHORSHUVWKDWXVHWKH*18*3/SURWHFW \RXUULJKWVZLWKWZRVWHSVDVVHUWFRS\ULJKWRQWKHVRIWZDUH DQG RIIHU \RX WKLV /LFHQVH JLYLQJ \RX OHJDO SHUPLVVLRQ WR FRS\ GLVWULEXWH DQGRU PRGLI\ LW )RU WKH GHYHORSHUV DQG DXWKRUV SURWHFWLRQ WKH *3/ FOHDUO\ H[SODLQV WKDW WKHUH LV QR ZDUUDQW\IRUWKLVIUHHVRIWZDUH)RUERWKXVHUV DQGDXWKRUV VDNH WKH *3/ UHTXLUHV WKDW PRGL¿HG YHUVLRQV EH PDUNHG DV changed, so that their problems will not be attributed erroneously to authors of previous versions. Some devices are GHVLJQHG WR GHQ\ XVHUV DFFHVV WR LQVWDOO RU UXQ PRGL¿HG versions of the software inside them, although the manufacturer can do so. This is fundamentally incompatible with the aim of SURWHFWLQJ XVHUV IUHHGRP WR FKDQJH WKH VRIWZDUH 7KH systematic pattern of such abuse occurs in the area of products for individuals to use, which is precisely where it is most unacceptable. Therefore, we have designed this version of the *3/ WR SURKLELW WKH SUDFWLFH IRU WKRVH SURGXFWV ,I VXFK problems arise substantially in other domains, we stand ready WRH[WHQGWKLVSURYLVLRQWRWKRVHGRPDLQVLQIXWXUHYHUVLRQVRI WKH*3/DVQHHGHGWRSURWHFWWKHIUHHGRPRIXVHUV)LQDOO\ every program is threatened constantly by software patents. States should not allow patents to restrict development and use of software on general-purpose computers, but in those that do, we wish to avoid the special danger that patents applied to a free program could make it effectively proprietary. 7RSUHYHQWWKLVWKH*3/DVVXUHVWKDWSDWHQWVFDQQRWEHXVHGWR render the program non-free. The precise terms and conditions IRUFRS\LQJGLVWULEXWLRQDQGPRGL¿FDWLRQIROORZ7(506$1' &21',7,216'H¿QLWLRQV7KLV/LFHQVHUHIHUVWRYHUVLRQ RI WKH *18 *HQHUDO 3XEOLF /LFHQVH &RS\ULJKW DOVR PHDQV copyright-like laws that apply to other kinds of works, such as semiconductor masks. "The Program" refers to any FRS\ULJKWDEOHZRUNOLFHQVHGXQGHUWKLV/LFHQVH(DFKOLFHQVHHLV WKDW\RXFRPSO\ZLWKWKHWHUPVRIWKLV/LFHQVHLQFRQYH\LQJDOO material for which you do not control copyright. Those thus making or running the covered works for you must do so H[FOXVLYHO\RQ\RXUEHKDOIXQGHU\RXUGLUHFWLRQDQGFRQWURORQ terms that prohibit them from making any copies of your copyrighted material outside their relationship with you. Conveying under any other circumstances is permitted solely under the FRQGLWLRQVVWDWHGEHORZ6XEOLFHQVLQJLVQRWDOORZHGVHFWLRQ 10 makes it unnecessary. 3URWHFWLQJ 8VHUV /HJDO 5LJKWV )URP $QWL&LUFXPYHQWLRQ /DZ 1R FRYHUHG ZRUN VKDOO EH GHHPHG SDUW RI DQ HIIHFWLYH WHFKQRORJLFDO PHDVXUH XQGHU DQ\ DSSOLFDEOH ODZ IXO¿OOLQJ REOLJDWLRQV XQGHU DUWLFOH RI WKH :,32 FRS\ULJKW WUHDW\ adopted on 20 December 1996, or similar laws prohibiting RU UHVWULFWLQJ FLUFXPYHQWLRQ RI VXFK PHDVXUHV :KHQ \RX convey a covered work, you waive any legal power to forbid FLUFXPYHQWLRQ RI WHFKQRORJLFDO PHDVXUHV WR WKH H[WHQW VXFK FLUFXPYHQWLRQLVHIIHFWHGE\H[HUFLVLQJULJKWVXQGHUWKLV/LFHQVH with respect to the covered work, and you disclaim any intention WR OLPLW RSHUDWLRQ RU PRGL¿FDWLRQ RI WKH ZRUN DV D PHDQV RI HQIRUFLQJDJDLQVWWKHZRUN VXVHUV\RXURUWKLUGSDUWLHV OHJDO rights to forbid circumvention of technological measures. 4. &RQYH\LQJ9HUEDWLP&RSLHV<RXPD\FRQYH\YHUEDWLPFRSLHV RIWKH3URJUDP VVRXUFHFRGHDV\RXUHFHLYHLWLQDQ\PHGLXP provided that you conspicuously and appropriately publish RQ HDFK FRS\ DQ DSSURSULDWH FRS\ULJKW QRWLFH NHHS LQWDFW DOO QRWLFHV VWDWLQJ WKDW WKLV /LFHQVH DQG DQ\ QRQSHUPLVVLYH WHUPVDGGHGLQDFFRUGZLWKVHFWLRQDSSO\WRWKHFRGHNHHS LQWDFWDOOQRWLFHVRIWKHDEVHQFHRIDQ\ZDUUDQW\DQGJLYHDOO UHFLSLHQWVDFRS\RIWKLV/LFHQVHDORQJZLWKWKH3URJUDP<RX may charge any price or no price for each copy that you convey, and you may offer support or warranty protection for a fee. 5. &RQYH\LQJ0RGL¿HG6RXUFH9HUVLRQV<RXPD\FRQYH\DZRUN EDVHGRQWKH3URJUDPRUWKHPRGL¿FDWLRQVWRSURGXFHLWIURP the Program, in the form of source code under the terms of VHFWLRQSURYLGHGWKDW\RXDOVRPHHWDOORIWKHVHFRQGLWLRQV a) The work must carry prominent notices stating that you PRGL¿HGLWDQGJLYLQJDUHOHYDQWGDWH b) The work must carry prominent notices stating that it is UHOHDVHG XQGHU WKLV /LFHQVH DQG DQ\ FRQGLWLRQV DGGHG XQGHU VHFWLRQ 7KLV UHTXLUHPHQW PRGL¿HV WKH UHTXLUHPHQW LQ VHFWLRQWRNHHSLQWDFWDOOQRWLFHVF<RXPXVWOLFHQVH WKHHQWLUHZRUNDVDZKROHXQGHUWKLV/LFHQVHWRDQ\RQHZKR FRPHVLQWRSRVVHVVLRQRIDFRS\7KLV/LFHQVHZLOOWKHUHIRUH apply, along with any applicable section 7 additional terms, to the whole of the work, and all its parts, regardless of how they DUHSDFNDJHG7KLV/LFHQVHJLYHVQRSHUPLVVLRQWROLFHQVH the work in any other way, but it does not invalidate such SHUPLVVLRQLI\RXKDYHVHSDUDWHO\UHFHLYHGLWG,IWKHZRUN has interactive user interfaces, each must display Appropriate /HJDO1RWLFHVKRZHYHULIWKH3URJUDPKDVLQWHUDFWLYH LQWHUIDFHVWKDWGRQRWGLVSOD\$SSURSULDWH/HJDO1RWLFHV\RXU work need not make them do so. A compilation of a covered work with other separate and independentworks, which are QRWE\WKHLUQDWXUHH[WHQVLRQVRIWKHFRYHUHGZRUNDQGZKLFK are not combined with it such as to form a larger program, in or on a volume of a storage or distribution medium, is called an "aggregate" if the compilation and its resulting copyright are not used to limit the access or legal rights of the FRPSLODWLRQ VXVHUVEH\RQGZKDWWKHLQGLYLGXDOZRUNVSHUPLW ,QFOXVLRQRIDFRYHUHGZRUNLQDQDJJUHJDWHGRHVQRWFDXVH WKLV/LFHQVHWRDSSO\WRWKHRWKHUSDUWVRIWKHDJJUHJDWH &RQYH\LQJ1RQ6RXUFH)RUPV<RXPD\FRQYH\DFRYHUHG work in object code form under the terms of sections 4 and 5, provided that you also convey the machine-readable &RUUHVSRQGLQJ6RXUFHXQGHUWKHWHUPVRIWKLV/LFHQVHLQRQH RIWKHVHZD\VD&RQYH\WKHREMHFWFRGHLQRUHPERGLHG in, a physical product (including a physical distribution PHGLXPDFFRPSDQLHGE\WKH&RUUHVSRQGLQJ6RXUFH¿[HG on a durable physical medium customarily used for software interchange. b) Convey the object code in, or embodied in, a physical product (including a physical distribution medium), accompanied by a written offer, valid for at least three years and valid for as long as you offer spare parts or customer 41 English DGGUHVVHG DV \RX /LFHQVHHV DQG UHFLSLHQWV PD\ EH individuals or organizations. To "modify" a work means to copy from or adapt all or part of the work in a fashion requiring FRS\ULJKWSHUPLVVLRQRWKHUWKDQWKHPDNLQJRIDQH[DFWFRS\ 7KHUHVXOWLQJZRUNLVFDOOHGDPRGL¿HGYHUVLRQRIWKHHDUOLHU work or a work "based on" the earlier work. A "covered work" PHDQVHLWKHUWKHXQPRGL¿HG3URJUDPRUDZRUNEDVHGRQWKH Program. To "propagate" a work means to do anything with it that, without permission, would make you directly or secondarily OLDEOHIRULQIULQJHPHQWXQGHUDSSOLFDEOHFRS\ULJKWODZH[FHSW H[HFXWLQJ LW RQ D FRPSXWHU RU PRGLI\LQJ D SULYDWH FRS\ Propagation includes copying, distribution (with or without PRGL¿FDWLRQ PDNLQJ DYDLODEOH WR WKH SXEOLF DQG LQ VRPH countries other activities as well. To "convey" a work means any kind of propagation that enables other parties to make or UHFHLYH FRSLHV 0HUH LQWHUDFWLRQ ZLWK D XVHU WKURXJK D computer network, with no transfer of a copy, is not conveying. $Q LQWHUDFWLYH XVHU LQWHUIDFH GLVSOD\V $SSURSULDWH /HJDO 1RWLFHV WR WKH H[WHQW WKDW LW LQFOXGHV D FRQYHQLHQW DQG prominently visible feature that (1) displays an appropriate copyright notice, and (2) tells the user that there is no warranty IRUWKHZRUNH[FHSWWRWKHH[WHQWWKDWZDUUDQWLHVDUHSURYLGHG WKDW OLFHQVHHV PD\ FRQYH\ WKH ZRUN XQGHU WKLV /LFHQVH DQG KRZWRYLHZDFRS\RIWKLV/LFHQVH,IWKHLQWHUIDFHSUHVHQWVD list of user commands or options, such as a menu, a prominent item in the list meets this criterion. 1. Source Code. The "source code" for a work means the preferred form of the work IRUPDNLQJPRGL¿FDWLRQVWRLW2EMHFWFRGHPHDQVDQ\QRQ VRXUFH IRUP RI D ZRUN $ 6WDQGDUG ,QWHUIDFH PHDQV DQ LQWHUIDFH WKDW HLWKHU LV DQ RI¿FLDO VWDQGDUG GH¿QHG E\ D recognized standards body, or, in the case of interfaces VSHFL¿HG IRU D SDUWLFXODU SURJUDPPLQJ ODQJXDJH RQH WKDW LV widely used among developers working in that language. The 6\VWHP /LEUDULHV RI DQ H[HFXWDEOH ZRUN LQFOXGH DQ\WKLQJ other than the work as a whole, that (a) is included in the QRUPDOIRUPRISDFNDJLQJD0DMRU&RPSRQHQWEXWZKLFKLVQRW SDUWRIWKDW0DMRU&RPSRQHQWDQGEVHUYHVRQO\WRHQDEOH XVHRIWKHZRUNZLWKWKDW0DMRU&RPSRQHQWRUWRLPSOHPHQWD 6WDQGDUG,QWHUIDFHIRUZKLFKDQLPSOHPHQWDWLRQLVDYDLODEOHWR WKHSXEOLFLQVRXUFHFRGHIRUP$0DMRU&RPSRQHQWLQWKLV FRQWH[WPHDQVDPDMRUHVVHQWLDOFRPSRQHQWNHUQHOZLQGRZ V\VWHPDQGVRRQRIWKHVSHFL¿FRSHUDWLQJV\VWHPLIDQ\RQ ZKLFKWKHH[HFXWDEOHZRUNUXQVRUDFRPSLOHUXVHGWRSURGXFH the work, or an object code interpreter used to run it. The "Corresponding Source" for a work in object code form means all the source code needed to generate, install, and (for an H[HFXWDEOHZRUNUXQWKHREMHFWFRGHDQGWRPRGLI\WKHZRUN LQFOXGLQJ VFULSWV WR FRQWURO WKRVH DFWLYLWLHV +RZHYHU LW GRHV QRW LQFOXGH WKH ZRUN V 6\VWHP /LEUDULHV RU JHQHUDOSXUSRVH tools or generally available free programs which are used XQPRGL¿HGLQSHUIRUPLQJWKRVHDFWLYLWLHVEXWZKLFKDUHQRWSDUW RI WKH ZRUN )RU H[DPSOH &RUUHVSRQGLQJ 6RXUFH LQFOXGHV LQWHUIDFH GH¿QLWLRQ ¿OHV DVVRFLDWHG ZLWK VRXUFH ¿OHV IRU WKH work, and the source code for shared libraries and dynamically OLQNHG VXESURJUDPV WKDW WKH ZRUN LV VSHFL¿FDOO\ GHVLJQHG WR require, such as by intimate data communication or control ÀRZEHWZHHQWKRVHVXESURJUDPVDQGRWKHUSDUWVRIWKHZRUN The Corresponding Source need not include anything that users can regenerate automatically from other parts of the Corresponding Source. The Corresponding Source for a work in source code form is thatsame work. 2. Basic Permissions. $OOULJKWVJUDQWHGXQGHUWKLV/LFHQVHDUHJUDQWHGIRUWKHWHUPRI copyright on the Program, and are irrevocable provided the VWDWHGFRQGLWLRQVDUHPHW7KLV/LFHQVHH[SOLFLWO\DI¿UPV\RXU XQOLPLWHG SHUPLVVLRQ WR UXQ WKH XQPRGL¿HG 3URJUDP 7KH RXWSXWIURPUXQQLQJDFRYHUHGZRUNLVFRYHUHGE\WKLV/LFHQVH only if the output, given its content, constitutes a covered ZRUN 7KLV /LFHQVH DFNQRZOHGJHV \RXU ULJKWV RI IDLU XVH RU RWKHUHTXLYDOHQWDVSURYLGHGE\FRS\ULJKWODZ<RXPD\PDNH run and propagate covered works that you do not convey, without conditions so long as your license otherwise remains in IRUFH<RXPD\FRQYH\FRYHUHGZRUNVWRRWKHUVIRUWKHVROH SXUSRVHRIKDYLQJWKHPPDNHPRGL¿FDWLRQVH[FOXVLYHO\IRU\RX or provide you with facilities for running those works, provided English support for that product model, to give anyone who possesses the object code either (1) a copy of the Corresponding Source for all the software in the product WKDWLVFRYHUHGE\WKLV/LFHQVHRQDGXUDEOHSK\VLFDO medium customarily used for software interchange, for a price no more than your reasonable cost of physically performing this conveying of source, or (2) access to copy the Corresponding Source from a network server at no charge. c) Convey individual copies of the object code with a copy of the written offer to provide the Corresponding Source. This alternative is allowed only occasionally and noncommercially, and only if you received the object code with such an offer, in accord with subsection 6b. d) Convey the object code by offering access from a designated place (gratis or for a charge), and offer equivalent access to the Corresponding Source in the same way through the same place at no IXUWKHUFKDUJH<RXQHHGQRWUHTXLUHUHFLSLHQWVWRFRS\WKH &RUUHVSRQGLQJ6RXUFHDORQJZLWKWKHREMHFWFRGH,IWKHSODFH to copy the object code is a network server, the Corresponding Source may be on a different server (operated by you or a third party) that supports equivalent copying facilities, provided you maintain clear directions QH[WWRWKHREMHFWFRGHVD\LQJZKHUHWR¿QGWKH Corresponding Source. Regardless of what server hosts the Corresponding Source, you remain obligated to ensure that it is available for as long as needed to satisfy these requirements. e) Convey the object code using peer-to-peer transmission, provided you inform other peers where the object code and Corresponding Source of the work are being offered to the general public at no charge under subsection 6d. A separable portion of the object code, whose VRXUFHFRGHLVH[FOXGHGIURPWKH&RUUHVSRQGLQJ6RXUFHDVD 6\VWHP/LEUDU\QHHGQRWEHLQFOXGHGLQFRQYH\LQJWKHREMHFW code work. A "User Product" is either (1) a "consumer product", which means any tangible personal property which is normally used for personal, family, or household purposes, or (2) anything designed or sold for incorporation into a GZHOOLQJ,QGHWHUPLQLQJZKHWKHUDSURGXFWLVDFRQVXPHU product, doubtful cases shall be resolved in favor of coverage. For a particular product received by a particular user, "normally used" refers to a typical or common use of that class of product, regardless of the status of the particular user or of the way in which the particular user actually uses, or H[SHFWVRULVH[SHFWHGWRXVHWKHSURGXFW$SURGXFWLVD consumer product regardless of whether the product has substantial commercial, industrial or non-consumer uses, XQOHVVVXFKXVHVUHSUHVHQWWKHRQO\VLJQL¿FDQWPRGHRIXVHRI WKHSURGXFW,QVWDOODWLRQ,QIRUPDWLRQIRUD8VHU3URGXFW means any methods, procedures, authorization keys, or other LQIRUPDWLRQUHTXLUHGWRLQVWDOODQGH[HFXWHPRGL¿HGYHUVLRQV RIDFRYHUHGZRUNLQWKDW8VHU3URGXFWIURPDPRGL¿HG version of its Corresponding Source. The information must VXI¿FHWRHQVXUHWKDWWKHFRQWLQXHGIXQFWLRQLQJRIWKH PRGL¿HGREMHFWFRGHLVLQQRFDVHSUHYHQWHGRULQWHUIHUHGZLWK VROHO\EHFDXVHPRGL¿FDWLRQKDVEHHQPDGH,I\RXFRQYH\DQ REMHFWFRGHZRUNXQGHUWKLVVHFWLRQLQRUZLWKRUVSHFL¿FDOO\ for use in, a User Product, and the conveying occurs as part of a transaction in which the right of possession and use of the User Product is transferred to the recipient in perpetuity or for D¿[HGWHUPUHJDUGOHVVRIKRZWKHWUDQVDFWLRQLV characterized), the Corresponding Source conveyed under this VHFWLRQPXVWEHDFFRPSDQLHGE\WKH,QVWDOODWLRQ,QIRUPDWLRQ But this requirement does not apply if neither you nor any WKLUGSDUW\UHWDLQVWKHDELOLW\WRLQVWDOOPRGL¿HGREMHFWFRGHRQ WKH8VHU3URGXFWIRUH[DPSOHWKHZRUNKDVEHHQLQVWDOOHGLQ 5207KHUHTXLUHPHQWWRSURYLGH,QVWDOODWLRQ,QIRUPDWLRQ does not include a requirement to continue to provide support service, warranty, or updates for a work that has been PRGL¿HGRULQVWDOOHGE\WKHUHFLSLHQWRUIRUWKH8VHU3URGXFW LQZKLFKLWKDVEHHQPRGL¿HGRULQVWDOOHG$FFHVVWRD QHWZRUNPD\EHGHQLHGZKHQWKHPRGL¿FDWLRQLWVHOIPDWHULDOO\ and adversely affects the operation of the network or violates the rules and protocols for communication across the network. &RUUHVSRQGLQJ6RXUFHFRQYH\HGDQG,QVWDOODWLRQ,QIRUPDWLRQ 42 provided, in accord with this section must be in a format that is publicly documented (and with an implementation available to the public in source code form), and must require no special password or key for unpacking, reading or copying. 7. Additional Terms. "Additional permissions" are terms that VXSSOHPHQWWKHWHUPVRIWKLV/LFHQVHE\PDNLQJH[FHSWLRQV from one or more of its conditions. Additional permissions that are applicable to the entire Program shall be treated as WKRXJKWKH\ZHUHLQFOXGHGLQWKLV/LFHQVHWRWKHH[WHQWWKDW WKH\DUHYDOLGXQGHUDSSOLFDEOHODZ,IDGGLWLRQDOSHUPLVVLRQV apply only to part of the Program, that part may be used separately under those permissions, but the entire Program UHPDLQVJRYHUQHGE\WKLV/LFHQVHZLWKRXWUHJDUGWRWKH DGGLWLRQDOSHUPLVVLRQV:KHQ\RXFRQYH\DFRS\RIDFRYHUHG work, you may at your optionremove any additional permissions from that copy, or from any part of it. (Additional permissions may be written to require their own removal in FHUWDLQFDVHVZKHQ\RXPRGLI\WKHZRUN<RXPD\SODFH additional permissions on material, added by you to a covered work, for which you have or can give appropriate copyright SHUPLVVLRQ1RWZLWKVWDQGLQJDQ\RWKHUSURYLVLRQRIWKLV /LFHQVHIRUPDWHULDO\RXDGGWRDFRYHUHGZRUN\RXPD\LI authorized by the copyright holders of that material) VXSSOHPHQWWKHWHUPVRIWKLV/LFHQVHZLWKWHUPVD Disclaiming warranty or limiting liability differently from the WHUPVRIVHFWLRQVDQGRIWKLV/LFHQVHRUE5HTXLULQJ SUHVHUYDWLRQRIVSHFL¿HGUHDVRQDEOHOHJDOQRWLFHVRUDXWKRU DWWULEXWLRQVLQWKDWPDWHULDORULQWKH$SSURSULDWH/HJDO 1RWLFHVGLVSOD\HGE\ZRUNVFRQWDLQLQJLWRUF3URKLELWLQJ misrepresentation of the origin of that material, or requiring WKDWPRGL¿HGYHUVLRQVRIVXFKPDWHULDOEHPDUNHGLQ UHDVRQDEOHZD\VDVGLIIHUHQWIURPWKHRULJLQDOYHUVLRQRUG /LPLWLQJWKHXVHIRUSXEOLFLW\SXUSRVHVRIQDPHVRIOLFHQVRUV RUDXWKRUVRIWKHPDWHULDORUH'HFOLQLQJWRJUDQWULJKWV under trademark law for use of some trade names, WUDGHPDUNVRUVHUYLFHPDUNVRUI5HTXLULQJ LQGHPQL¿FDWLRQRIOLFHQVRUVDQGDXWKRUVRIWKDWPDWHULDOE\ DQ\RQHZKRFRQYH\VWKHPDWHULDORUPRGL¿HGYHUVLRQVRI it) with contractual assumptions of liability to the recipient, for any liability that these contractual assumptions directly impose on those licensors and authors. All other non-permissive additional terms are considered "furtherrestrictions" within the PHDQLQJRIVHFWLRQ,IWKH3URJUDPDV\RXUHFHLYHGLWRU any part of it, contains a notice stating that it is governed by WKLV/LFHQVHDORQJZLWKDWHUPWKDWLVDIXUWKHUUHVWULFWLRQ\RX PD\UHPRYHWKDWWHUP,IDOLFHQVHGRFXPHQWFRQWDLQVD further restriction but permits relicensing or conveying under WKLV/LFHQVH\RXPD\DGGWRDFRYHUHGZRUNPDWHULDO governed by the terms of that license document, provided that the further restriction does not survive such relicensing or FRQYH\LQJ,I\RXDGGWHUPVWRDFRYHUHGZRUNLQDFFRUGZLWK WKLVVHFWLRQ\RXPXVWSODFHLQWKHUHOHYDQWVRXUFH¿OHVD VWDWHPHQWRIWKHDGGLWLRQDOWHUPVWKDWDSSO\WRWKRVH¿OHVRU DQRWLFHLQGLFDWLQJZKHUHWR¿QGWKHDSSOLFDEOHWHUPV Additional terms, permissive or non-permissive, may be stated in the form of a separately written license, or stated as H[FHSWLRQVWKHDERYHUHTXLUHPHQWVDSSO\HLWKHUZD\ 7HUPLQDWLRQ<RXPD\QRWSURSDJDWHRUPRGLI\DFRYHUHG ZRUNH[FHSWDVH[SUHVVO\SURYLGHGXQGHUWKLV/LFHQVH$Q\ attempt otherwise to propagate or modify it is void, and will DXWRPDWLFDOO\WHUPLQDWH\RXUULJKWVXQGHUWKLV/LFHQVH (including any patent licenses granted under the third SDUDJUDSKRIVHFWLRQ+RZHYHULI\RXFHDVHDOOYLRODWLRQ RIWKLV/LFHQVHWKHQ\RXUOLFHQVHIURPDSDUWLFXODUFRS\ULJKW holder is reinstated (a) provisionally, unless and until the FRS\ULJKWKROGHUH[SOLFLWO\DQG¿QDOO\WHUPLQDWHV\RXUOLFHQVH and (b) permanently, if the copyright holder fails to notify you of the violation by some reasonable means prior to 60 days DIWHUWKHFHVVDWLRQ0RUHRYHU\RXUOLFHQVHIURPDSDUWLFXODU copyright holder is reinstated permanently if the copyright KROGHUQRWL¿HV\RXRIWKHYLRODWLRQE\VRPHUHDVRQDEOH PHDQVWKLVLVWKH¿UVWWLPH\RXKDYHUHFHLYHGQRWLFHRI YLRODWLRQRIWKLV/LFHQVHIRUDQ\ZRUNIURPWKDWFRS\ULJKW holder, and you cure the violation prior to 30 days after your use of the covered work in a country, would infringe one or PRUHLGHQWL¿DEOHSDWHQWVLQWKDWFRXQWU\WKDW\RXKDYHUHDVRQ WREHOLHYHDUHYDOLG,ISXUVXDQWWRRULQFRQQHFWLRQZLWKD single transaction orarrangement, you convey, or propagate by procuring conveyance of, a covered work, and grant a patent license to some of the parties receiving the covered work authorizing them to use, propagate, modify or convey a VSHFL¿FFRS\RIWKHFRYHUHGZRUNWKHQWKHSDWHQWOLFHQVH\RX JUDQWLVDXWRPDWLFDOO\H[WHQGHGWRDOOUHFLSLHQWVRIWKHFRYHUHG work and works based on it. A patent license is "discriminatory" if it does not include within the scope of its FRYHUDJHSURKLELWVWKHH[HUFLVHRIRULVFRQGLWLRQHGRQWKH QRQH[HUFLVHRIRQHRUPRUHRIWKHULJKWVWKDWDUHVSHFL¿FDOO\ JUDQWHGXQGHUWKLV/LFHQVH<RXPD\QRWFRQYH\DFRYHUHG work if you are a party to an arrangement with a third party that is in the business of distributing software, under which \RXPDNHSD\PHQWWRWKHWKLUGSDUW\EDVHGRQWKHH[WHQWRI your activity of conveying the work, and under which the third party grants, to any of the parties who would receive the covered work from you, a discriminatory patent license (a) in connection with copies of the covered work conveyed by you (or copies made from those copies), or (b) primarily for and in FRQQHFWLRQZLWKVSHFL¿FSURGXFWVRUFRPSLODWLRQVWKDWFRQWDLQ the covered work, unless you entered into that arrangement, RUWKDWSDWHQWOLFHQVHZDVJUDQWHGSULRUWR0DUFK 1RWKLQJLQWKLV/LFHQVHVKDOOEHFRQVWUXHGDVH[FOXGLQJRU limiting any implied license or other defenses to infringement that may otherwise be available to you under applicable patent ODZ1R6XUUHQGHURI2WKHUV )UHHGRP,IFRQGLWLRQVDUH imposed on you (whether by court order, agreement or RWKHUZLVHWKDWFRQWUDGLFWWKHFRQGLWLRQVRIWKLV/LFHQVHWKH\ GRQRWH[FXVH\RXIURPWKHFRQGLWLRQVRIWKLV/LFHQVH,I\RX cannot convey a covered work so as to satisfy simultaneously \RXUREOLJDWLRQVXQGHUWKLV/LFHQVHDQGDQ\RWKHUSHUWLQHQW obligations, then as a consequence you may not convey it at DOO)RUH[DPSOHLI\RXDJUHHWRWHUPVWKDWREOLJDWH\RXWR collect a royalty for further conveying from those to whom you convey the Program, the only way you could satisfy both those WHUPVDQGWKLV/LFHQVHZRXOGEHWRUHIUDLQHQWLUHO\IURP FRQYH\LQJWKH3URJUDP8VHZLWKWKH*18$IIHUR*HQHUDO 3XEOLF/LFHQVH1RWZLWKVWDQGLQJDQ\RWKHUSURYLVLRQRIWKLV /LFHQVH\RXKDYHSHUPLVVLRQWROLQNRUFRPELQHDQ\FRYHUHG ZRUNZLWKDZRUNOLFHQVHGXQGHUYHUVLRQRIWKH*18$IIHUR *HQHUDO3XEOLF/LFHQVHLQWRDVLQJOHFRPELQHGZRUNDQGWR FRQYH\WKHUHVXOWLQJZRUN7KHWHUPVRIWKLV/LFHQVHZLOO continue to apply to the part which is the covered work, but WKHVSHFLDOUHTXLUHPHQWVRIWKH*18$IIHUR*HQHUDO3XEOLF /LFHQVHVHFWLRQFRQFHUQLQJLQWHUDFWLRQWKURXJKDQHWZRUN will apply to the combination as such. 14. Revised Versions of WKLV/LFHQVH7KH)UHH6RIWZDUH)RXQGDWLRQPD\SXEOLVK UHYLVHGDQGRUQHZYHUVLRQVRIWKH*18*HQHUDO3XEOLF/LFHQVH from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing YHUVLRQQXPEHU,IWKH3URJUDPVSHFL¿HVWKDWDFHUWDLQ QXPEHUHGYHUVLRQRIWKH*18*HQHUDO3XEOLF/LFHQVHRUDQ\ later version" applies to it, you have the option of following the terms and conditions either of that numbered version or of any ODWHUYHUVLRQSXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQ,I WKH3URJUDPGRHVQRWVSHFLI\DYHUVLRQQXPEHURIWKH*18 *HQHUDO3XEOLF/LFHQVH\RXPD\FKRRVHDQ\YHUVLRQHYHU SXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQ,IWKH3URJUDP VSHFL¿HVWKDWDSUR[\FDQGHFLGHZKLFKIXWXUHYHUVLRQVRIWKH *18*HQHUDO3XEOLF/LFHQVHFDQEHXVHGWKDWSUR[\ VSXEOLF statement of acceptance of a version permanently authorizes \RXWRFKRRVHWKDWYHUVLRQIRUWKH3URJUDP/DWHUOLFHQVH versions may give you additional or different permissions. +RZHYHUQRDGGLWLRQDOREOLJDWLRQVDUHLPSRVHGRQDQ\DXWKRU or copyright holder as a result of your choosing to follow a ODWHUYHUVLRQ'LVFODLPHURI:DUUDQW\7+(5(,612 :$55$17<)257+(352*5$0727+((;7(173(50,77(' %<$33/,&$%/(/$:(;&(37:+(127+(5:,6(67$7(',1 :5,7,1*7+(&23<5,*+7+2/'(56$1'2527+(5 3$57,(63529,'(7+(352*5$0$6,6:,7+287 43 English receipt of the notice. Termination of your rights under this section does not terminate thelicenses of parties who have UHFHLYHGFRSLHVRUULJKWVIURP\RXXQGHUWKLV/LFHQVH,I\RXU rights have been terminated and not permanently reinstated, you do not qualify to receive new licenses for the same PDWHULDOXQGHUVHFWLRQ$FFHSWDQFH1RW5HTXLUHGIRU +DYLQJ&RSLHV<RXDUHQRWUHTXLUHGWRDFFHSWWKLV/LFHQVHLQ order to receive or run a copy of the Program. Ancillary propagation of a covered work occurring solely as a consequence of using peer-to-peer transmission to receive a FRS\OLNHZLVHGRHVQRWUHTXLUHDFFHSWDQFH+RZHYHUQRWKLQJ RWKHUWKDQWKLV/LFHQVHJUDQWV\RXSHUPLVVLRQWRSURSDJDWHRU modify any covered work. These actions infringe copyright if \RXGRQRWDFFHSWWKLV/LFHQVH7KHUHIRUHE\PRGLI\LQJRU propagating acovered work, you indicate your acceptance of WKLV/LFHQVHWRGRVR$XWRPDWLF/LFHQVLQJRI'RZQVWUHDP Recipients. Each time you convey a covered work, the recipient automatically receives a license from the original licensors, to run, modify and propagate that work, subject to WKLV/LFHQVH<RXDUHQRWUHVSRQVLEOHIRUHQIRUFLQJFRPSOLDQFH E\WKLUGSDUWLHVZLWKWKLV/LFHQVH$QHQWLW\WUDQVDFWLRQLVD transaction transferring control of an organization, or substantially all assets of one, or subdividing an organization, RUPHUJLQJRUJDQL]DWLRQV,ISURSDJDWLRQRIDFRYHUHGZRUN results from an entity transaction, each party to that transaction who receives a copy of the work also receives ZKDWHYHUOLFHQVHVWRWKHZRUNWKHSDUW\ VSUHGHFHVVRULQ interest had or could give under the previous paragraph, plus a right to possession of the Corresponding Source of the work from the predecessor in interest, if the predecessor has it or FDQJHWLWZLWKUHDVRQDEOHHIIRUWV<RXPD\QRWLPSRVHDQ\ IXUWKHUUHVWULFWLRQVRQWKHH[HUFLVHRIWKHULJKWVJUDQWHGRU DI¿UPHGXQGHUWKLV/LFHQVH)RUH[DPSOH\RXPD\QRW LPSRVHDOLFHQVHIHHUR\DOW\RURWKHUFKDUJHIRUH[HUFLVHRI ULJKWVJUDQWHGXQGHUWKLV/LFHQVHDQG\RXPD\QRWLQLWLDWH litigation (including a cross-claim or counterclaim in a lawsuit) alleging that any patent claim is infringed by making, using, selling, offering for sale, or importing the Program or any portion of it. 11. Patents. A "contributor" is a copyright KROGHUZKRDXWKRUL]HVXVHXQGHUWKLV/LFHQVHRIWKH3URJUDP or a work on which the Program is based. The work thus OLFHQVHGLVFDOOHGWKHFRQWULEXWRU VFRQWULEXWRUYHUVLRQ$ FRQWULEXWRU VHVVHQWLDOSDWHQWFODLPVDUHDOOSDWHQWFODLPV owned or controlled by the contributor, whether already acquired or hereafter acquired, that would be infringed by VRPHPDQQHUSHUPLWWHGE\WKLV/LFHQVHRIPDNLQJXVLQJRU selling its contributor version, but do not include claims that would be infringed only as a consequence of further PRGL¿FDWLRQRIWKHFRQWULEXWRUYHUVLRQ)RUSXUSRVHVRIWKLV GH¿QLWLRQFRQWUROLQFOXGHVWKHULJKWWRJUDQWSDWHQW sublicenses in a manner consistent with the requirements of WKLV/LFHQVH(DFKFRQWULEXWRUJUDQWV\RXDQRQH[FOXVLYH ZRUOGZLGHUR\DOW\IUHHSDWHQWOLFHQVHXQGHUWKHFRQWULEXWRU V essential patent claims, to make, use, sell, offer for sale, import and otherwise run, modify andpropagate the contents RILWVFRQWULEXWRUYHUVLRQ,QWKHIROORZLQJWKUHHSDUDJUDSKVD SDWHQWOLFHQVHLVDQ\H[SUHVVDJUHHPHQWRUFRPPLWPHQW however denominated, not to enforce a patent (such as an H[SUHVVSHUPLVVLRQWRSUDFWLFHDSDWHQWRUFRYHQDQWQRWWRVXH for patent infringement). To "grant" such a patent license to a party means to make such an agreement or commitment not WRHQIRUFHDSDWHQWDJDLQVWWKHSDUW\,I\RXFRQYH\D covered work, knowingly relying on a patent license, and the Corresponding Source of the work is not available for anyone WRFRS\IUHHRIFKDUJHDQGXQGHUWKHWHUPVRIWKLV/LFHQVH through a publicly available network server or other readily accessible means, then you must either (1) cause the Corresponding Source to be so available, or (2) arrange to GHSULYH\RXUVHOIRIWKHEHQH¿WRIWKHSDWHQWOLFHQVHIRUWKLV particular work, or (3) arrange, in a manner consistent with WKHUHTXLUHPHQWVRIWKLV/LFHQVHWRH[WHQGWKHSDWHQWOLFHQVH WRGRZQVWUHDPUHFLSLHQWV.QRZLQJO\UHO\LQJPHDQV\RX have actual knowledge that, but for the patent license, your FRQYH\LQJWKHFRYHUHGZRUNLQDFRXQWU\RU\RXUUHFLSLHQW V English :$55$17<2)$1<.,1'(,7+(5(;35(66('25,03/,(' ,1&/8',1*%87127/,0,7('727+(,03/,(' :$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$ 3$57,&8/$5385326(7+((17,5(5,6.$6727+( 48$/,7<$1'3(5)250$1&(2)7+(352*5$0,6:,7+ <286+28/'7+(352*5$03529('()(&7,9(<28 $6680(7+(&2672)$//1(&(66$5<6(59,&,1*5(3$,5 25&255(&7,21/LPLWDWLRQRI/LDELOLW\,112(9(17 81/(665(48,5('%<$33/,&$%/(/$:25$*5(('72,1 :5,7,1*:,//$1<&23<5,*+7+2/'(525$1<27+(5 3$57<:+202',),(6$1'25&219(<67+(352*5$0$6 3(50,77('$%29(%(/,$%/(72<28)25'$0$*(6 ,1&/8',1*$1<*(1(5$/63(&,$/,1&,'(17$/25 &216(48(17,$/'$0$*(6$5,6,1*2872)7+(86(25 ,1$%,/,7<7286(7+(352*5$0,1&/8',1*%87127 /,0,7('72/2662)'$7$25'$7$%(,1*5(1'(5(' ,1$&&85$7(25/266(66867$,1('%<<28257+,5' 3$57,(625$)$,/85(2)7+(352*5$07223(5$7( :,7+$1<27+(5352*5$06(9(1,)68&++2/'(525 27+(53$57<+$6%((1$'9,6('2)7+(3266,%,/,7<2) 68&+'$0$*(6,QWHUSUHWDWLRQRI6HFWLRQVDQG ,IWKHGLVFODLPHURIZDUUDQW\DQGOLPLWDWLRQRIOLDELOLW\SURYLGHG above cannot be given local legal effect according to their terms, reviewing courts shall apply local law that most closely DSSUR[LPDWHVDQDEVROXWHZDLYHURIDOOFLYLOOLDELOLW\LQ connection with the Program, unless a warranty or assumption of liability accompanies a copy of the Program in return for a IHH(1'2)7(506$1'&21',7,216+RZWR$SSO\7KHVH 7HUPVWR<RXU1HZ3URJUDPV,I\RXGHYHORSDQHZSURJUDP and you want it to be of the greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the following notices to the program. ,WLVVDIHVWWRDWWDFKWKHPWRWKHVWDUWRIHDFKVRXUFH¿OHWR PRVWHIIHFWLYHO\VWDWHWKHH[FOXVLRQRIZDUUDQW\DQGHDFK¿OH should have at least the "copyright" line and a pointer to ZKHUHWKHIXOOQRWLFHLVIRXQGRQHOLQHWRJLYHWKHSURJUDP V QDPHDQGDEULHILGHDRIZKDWLWGRHV!&RS\ULJKW&\HDU! QDPHRIDXWKRU!7KLVSURJUDPLVIUHHVRIWZDUH\RXFDQ UHGLVWULEXWHLWDQGRUPRGLI\LWXQGHUWKHWHUPVRIWKH*18 *HQHUDO3XEOLF/LFHQVHDVSXEOLVKHGE\WKH)UHH6RIWZDUH )RXQGDWLRQHLWKHUYHUVLRQRIWKH/LFHQVHRUDW\RXURSWLRQ any later version.This program is distributed in the hope that LWZLOOEHXVHIXOEXW:,7+287$1<:$55$17<ZLWKRXWHYHQ WKHLPSOLHGZDUUDQW\RI0(5&+$17$%,/,7<RU),71(66)25$ 3$57,&8/$5385326(6HHWKH*18*HQHUDO3XEOLF/LFHQVH IRUPRUHGHWDLOV<RXVKRXOGKDYHUHFHLYHGDFRS\RIWKH*18 *HQHUDO3XEOLF/LFHQVH DORQJZLWKWKLVSURJUDP,IQRWVHHKWWSZZZJQXRUJ OLFHQVHV!$OVRDGGLQIRUPDWLRQRQKRZWRFRQWDFW\RXE\ HOHFWURQLFDQGSDSHUPDLO,IWKHSURJUDPGRHVWHUPLQDO interaction, make it output a short notice like this when it VWDUWVLQDQLQWHUDFWLYHPRGHSURJUDP!&RS\ULJKW& \HDU!QDPHRIDXWKRU!7KLVSURJUDPFRPHVZLWK $%62/87(/<12:$55$17<IRUGHWDLOVW\SHCVKRZZ 7KLV is free software, and you are welcome to redistribute it under FHUWDLQFRQGLWLRQVW\SHCVKRZF IRUGHWDLOV7KHK\SRWKHWLFDO FRPPDQGVCVKRZZ DQGCVKRZF VKRXOGVKRZWKH DSSURSULDWHSDUWVRIWKH*HQHUDO3XEOLF/LFHQVH2IFRXUVH \RXUSURJUDP VFRPPDQGVPLJKWEHGLIIHUHQWIRUD*8, LQWHUIDFH\RXZRXOGXVHDQDERXWER[<RXVKRXOGDOVR get your employer (if you work as a programmer) or school, if any, to sign a "copyright disclaimer" for the program, if necessary. For more information on this, and how to apply DQGIROORZWKH*18*3/VHHKWWSZZZJQXRUJ OLFHQVHV!7KH*18*HQHUDO3XEOLF/LFHQVHGRHVQRWSHUPLW LQFRUSRUDWLQJ\RXUSURJUDPLQWRSURSULHWDU\SURJUDPV,I\RXU program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the OLEUDU\,IWKLVLVZKDW\RXZDQWWRGRXVHWKH*18/HVVHU *HQHUDO3XEOLF/LFHQVHLQVWHDGRIWKLV/LFHQVH%XW¿UVW SOHDVHUHDGKWWSZZZJQXRUJSKLORVRSK\ZK\QRWOJSO KWPO! HarfBuzz 44 +DUI%X]]ZDVSUHYLRXVO\OLFHQVHGXQGHUGLIIHUHQWOLFHQVHV7KLV ZDV FKDQJHG LQ-DQXDU\ ,I \RX QHHG WR UHOLFHQVH \RXU old copies, consult the announcement of the license change on WKHLQWHUQHW2WKHUWKDQWKDWHDFKFRS\RI+DUI%X]]LVOLFHQVHG XQGHU WKH &23<,1* ¿OH LQFOXGHG ZLWK LW 7KH DFWXDO OLFHQVH IROORZV Permission is hereby granted, without written agreement and without license or royalty fees, to use, copy, modify, and distribute this software and its documentation for any purpose, provided that the above copyright notice and the following two paragraphs appear in all copies of this software. ,112(9(176+$//7+(&23<5,*+7+2/'(5%(/,$%/(72 $1< 3$57< )25 ',5(&7 ,1',5(&7 63(&,$/ ,1&,'(17$/ 25 &216(48(17,$/ '$0$*(6 $5,6,1* 287 2) 7+( 86( 2)7+,662)7:$5($1',76'2&80(17$7,21(9(1,)7+( &23<5,*+7+2/'(5+$6%((1$'9,6('2)7+(3266,%,/,7< 2)68&+'$0$*( 7+( &23<5,*+7 +2/'(5 63(&,),&$//< ',6&/$,06 $1< :$55$17,(6 ,1&/8',1* %87 127 /,0,7(' 72 7+( ,03/,(' :$55$17,(6 2) 0(5&+$17$%,/,7< $1' ),71(66 )25 $ 3$57,&8/$5 385326( 7+( 62)7:$5( 3529,'(' +(5(81'(5,621$1$6,6%$6,6$1'7+(&23<5,*+7 +2/'(5 +$6 12 2%/,*$7,21 72 3529,'( 0$,17(1$1&( 683325783'$7(6(1+$1&(0(1762502',),&$7,216 LGPLv2.1 *18/(66(5*(1(5$/38%/,&/,&(16( Version 2.1, February 1999 Copyright (C) 1991, 1999 )UHH6RIWZDUH)RXQGDWLRQ,QF)UDQNOLQ6WUHHW)LIWK)ORRU %RVWRQ0$86$(YHU\RQHLVSHUPLWWHGWRFRS\ and distribute verbatim copies of this license document, but FKDQJLQJ LW LV QRW DOORZHG >7KLV LV WKH ¿UVW UHOHDVHG YHUVLRQ RI WKH /HVVHU *3/ ,W DOVR FRXQWV DV WKH VXFFHVVRU RI WKH *18 /LEUDU\ 3XEOLF /LFHQVH YHUVLRQ KHQFH WKH YHUVLRQ number 2.1.] Preamble The licenses for most software are designed to take away your freedom to share and change it. %\ FRQWUDVW WKH *18 *HQHUDO 3XEOLF /LFHQVHV DUH LQWHQGHG WR guarantee your freedom to share and change free software--to make sure the software is free for all its users. This license, WKH /HVVHU *HQHUDO 3XEOLF /LFHQVH DSSOLHV WR VRPH VSHFLDOO\ designated software packages--typically libraries--of the Free Software Foundation and other authors who decide to use it. <RXFDQXVHLWWRREXWZHVXJJHVW\RX¿UVWWKLQNFDUHIXOO\DERXW ZKHWKHU WKLV OLFHQVH RU WKH RUGLQDU\ *HQHUDO 3XEOLF /LFHQVH LV the better strategy to use in any particular case, based on WKH H[SODQDWLRQV EHORZ :KHQ ZH VSHDN RI IUHH VRIWZDUH we are referring to freedom of use, not price. Our General 3XEOLF /LFHQVHV DUH GHVLJQHG WR PDNH VXUH WKDW \RX KDYH WKH freedom to distribute copies of free software (and charge for WKLVVHUYLFHLI\RXZLVKWKDW\RXUHFHLYHVRXUFHFRGHRUFDQ JHWLWLI\RXZDQWLWWKDW\RXFDQFKDQJHWKHVRIWZDUHDQGXVH SLHFHVRIELWLQQHZIUHHSURJUDPVDQGWKDW\RXDUHLQIRUPHG that you can do these things. To protect your rights, we need to make restrictions that forbid distributors to deny you these rights or to ask you to surrender these rights. These restrictions translate to certain responsibilities for you if you GLVWULEXWHFRSLHVRIWKHOLEUDU\RULI\RXPRGLI\LW)RUH[DPSOH if you distribute copies of the library, whether gratis or for a fee, you must give the recipients all the rights that we gave \RX<RXPXVWPDNHVXUHWKDWWKH\WRRUHFHLYHRUFDQJHWWKH VRXUFHFRGH,I\RXOLQNRWKHUFRGHZLWKWKHOLEUDU\\RXPXVW SURYLGHFRPSOHWHREMHFW¿OHVWRWKHUHFLSLHQWVVRWKDWWKH\FDQ relink them with the library after making changes to the library and recompiling it. And you must show them these terms so WKH\ NQRZ WKHLU ULJKWV :H SURWHFW \RXU ULJKWV ZLWK D WZR VWHSPHWKRGZHFRS\ULJKWWKHOLEUDU\DQGZHRIIHU\RX this license, which gives you legal permission to copy, distribute and/or modify the library. To protect each distributor, we want to make it very clear that there is no warranty for the IUHHOLEUDU\$OVRLIWKHOLEUDU\LVPRGL¿HGE\VRPHRQHHOVHDQG passed on, the recipients should know that what they have is DOOPRGXOHVLWFRQWDLQVSOXVDQ\DVVRFLDWHGLQWHUIDFHGH¿QLWLRQ ¿OHVSOXVWKHVFULSWVXVHGWRFRQWUROFRPSLODWLRQDQGLQVWDOODWLRQ of the library. Activities other than copying, distribution and PRGL¿FDWLRQDUHQRWFRYHUHGE\WKLV/LFHQVHWKH\DUHRXWVLGH LWVVFRSH7KHDFWRIUXQQLQJDSURJUDPXVLQJWKH/LEUDU\LVQRW restricted, and output from such a program is covered only if its FRQWHQWVFRQVWLWXWHDZRUNEDVHGRQWKH/LEUDU\LQGHSHQGHQW RIWKHXVHRIWKH/LEUDU\LQDWRROIRUZULWLQJLW:KHWKHUWKDWLV WUXHGHSHQGVRQZKDWWKH/LEUDU\GRHVDQGZKDWWKHSURJUDP WKDWXVHVWKH/LEUDU\GRHV <RXPD\FRS\DQGGLVWULEXWHYHUEDWLPFRSLHVRIWKH/LEUDU\ V complete source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of ZDUUDQW\NHHSLQWDFWDOOWKHQRWLFHVWKDWUHIHUWRWKLV/LFHQVH DQGWRWKHDEVHQFHRIDQ\ZDUUDQW\DQGGLVWULEXWHDFRS\RI WKLV/LFHQVHDORQJZLWKWKH/LEUDU\<RXPD\FKDUJHDIHHIRU the physical act of transferring a copy, and you may at your RSWLRQRIIHUZDUUDQW\SURWHFWLRQLQH[FKDQJHIRUDIHH<RX PD\PRGLI\\RXUFRS\RUFRSLHVRIWKH/LEUDU\RUDQ\SRUWLRQ RILWWKXVIRUPLQJDZRUNEDVHGRQWKH/LEUDU\DQGFRS\DQG GLVWULEXWHVXFKPRGL¿FDWLRQVRUZRUNXQGHUWKHWHUPVRI6HFWLRQ DERYHSURYLGHGWKDW\RXDOVRPHHWDOORIWKHVHFRQGLWLRQVD 7KHPRGL¿HGZRUNPXVWLWVHOIEHDVRIWZDUHOLEUDU\E<RXPXVW FDXVHWKH¿OHVPRGL¿HGWRFDUU\SURPLQHQWQRWLFHVVWDWLQJWKDW \RXFKDQJHGWKH¿OHVDQGWKHGDWHRIDQ\FKDQJHF<RXPXVW cause the whole of the work to be licensed at no charge to all WKLUGSDUWLHVXQGHUWKHWHUPVRIWKLV/LFHQVHG,IDIDFLOLW\LQ WKHPRGL¿HG/LEUDU\UHIHUVWRDIXQFWLRQRUDWDEOHRIGDWDWREH supplied by an application program that uses the facility, other than as an argument passed when the facility is invoked, then you must make a good faith effort to ensure that, in the event an application does not supply such function or table, the facility still operates, and performs whatever part of its purpose UHPDLQV PHDQLQJIXO )RU H[DPSOH D IXQFWLRQ LQ D OLEUDU\ WR compute square roots has a purpose that is entirely wellGH¿QHGLQGHSHQGHQWRIWKHDSSOLFDWLRQ7KHUHIRUH6XEVHFWLRQ 2d requires that any application-supplied function or table used E\ WKLV IXQFWLRQ PXVW EH RSWLRQDO LI WKH DSSOLFDWLRQ GRHV QRW supply it, the square root function must still compute square URRWV 7KHVH UHTXLUHPHQWV DSSO\ WR WKH PRGL¿HG ZRUN DV D ZKROH,ILGHQWL¿DEOHVHFWLRQVRIWKDWZRUNDUHQRWGHULYHGIURP WKH/LEUDU\DQGFDQEHUHDVRQDEO\FRQVLGHUHGLQGHSHQGHQWDQG VHSDUDWHZRUNVLQWKHPVHOYHVWKHQWKLV/LFHQVHDQGLWVWHUPV do not apply to those sections when you distribute them as separate works. But when you distribute the same sections DV SDUW RI DZKROH ZKLFK LV D ZRUN EDVHG RQ WKH /LEUDU\ WKH GLVWULEXWLRQRIWKHZKROHPXVWEHRQWKHWHUPVRIWKLV/LFHQVH ZKRVH SHUPLVVLRQV IRU RWKHU OLFHQVHHV H[WHQG WR WKH HQWLUH whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights RUFRQWHVW\RXUULJKWVWRZRUNZULWWHQHQWLUHO\E\\RXUDWKHU WKHLQWHQWLVWRH[HUFLVHWKHULJKWWRFRQWUROWKHGLVWULEXWLRQRI GHULYDWLYHRUFROOHFWLYHZRUNVEDVHGRQWKH/LEUDU\,QDGGLWLRQ PHUH DJJUHJDWLRQ RI DQRWKHU ZRUN QRW EDVHG RQ WKH /LEUDU\ ZLWK WKH /LEUDU\ RU ZLWK D ZRUN EDVHG RQ WKH /LEUDU\ RQ D volume of a storage or distribution medium does not bring the RWKHUZRUNXQGHUWKHVFRSHRIWKLV/LFHQVH<RXPD\RSWWR DSSO\ WKH WHUPV RI WKH RUGLQDU\ *18 *HQHUDO 3XEOLF /LFHQVH LQVWHDGRIWKLV/LFHQVHWRDJLYHQFRS\RIWKH/LEUDU\7RGRWKLV \RXPXVWDOWHUDOOWKHQRWLFHVWKDWUHIHUWRWKLV/LFHQVHVRWKDW WKH\UHIHUWRWKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVHYHUVLRQ LQVWHDGRIWRWKLV/LFHQVH,IDQHZHUYHUVLRQWKDQYHUVLRQ RI WKH RUGLQDU\ *18 *HQHUDO 3XEOLF /LFHQVH KDV DSSHDUHG then you can specify that version instead if you wish.) Do not make any other change in these notices. Once this change is made in a given copy, it is irreversible for that copy, so the RUGLQDU\*18*HQHUDO3XEOLF/LFHQVHDSSOLHVWRDOOVXEVHTXHQW copies and derivative works made from that copy. This option LVXVHIXOZKHQ\RXZLVKWRFRS\SDUWRIWKHFRGHRIWKH/LEUDU\ LQWR D SURJUDP WKDW LV QRW D OLEUDU\ <RX PD\ FRS\ DQG GLVWULEXWH WKH /LEUDU\ RU D SRUWLRQ RU GHULYDWLYH RI LW XQGHU 6HFWLRQLQREMHFWFRGHRUH[HFXWDEOHIRUPXQGHUWKHWHUPV of Sections 1 and 2 above provided that you accompany it with the complete corresponding machine-readable source code, 45 English QRWWKHRULJLQDOYHUVLRQVRWKDWWKHRULJLQDODXWKRU VUHSXWDWLRQ will not be affected by problems that might be introduced by others. Finally, software patents pose a constant threat to WKH H[LVWHQFH RI DQ\ IUHH SURJUDP :H ZLVK WR PDNH VXUH that a company cannot effectively restrict the users of a free program by obtaining a restrictive license from a patent holder. Therefore, we insist that any patent license obtained for a version of the library must be consistent with the full freedom RIXVHVSHFL¿HGLQWKLVOLFHQVH0RVW*18VRIWZDUHLQFOXGLQJ VRPHOLEUDULHVLVFRYHUHGE\WKHRUGLQDU\*18*HQHUDO3XEOLF /LFHQVH7KLVOLFHQVHWKH*18/HVVHU*HQHUDO3XEOLF/LFHQVH applies to certain designated libraries, and is quite different IURPWKHRUGLQDU\*HQHUDO3XEOLF/LFHQVH:HXVHWKLVOLFHQVH for certain libraries in order to permit linking those libraries into QRQIUHHSURJUDPV:KHQDSURJUDPLVOLQNHGZLWKDOLEUDU\ whether statically or using a shared library, the combination of the two is legally speaking a combined work, a derivative RI WKH RULJLQDO OLEUDU\ 7KH RUGLQDU\ *HQHUDO 3XEOLF /LFHQVH therefore permits such linking only if the entire combination ¿WVLWVFULWHULDRIIUHHGRP7KH/HVVHU*HQHUDO3XEOLF/LFHQVH SHUPLWVPRUHOD[FULWHULDIRUOLQNLQJRWKHUFRGHZLWKWKHOLEUDU\ :HFDOOWKLVOLFHQVHWKH/HVVHU*HQHUDO3XEOLF/LFHQVHEHFDXVH LW GRHV /HVV WR SURWHFW WKH XVHU V IUHHGRP WKDQ WKH RUGLQDU\ *HQHUDO 3XEOLF /LFHQVH ,W DOVR SURYLGHV RWKHU IUHH VRIWZDUH GHYHORSHUV /HVV RI DQ DGYDQWDJH RYHU FRPSHWLQJ QRQIUHH programs. These disadvantages are the reason we use the RUGLQDU\ *HQHUDO 3XEOLF /LFHQVH IRU PDQ\ OLEUDULHV +RZHYHU WKH /HVVHU OLFHQVH SURYLGHV DGYDQWDJHV LQ FHUWDLQ VSHFLDO circumstances. )RUH[DPSOHRQUDUHRFFDVLRQVWKHUHPD\EHDVSHFLDOQHHG to encourage the widest possible use of a certain library, so that it becomes a de-facto standard. To achieve this, nonfree programs must be allowed to use the library. A more frequent case is that a free library does the same job as ZLGHO\ XVHG QRQIUHH OLEUDULHV ,Q WKLV FDVH WKHUH LV OLWWOH to gain by limiting the free library to free software only, so ZH XVH WKH /HVVHU *HQHUDO 3XEOLF /LFHQVH ,Q RWKHU FDVHV permission to use a particular library in non-free programs enables a greater number of people to use a large body of free VRIWZDUH)RUH[DPSOHSHUPLVVLRQWRXVHWKH*18&/LEUDU\ in non-free programs enables many more people to use the ZKROH*18RSHUDWLQJV\VWHPDVZHOODVLWVYDULDQWWKH*18 /LQX[RSHUDWLQJV\VWHP$OWKRXJKWKH/HVVHU*HQHUDO3XEOLF /LFHQVHLV/HVVSURWHFWLYHRIWKHXVHUV IUHHGRPLWGRHVHQVXUH WKDWWKHXVHURIDSURJUDPWKDWLVOLQNHGZLWKWKH/LEUDU\KDV the freedom and the wherewithal to run that program using a PRGL¿HGYHUVLRQRIWKH/LEUDU\ The precise terms and conditions for copying, distribution DQGPRGL¿FDWLRQIROORZ3D\FORVHDWWHQWLRQWRWKHGLIIHUHQFH between a "work based on the library" and a "work that uses the library". The former contains code derived from the library, whereas the latter must be combined with the library LQ RUGHU WR UXQ *18 /(66(5 *(1(5$/ 38%/,& /,&(16( 7(506 $1' &21',7,216 )25 &23<,1* ',675,%87,21 $1' 02',),&$7,21 7KLV /LFHQVH $JUHHPHQW DSSOLHV to any software library or other program which contains a notice placed by the copyright holder or other authorized party saying it may be distributed under the terms of this /HVVHU *HQHUDO 3XEOLF /LFHQVH DOVR FDOOHG WKLV /LFHQVH Each licensee is addressed as "you". A "library" means a collection of software functions and/or data prepared so as to be conveniently linked with application programs (which use VRPHRIWKRVHIXQFWLRQVDQGGDWDWRIRUPH[HFXWDEOHV7KH /LEUDU\ EHORZ UHIHUV WR DQ\ VXFK VRIWZDUH OLEUDU\ RU ZRUN which has been distributed under these terms. A "work based RQWKH/LEUDU\PHDQVHLWKHUWKH/LEUDU\RUDQ\GHULYDWLYHZRUN XQGHU FRS\ULJKW ODZ WKDW LV WR VD\ D ZRUN FRQWDLQLQJ WKH /LEUDU\RUDSRUWLRQRILWHLWKHUYHUEDWLPRUZLWKPRGL¿FDWLRQV and/or translated straightforwardly into another language. +HUHLQDIWHU WUDQVODWLRQ LV LQFOXGHG ZLWKRXW OLPLWDWLRQ LQ WKH WHUP PRGL¿FDWLRQ 6RXUFH FRGH IRU D ZRUN PHDQV WKH SUHIHUUHGIRUPRIWKHZRUNIRUPDNLQJPRGL¿FDWLRQVWRLW)RU a library, complete source code means all the source code for English which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange. ,I GLVWULEXWLRQ RI REMHFW FRGH LV PDGH E\ RIIHULQJ DFFHVV WR copy from a designated place, then offering equivalent access WR FRS\ WKH VRXUFH FRGH IURP WKH VDPH SODFH VDWLV¿HV WKH requirement to distribute the source code, even though third parties are not compelled to copy the source along with the object code. 5. A program that contains no derivative of any SRUWLRQRIWKH/LEUDU\EXWLVGHVLJQHGWRZRUNZLWKWKH/LEUDU\ by being compiled or linked with it, is called a "work that uses WKH /LEUDU\ 6XFK D ZRUN LQ LVRODWLRQ LV QRW D GHULYDWLYH ZRUN RI WKH /LEUDU\ DQG WKHUHIRUH IDOOV RXWVLGH WKH VFRSH RI WKLV /LFHQVH +RZHYHU OLQNLQJ D ZRUN WKDW XVHV WKH /LEUDU\ ZLWK WKH /LEUDU\ FUHDWHV DQ H[HFXWDEOH WKDW LV D GHULYDWLYH RI WKH/LEUDU\EHFDXVHLWFRQWDLQVSRUWLRQVRIWKH/LEUDU\UDWKHU WKDQDZRUNWKDWXVHVWKHOLEUDU\7KHH[HFXWDEOHLVWKHUHIRUH FRYHUHGE\WKLV/LFHQVH6HFWLRQVWDWHVWHUPVIRUGLVWULEXWLRQ RI VXFK H[HFXWDEOHV :KHQ D ZRUN WKDW XVHV WKH /LEUDU\ XVHV PDWHULDO IURP D KHDGHU ¿OH WKDW LV SDUW RI WKH /LEUDU\ the object code for the work may be a derivative work of the /LEUDU\ HYHQ WKRXJK WKH VRXUFH FRGH LV QRW :KHWKHU WKLV LV WUXHLVHVSHFLDOO\VLJQL¿FDQWLIWKHZRUNFDQEHOLQNHGZLWKRXW WKH/LEUDU\RULIWKHZRUNLVLWVHOIDOLEUDU\7KHWKUHVKROGIRU WKLVWREHWUXHLVQRWSUHFLVHO\GH¿QHGE\ODZ,IVXFKDQREMHFW ¿OH XVHV RQO\ QXPHULFDO SDUDPHWHUV GDWD VWUXFWXUH OD\RXWV and accessors, and small macros and small inline functions WHQ OLQHV RU OHVV LQ OHQJWK WKHQ WKH XVH RI WKH REMHFW ¿OH is unrestricted, regardless of whether it is legally a derivative ZRUN([HFXWDEOHVFRQWDLQLQJWKLVREMHFWFRGHSOXVSRUWLRQVRI WKH/LEUDU\ZLOOVWLOOIDOOXQGHU6HFWLRQ2WKHUZLVHLIWKHZRUN LVDGHULYDWLYHRIWKH/LEUDU\\RXPD\GLVWULEXWHWKHREMHFWFRGH IRU WKH ZRUN XQGHU WKH WHUPV RI 6HFWLRQ $Q\ H[HFXWDEOHV containing that work also fall under Section 6, whether or QRW WKH\ DUH OLQNHG GLUHFWO\ ZLWK WKH /LEUDU\ LWVHOI $V DQ H[FHSWLRQWRWKH6HFWLRQVDERYH\RXPD\DOVRFRPELQHRUOLQN D ZRUN WKDW XVHV WKH /LEUDU\ ZLWK WKH /LEUDU\ WR SURGXFH D ZRUN FRQWDLQLQJ SRUWLRQV RI WKH /LEUDU\ DQG GLVWULEXWH WKDW work under terms of your choice, provided that the terms SHUPLW PRGL¿FDWLRQ RI WKH ZRUN IRU WKH FXVWRPHU V RZQ XVH DQGUHYHUVHHQJLQHHULQJIRUGHEXJJLQJVXFKPRGL¿FDWLRQV<RX must give prominent notice with each copy of the work that the /LEUDU\LVXVHGLQLWDQGWKDWWKH/LEUDU\DQGLWVXVHDUHFRYHUHG E\ WKLV /LFHQVH <RX PXVW VXSSO\ D FRS\ RI WKLV /LFHQVH ,I WKH ZRUN GXULQJ H[HFXWLRQ GLVSOD\V FRS\ULJKW QRWLFHV \RX PXVWLQFOXGHWKHFRS\ULJKWQRWLFHIRUWKH/LEUDU\DPRQJWKHP as well as a reference directing the user to the copy of this /LFHQVH$OVR\RXPXVWGRRQHRIWKHVHWKLQJV a) Accompany the work with the complete corresponding PDFKLQHUHDGDEOH VRXUFH FRGH IRU WKH /LEUDU\ LQFOXGLQJ whatever changes were used in the work (which must be GLVWULEXWHG XQGHU 6HFWLRQV DQG DERYH DQG LI WKH ZRUN LV DQ H[HFXWDEOH OLQNHG ZLWK WKH /LEUDU\ ZLWK WKH FRPSOHWH PDFKLQHUHDGDEOHZRUNWKDWXVHVWKH/LEUDU\DVREMHFWFRGH DQGRU VRXUFH FRGH VR WKDW WKH XVHU FDQ PRGLI\ WKH /LEUDU\ DQG WKHQ UHOLQN WR SURGXFH D PRGL¿HG H[HFXWDEOH FRQWDLQLQJ WKHPRGL¿HG/LEUDU\ ,W LV XQGHUVWRRG WKDW WKH XVHU ZKR FKDQJHV WKH FRQWHQWV RI GH¿QLWLRQV ¿OHV LQ WKH /LEUDU\ ZLOO QRW QHFHVVDULO\ EH DEOH WR UHFRPSLOH WKH DSSOLFDWLRQ WR XVH WKH PRGL¿HG GH¿QLWLRQV b) Use a suitable shared library mechanism for linking with WKH /LEUDU\$ VXLWDEOH PHFKDQLVP LV RQH WKDW XVHV DW UXQ WLPH D FRS\ RI WKH OLEUDU\ DOUHDG\ SUHVHQW RQ WKH XVHU V computer system, rather than copying library functions into WKHH[HFXWDEOHDQGZLOORSHUDWHSURSHUO\ZLWKDPRGL¿HG version of the library, if the user installs one, as long as the PRGL¿HGYHUVLRQLVLQWHUIDFHFRPSDWLEOHZLWKWKHYHUVLRQWKDW the work was made with.c) Accompany the work with a written offer, valid for at least three years, to give the same user WKHPDWHULDOVVSHFL¿HGLQ6XEVHFWLRQDDERYHIRUDFKDUJH QR PRUH WKDQ WKH FRVW RI SHUIRUPLQJ WKLV GLVWULEXWLRQ G ,I distribution of the work is made by offering access to copy from a designated place, offer equivalent access to copy the DERYHVSHFL¿HGPDWHULDOVIURPWKHVDPHSODFHH9HULI\WKDW the user has already received a copy of these materials or WKDW\RXKDYHDOUHDG\VHQWWKLVXVHUDFRS\)RUDQH[HFXWDEOH 46 WKH UHTXLUHG IRUP RI WKH ZRUN WKDW XVHV WKH /LEUDU\ PXVW include any data and utility programs needed for reproducing WKHH[HFXWDEOHIURPLW+RZHYHUDVDVSHFLDOH[FHSWLRQWKH materials to be distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the RSHUDWLQJ V\VWHP RQ ZKLFK WKH H[HFXWDEOH UXQV XQOHVV WKDW FRPSRQHQWLWVHOIDFFRPSDQLHVWKHH[HFXWDEOH,WPD\KDSSHQ that this requirement contradicts the license restrictions of other proprietary libraries that do not normally accompany the operating system. Such a contradiction means you cannot use ERWKWKHPDQGWKH/LEUDU\WRJHWKHULQDQH[HFXWDEOHWKDW\RX GLVWULEXWH <RX PD\ SODFH OLEUDU\ IDFLOLWLHV WKDW DUH D ZRUN EDVHG RQ WKH /LEUDU\ VLGHE\VLGH LQ D VLQJOH OLEUDU\ WRJHWKHU ZLWK RWKHU OLEUDU\ IDFLOLWLHV QRW FRYHUHG E\ WKLV /LFHQVH DQG distribute such a combined library, provided that the separate GLVWULEXWLRQRIWKHZRUNEDVHGRQWKH/LEUDU\DQGRIWKHRWKHU library facilities is otherwise permitted, and provided that you GRWKHVHWZRWKLQJVD$FFRPSDQ\WKHFRPELQHGOLEUDU\ZLWK D FRS\ RI WKH VDPH ZRUN EDVHG RQ WKH /LEUDU\ XQFRPELQHG with any other library facilities. This must be distributed under the terms of the Sections above. b) Give prominent notice with the combined library of the fact that part of it is a work based RQWKH/LEUDU\DQGH[SODLQLQJZKHUHWR¿QGWKHDFFRPSDQ\LQJ uncombined form of the same work. <RXPD\QRWFRS\PRGLI\VXEOLFHQVHOLQNZLWKRUGLVWULEXWH WKH /LEUDU\ H[FHSW DV H[SUHVVO\ SURYLGHG XQGHU WKLV /LFHQVH Any attempt otherwise to copy, modify, sublicense, link with, or GLVWULEXWHWKH/LEUDU\LVYRLGDQGZLOODXWRPDWLFDOO\WHUPLQDWH \RXU ULJKWV XQGHU WKLV /LFHQVH +RZHYHU SDUWLHV ZKR KDYH UHFHLYHG FRSLHV RU ULJKWV IURP \RX XQGHU WKLV /LFHQVH ZLOO not have their licenses terminated so long as such parties UHPDLQ LQ IXOO FRPSOLDQFH <RX DUH QRW UHTXLUHG WR DFFHSW WKLV/LFHQVHVLQFH\RXKDYHQRWVLJQHGLW+RZHYHUQRWKLQJ HOVHJUDQWV\RXSHUPLVVLRQWRPRGLI\RUGLVWULEXWHWKH/LEUDU\ or its derivative works. These actions are prohibited by law LI\RXGRQRWDFFHSWWKLV/LFHQVH7KHUHIRUHE\PRGLI\LQJRU GLVWULEXWLQJ WKH /LEUDU\ RU DQ\ ZRUN EDVHG RQ WKH /LEUDU\ \RXLQGLFDWH\RXUDFFHSWDQFHRIWKLV/LFHQVHWRGRVRDQGDOO its terms and conditions for copying, distributing or modifying WKH/LEUDU\RUZRUNVEDVHGRQLW(DFKWLPH\RXUHGLVWULEXWH WKH/LEUDU\RUDQ\ ZRUN EDVHG RQ WKH /LEUDU\ WKH UHFLSLHQW automatically receives a license from the original licensor to FRS\ GLVWULEXWH OLQN ZLWK RU PRGLI\ WKH /LEUDU\ VXEMHFW WR WKHVHWHUPVDQGFRQGLWLRQV<RXPD\QRWLPSRVHDQ\IXUWKHU UHVWULFWLRQV RQ WKH UHFLSLHQWV H[HUFLVH RI WKH ULJKWV JUDQWHG KHUHLQ <RX DUH QRW UHVSRQVLEOH IRU HQIRUFLQJ FRPSOLDQFH E\ WKLUG SDUWLHV ZLWK WKLV /LFHQVH ,I DV D FRQVHTXHQFH RI D court judgment or allegation of patent infringement or for any other reason (not limited to patent issues), conditions are imposed on you (whether by court order, agreement or RWKHUZLVHWKDWFRQWUDGLFWWKHFRQGLWLRQVRIWKLV/LFHQVHWKH\ GRQRWH[FXVH\RXIURPWKHFRQGLWLRQVRIWKLV/LFHQVH,I\RX cannot distribute so as to satisfy simultaneously your obligations XQGHU WKLV /LFHQVH DQG DQ\ RWKHU SHUWLQHQW REOLJDWLRQV WKHQ DV D FRQVHTXHQFH \RX PD\ QRW GLVWULEXWH WKH /LEUDU\ DW DOO )RUH[DPSOHLIDSDWHQWOLFHQVHZRXOGQRWSHUPLWUR\DOW\IUHH UHGLVWULEXWLRQ RI WKH /LEUDU\ E\ DOO WKRVH ZKR UHFHLYH FRSLHV directly or indirectly through you, then the only way you could VDWLVI\ERWKLWDQGWKLV/LFHQVHZRXOGEHWRUHIUDLQHQWLUHO\IURP GLVWULEXWLRQRIWKH/LEUDU\,IDQ\SRUWLRQRIWKLVVHFWLRQLVKHOG invalid or unenforceable under any particular circumstance, the balance of the section is intended to apply, and the section DV D ZKROH LV LQWHQGHG WR DSSO\ LQ RWKHU FLUFXPVWDQFHV ,W LV not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of DQ\VXFKFODLPVWKLVVHFWLRQKDVWKHVROHSXUSRVHRISURWHFWLQJ the integrity of the free software distribution system which is LPSOHPHQWHG E\ SXEOLF OLFHQVH SUDFWLFHV 0DQ\ SHRSOH KDYH made generous contributions to the wide range of software distributed through that system in reliance on consistent DSSOLFDWLRQ RI WKDW V\VWHP LW LV XS WR WKH DXWKRUGRQRU WR decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is believed *HQHUDO 3XEOLF /LFHQVH DORQJ ZLWK WKLV OLEUDU\ LI QRW ZULWH WR WKH )UHH 6RIWZDUH )RXQGDWLRQ ,QF )UDQNOLQ 6WUHHW )LIWK )ORRU%RVWRQ0$86$$OVRDGGLQIRUPDWLRQRQ KRZWRFRQWDFW\RXE\HOHFWURQLFDQGSDSHUPDLO<RXVKRXOG also get your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the library, if QHFHVVDU\+HUHLVDVDPSOHDOWHUWKHQDPHV<R\RG\QH,QF KHUHE\GLVFODLPVDOOFRS\ULJKWLQWHUHVW LQWKHOLEUDU\C)URE D OLEUDU\IRUWZHDNLQJNQREVZULWWHQE\-DPHV5DQGRP+DFNHU VLJQDWXUH RI 7\ &RRQ! $SULO 7\ &RRQ 3UHVLGHQW RI 9LFH7KDW VDOOWKHUHLVWRLW libcurl &23<5,*+7 $1' 3(50,66,21 127,&( &RS\ULJKW F 'DQLHO6WHQEHUJGDQLHO#KD[[VH!$OOULJKWVUHVHUYHG Permission to use, copy, modify, and distribute this software for any purpose with or without fee is hereby granted, provided that the above copyright notice and this permission notice DSSHDU LQ DOO FRSLHV 7+( 62)7:$5( ,6 3529,'(' $6 ,6 :,7+287 :$55$17< 2) $1< .,1' (;35(66 25 ,03/,(' ,1&/8',1* %87 127 /,0,7(' 72 7+( :$55$17,(6 2) 0(5&+$17$%,/,7<),71(66)25$3$57,&8/$5385326($1' 121,1)5,1*(0(172)7+,5'3$57<5,*+76,112(9(17 6+$// 7+( $87+256 25 &23<5,*+7 +2/'(56 %( /,$%/( )25$1<&/$,0'$0$*(62527+(5/,$%,/,7<:+(7+(5 ,1$1$&7,212)&2175$&772572527+(5:,6($5,6,1* )5202872)25,1&211(&7,21:,7+7+(62)7:$5(25 7+( 86( 25 27+(5 '($/,1*6 ,1 7+( 62)7:$5( ([FHSW as contained in this notice, the name of a copyright holder shall not be used in advertising or otherwise to promote the sale, use or other dealings in this Software without prior written authorization of the copyright holder. libjpeg-7.txt /(*$/,668(6 ============ ,QSODLQ(QJOLVK :HGRQ¶WSURPLVHWKDWWKLVVRIWZDUHZRUNV%XWLI\RX¿QG DQ\EXJVSOHDVHOHWXVNQRZ <RXFDQXVHWKLVVRIWZDUHIRUZKDWHYHU\RXZDQW<RXGRQ¶W have to pay us. <RXPD\QRWSUHWHQGWKDW\RXZURWHWKLVVRIWZDUH,I\RX use it in a program, you must acknowledge somewhere in your GRFXPHQWDWLRQWKDW\RX¶YHXVHGWKH,-*FRGH ,QOHJDOHVH 7KH DXWKRUV PDNH 12 :$55$17< RU UHSUHVHQWDWLRQ HLWKHU H[SUHVV RU LPSOLHG ZLWK UHVSHFW WR WKLV VRIWZDUH LWV TXDOLW\ DFFXUDF\ PHUFKDQWDELOLW\ RU ¿WQHVV IRU D SDUWLFXODU SXUSRVH 7KLV VRIWZDUH LV SURYLGHG ³$6 ,6´ DQG \RX LWV XVHU DVVXPH the entire risk as to its quality and accuracy. This software is FRS\ULJKW&7KRPDV*/DQH*XLGR9ROOEHGLQJ $OO 5LJKWV 5HVHUYHG H[FHSW DV VSHFL¿HG EHORZ 3HUPLVVLRQ is hereby granted to use, copy, modify, and distribute this software (or portions thereof) for any purpose, without fee, subject to these FRQGLWLRQV ,IDQ\SDUWRIWKHVRXUFHFRGHIRUWKLVVRIWZDUHLVGLVWULEXWHG WKHQ WKLV 5($'0( ¿OH PXVW EH LQFOXGHG ZLWK WKLV FRS\ULJKW DQGQRZDUUDQW\QRWLFHXQDOWHUHGDQGDQ\DGGLWLRQVGHOHWLRQV RU FKDQJHV WR WKH RULJLQDO ¿OHV PXVW EH FOHDUO\ LQGLFDWHG LQ accompanying documentation. ,IRQO\H[HFXWDEOHFRGHLVGLVWULEXWHGWKHQWKHDFFRPSDQ\LQJ documentation must state that “this software is based in part RQWKHZRUNRIWKH,QGHSHQGHQW-3(**URXS´ (3) Permission for use of this software is granted only if the user DFFHSWV IXOO UHVSRQVLELOLW\ IRU DQ\ XQGHVLUDEOH FRQVHTXHQFHV WKHDXWKRUVDFFHSW12/,$%,/,7<IRUGDPDJHVRIDQ\NLQG These conditions apply to any software derived from or based RQWKH,-*FRGHQRWMXVWWRWKHXQPRGL¿HGOLEUDU\,I\RXXVH RXU ZRUN \RX RXJKW WR DFNQRZOHGJH XV 3HUPLVVLRQ LV 127 JUDQWHGIRUWKHXVHRIDQ\,-*DXWKRU¶VQDPHRUFRPSDQ\QDPH in advertising or publicity relating to this software or products derived from it. This software may be referred to only as “the ,QGHSHQGHQW-3(**URXS¶VVRIWZDUH´:HVSHFL¿FDOO\SHUPLWDQG encourage the use of this software as the basis of commercial 47 English WR EH D FRQVHTXHQFH RI WKH UHVW RI WKLV /LFHQVH ,I WKH GLVWULEXWLRQ DQGRU XVH RI WKH /LEUDU\ LV UHVWULFWHG LQ FHUWDLQ countries either by patents or by copyrighted interfaces, the RULJLQDO FRS\ULJKW KROGHU ZKR SODFHV WKH /LEUDU\ XQGHU WKLV /LFHQVHPD\DGGDQH[SOLFLWJHRJUDSKLFDOGLVWULEXWLRQOLPLWDWLRQ H[FOXGLQJWKRVHFRXQWULHVVRWKDWGLVWULEXWLRQLVSHUPLWWHGRQO\ LQ RU DPRQJ FRXQWULHV QRW WKXV H[FOXGHG ,Q VXFK FDVH WKLV /LFHQVHLQFRUSRUDWHVWKHOLPLWDWLRQDVLIZULWWHQLQWKHERG\RI WKLV /LFHQVH 7KH )UHH 6RIWZDUH )RXQGDWLRQ PD\ SXEOLVK UHYLVHGDQGRUQHZYHUVLRQVRIWKH/HVVHU*HQHUDO3XEOLF/LFHQVH from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing YHUVLRQ QXPEHU ,I WKH /LEUDU\ VSHFL¿HV D YHUVLRQ QXPEHU RI WKLV /LFHQVH ZKLFK DSSOLHV WR LW DQG DQ\ ODWHU YHUVLRQ \RX have the option of following the terms and conditions either of that version or of any later version published by the Free 6RIWZDUH)RXQGDWLRQ,IWKH/LEUDU\GRHVQRWVSHFLI\DOLFHQVH version number, you may choose any version ever published by WKH )UHH 6RIWZDUH )RXQGDWLRQ ,I \RX ZLVK WR LQFRUSRUDWH SDUWVRIWKH/LEUDU\LQWRRWKHUIUHHSURJUDPVZKRVHGLVWULEXWLRQ conditions are incompatible with these, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the Free Software )RXQGDWLRQ ZH VRPHWLPHV PDNH H[FHSWLRQV IRU WKLV 2XU decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. 12:$55$17<%(&$86(7+(/,%5$5<,6 /,&(16(' )5(( 2) &+$5*( 7+(5( ,6 12 :$55$17< )25 7+( /,%5$5< 72 7+( (;7(17 3(50,77(' %< $33/,&$%/( /$: (;&(37 :+(1 27+(5:,6( 67$7(' ,1 :5,7,1* 7+( &23<5,*+7+2/'(56$1'2527+(53$57,(63529,'(7+( /,%5$5<$6,6:,7+287:$55$17<2)$1<.,1'(,7+(5 (;35(66(' 25 ,03/,(' ,1&/8',1* %87 127 /,0,7(' 72 7+( ,03/,(' :$55$17,(6 2) 0(5&+$17$%,/,7< $1' ),71(66 )25 $ 3$57,&8/$5 385326( 7+( (17,5( 5,6. $6727+(48$/,7<$1'3(5)250$1&(2)7+(/,%5$5<,6 :,7+ <28 6+28/' 7+( /,%5$5< 3529( '()(&7,9( <28 $66807+( &267 2) $// 1(&(66$5< 6(59,&,1* 5(3$,5 25 &255(&7,21] ,1 12 (9(17 81/(66 5(48,5(' %< $33/,&$%/( /$: 25 $*5((' 72 ,1 :5,7,1* :,// $1< &23<5,*+7 +2/'(5 25 $1< 27+(5 3$57< :+2 0$< 02',)<$1'255(',675,%87(7+(/,%5$5<$63(50,77(' $%29(%(/,$%/(72<28)25'$0$*(6,1&/8',1*$1< *(1(5$/ 63(&,$/ ,1&,'(17$/ 25 &216(48(17,$/ '$0$*(6$5,6,1*2872)7+(86(25,1$%,/,7<7286( 7+( /,%5$5< ,1&/8',1* %87 127 /,0,7(' 72 /266 2) '$7$ 25 '$7$ %(,1* 5(1'(5(' ,1$&&85$7( 25 /266(6 6867$,1('%<<28257+,5'3$57,(625$)$,/85(2)7+( /,%5$5<7223(5$7(:,7+$1<27+(562)7:$5((9(1 ,) 68&+ +2/'(5 25 27+(5 3$57< +$6 %((1 $'9,6(' 2) 7+(3266,%,/,7<2)68&+'$0$*(6 (1' 2) 7(506 $1' &21',7,216 +RZ WR $SSO\ 7KHVH 7HUPV WR <RXU1HZ/LEUDULHV,I\RXGHYHORSDQHZOLEUDU\DQG\RXZDQWLW to be of the greatest possible use to the public, we recommend making it free software that everyone can redistribute DQG FKDQJH <RX FDQ GR VR E\ SHUPLWWLQJ UHGLVWULEXWLRQ under these terms (or, alternatively, under the terms of the RUGLQDU\*HQHUDO3XEOLF/LFHQVH7RDSSO\WKHVHWHUPVDWWDFK WKHIROORZLQJQRWLFHVWRWKHOLEUDU\,WLVVDIHVWWRDWWDFKWKHP WRWKHVWDUWRIHDFKVRXUFH¿OHWRPRVWHIIHFWLYHO\FRQYH\WKH H[FOXVLRQ RI ZDUUDQW\ DQG HDFK ¿OH VKRXOG KDYH DW OHDVW WKH "copyright" line and a pointer to where the full notice is found. RQHOLQHWRJLYHWKHOLEUDU\ VQDPHDQGDEULHILGHDRIZKDWLW GRHV!&RS\ULJKW&\HDU!QDPHRIDXWKRU! 7KLV OLEUDU\ LV IUHH VRIWZDUH \RX FDQ UHGLVWULEXWH LW DQGRU PRGLI\LWXQGHUWKHWHUPVRIWKH*18/HVVHU*HQHUDO3XEOLF /LFHQVHDVSXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQHLWKHU YHUVLRQRIWKH/LFHQVHRUDW\RXURSWLRQDQ\ODWHUYHUVLRQ This library is distributed in the hope that it will be useful, but :,7+287$1<:$55$17<ZLWKRXWHYHQWKHLPSOLHGZDUUDQW\ RI 0(5&+$17$%,/,7< RU ),71(66 )25 $ 3$57,&8/$5 385326(6HHWKH*18/HVVHU*HQHUDO3XEOLF/LFHQVHIRUPRUH GHWDLOV <RX VKRXOG KDYH UHFHLYHG D FRS\ RI WKH *18 /HVVHU products, provided that all warranty or liability claims are assumed by the product vendor. ansi2knr.c is included in this English GLVWULEXWLRQE\SHUPLVVLRQRI/3HWHU'HXWVFKVROHSURSULHWRURILWV FRS\ULJKWKROGHU$ODGGLQ(QWHUSULVHVRI0HQOR3DUN&$ DQVLNQUF LV 127 FRYHUHG E\ WKH DERYH FRS\ULJKW DQG FRQGLWLRQV but instead by the usual distribution terms of the Free Software )RXQGDWLRQ SULQFLSDOO\ WKDW \RX PXVW LQFOXGH VRXUFH FRGH LI \RX UHGLVWULEXWH LW 6HH WKH ¿OH DQVLNQUF IRU IXOO GHWDLOV +RZHYHU since ansi2knr.c is not needed as part RI DQ\ SURJUDP JHQHUDWHG IURP WKH ,-* FRGH WKLV GRHV QRW OLPLW \RXPRUHWKDQWKHIRUHJRLQJSDUDJUDSKVGR7KH8QL[FRQ¿JXUDWLRQ VFULSW³FRQ¿JXUH´ZDVSURGXFHGZLWK*18$XWRFRQI,WLVFRS\ULJKW by the Free Software Foundation but is freely distributable. The same KROGVIRULWVVXSSRUWLQJVFULSWVFRQ¿JJXHVVFRQ¿JVXEOWPDLQVK $QRWKHUVXSSRUWVFULSWLQVWDOOVKLVFRS\ULJKWE\;&RQVRUWLXPEXWLV DOVRIUHHO\GLVWULEXWDEOH7KH,-*GLVWULEXWLRQIRUPHUO\LQFOXGHGFRGH WRUHDGDQGZULWH*,)¿OHV7RDYRLGHQWDQJOHPHQWZLWKWKH8QLV\V /=:SDWHQW*,)UHDGLQJVXSSRUWKDVEHHQUHPRYHGDOWRJHWKHUDQG WKH*,)ZULWHUKDVEHHQVLPSOL¿HGWRSURGXFH ³XQFRPSUHVVHG *,)V´ 7KLV WHFKQLTXH GRHV QRW XVH WKH /=: DOJRULWKP WKH UHVXOWLQJ *,) ¿OHV DUH ODUJHU WKDQ XVXDO EXW DUH UHDGDEOHE\DOOVWDQGDUG*,)GHFRGHUV :HDUHUHTXLUHGWRVWDWHWKDW ³7KH *UDSKLFV ,QWHUFKDQJH )RUPDWF LV WKH &RS\ULJKW SURSHUW\ RI &RPSX6HUYH,QFRUSRUDWHG*,)VPLVD6HUYLFH0DUNSURSHUW\RI &RPSX6HUYH,QFRUSRUDWHG´ KWPO! KHDG! WLWOH!5XQWLPH(UURUWLWOH! VW\OH! ERG\^IRQWIDPLO\´9HUGDQD´IRQWZHLJKWQRUPDO IRQWVL]HHPFRORUEODFN` S^IRQWIDPLO\´9HUGDQD´IRQWZHLJKWQRUPDOFRORUEODFN PDUJLQWRSS[` E ^IRQWIDPLO\´9HUGDQD´IRQWZHLJKWEROGFRORUEODFNPDUJLQWRS S[` +^IRQWIDPLO\´9HUGDQD´IRQWZHLJKWQRUPDO IRQWVL]HSWFRORUUHG` +^IRQWIDPLO\´9HUGDQD´IRQWZHLJKWQRUPDO IRQWVL]HSWFRORUPDURRQ` SUH^IRQWIDPLO\´/XFLGD&RQVROH´IRQWVL]HHP` PDUNHU^IRQWZHLJKWEROGFRORUEODFNWH[WGHFRUDWLRQQRQH` YHUVLRQ^FRORUJUD\` HUURU^PDUJLQERWWRPS[` H[SDQGDEOH^WH[WGHFRUDWLRQXQGHUOLQHIRQWZHLJKW EROGFRORUQDY\FXUVRUKDQG` VW\OH! KHDG! ERG\EJFRORU ´ZKLWH´! VSDQ!+!6HUYHU(UURULQµ¶$SSOLFDWLRQKUZLGWK VL]H FRORU VLOYHU!+! K!L!5XQWLPH(UURUL!K!VSDQ! IRQW IDFH ´$ULDO +HOYHWLFD *HQHYD 6XQ6DQV5HJXODU VDQVVHULI ³! E!'HVFULSWLRQE!$QDSSOLFDWLRQHUURURFFXUUHGRQWKHVHUYHU The current custom error settings for this application prevent the details of the application error from being viewed remotely (for VHFXULW\UHDVRQV,WFRXOGKRZHYHUEHYLHZHGE\EURZVHUVUXQQLQJ on the local server machine. EU!EU! E!'HWDLOVE! 7R HQDEOH WKH GHWDLOV RI WKLV VSHFL¿F HUURU message to be viewable on remote machines, please create D OWFXVWRP(UURUVJW WDJ ZLWKLQ D TXRWZHEFRQ¿JTXRW FRQ¿JXUDWLRQ ¿OH ORFDWHG LQ WKH URRW GLUHFWRU\ RI WKH FXUUHQW ZHE DSSOLFDWLRQ 7KLV OWFXVWRP(UURUVJW WDJ VKRXOG WKHQ KDYH LWV TXRWPRGHTXRWDWWULEXWHVHWWRTXRW2IITXRWEU!EU! WDEOHZLGWK EJFRORU ´IIIIFF´! WU! WG! FRGH!SUH! OW:HE&RQ¿J&RQ¿JXUDWLRQ)LOHJW OWFRQ¿JXUDWLRQJW OWV\VWHPZHEJW OWFXVWRP(UURUVPRGH TXRW2IITXRWJW OWV\VWHPZHEJW OWFRQ¿JXUDWLRQJWSUH!FRGH! WG! WU! WDEOH! EU! E!1RWHVE! 7KH FXUUHQW HUURU SDJH \RX DUH VHHLQJ 48 can be replaced by a custom error page by modifying the TXRWGHIDXOW5HGLUHFWTXRW DWWULEXWH RI WKH DSSOLFDWLRQ¶V OWFXVWRP(UURUVJW FRQ¿JXUDWLRQ WDJ WR SRLQW WR D FXVWRP HUURU SDJH85/EU!EU! WDEOHZLGWK EJFRORU ´IIIIFF´! WU! WG! FRGH!SUH! OW:HE&RQ¿J&RQ¿JXUDWLRQ)LOHJW OWFRQ¿JXUDWLRQJW OWV\VWHPZHEJW OWFXVWRP(UURUV PRGH TXRW5HPRWH2QO\TXRW GHIDXOW5HGLUHFW TXRWP\FXVWRPSDJHKWPTXRWJW OWV\VWHPZHEJW OWFRQ¿JXUDWLRQJWSUH!FRGH! WG! WU! WDEOH! Unicode_Bidirectional_Algorithm 81,&2'( ,1& /,&(16( $*5((0(17 '$7$ ),/(6 $1' 62)7:$5( 8QLFRGH 'DWD )LOHV LQFOXGH DOO GDWD ¿OHV XQGHU WKH GLUHFWRULHV KWWSZZZXQLFRGHRUJ3XEOLF KWWSZZZXQLFRGHRUJUHSRUWV DQGKWWSZZZXQLFRGHRUJFOGUGDWD8QLFRGH6RIWZDUHLQFOXGHV any source code published in the Unicode Standard or under the GLUHFWRULHV KWWSZZZXQLFRGHRUJ3XEOLF KWWSZZZXQLFRGH RUJUHSRUWVDQGKWWSZZZXQLFRGHRUJFOGUGDWD 127,&(7286(5&DUHIXOO\UHDGWKHIROORZLQJOHJDODJUHHPHQW %<'2:1/2$',1*,167$//,1*&23<,1*2527+(5:,6(86,1* 81,&2'(,1& 6'$7$),/(6'$7$),/(6$1'2562)7:$5( 62)7:$5( <28 81(48,92&$//< $&&(37 $1' $*5(( 72 %( %281' %< $// 2) 7+( 7(506 $1' &21',7,216 2) 7+,6 $*5((0(17,)<28'2127$*5(('2127'2:1/2$',167$// &23<',675,%87(2586(7+('$7$),/(62562)7:$5( &23<5,*+7$1'3(50,66,21127,&( &RS\ULJKWF8QLFRGH,QF$OOULJKWVUHVHUYHG'LVWULEXWHG XQGHUWKH7HUPVRI8VHLQKWWSZZZXQLFRGHRUJFRS\ULJKWKWPO Permission is hereby granted, free of charge, to any person REWDLQLQJ D FRS\ RI WKH 8QLFRGH GDWD ¿OHV DQG DQ\ DVVRFLDWHG documentation (the ""Data Files"") or Unicode software and any associated documentation (the ""Software"") to deal in the Data Files or Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, and/or sell copies of the Data Files or Software, and to permit persons to whom the Data Files or Software are furnished to do so, provided that (a) the above copyright notice(s) and this permission notice appear with all copies of the Data Files or Software, (b) both the above copyright notice(s) and this permission notice appear in associated documentation, and FWKHUHLVFOHDUQRWLFHLQHDFKPRGL¿HG'DWD)LOHRULQWKH6RIWZDUH as well as in the documentation associated with the Data File(s) or 6RIWZDUHWKDWWKHGDWDRUVRIWZDUHKDVEHHQPRGL¿HG 7+( '$7$ ),/(6 $1' 62)7:$5( $5( 3529,'(' $6 ,6 :,7+287 :$55$17< 2) $1< .,1' (;35(66 25 ,03/,(' ,1&/8',1* %87 127 /,0,7(' 72 7+( :$55$17,(6 2) 0(5&+$17$%,/,7< ),71(66 )25 $ 3$57,&8/$5 385326( $1' 121,1)5,1*(0(17 2) 7+,5' 3$57< 5,*+76 ,1 12 (9(17 6+$//7+(&23<5,*+7+2/'(525+2/'(56,1&/8'(',17+,6 127,&( %( /,$%/( )25 $1< &/$,0 25 $1< 63(&,$/ ,1',5(&7 25 &216(48(17,$/ '$0$*(6 25 $1< '$0$*(6 :+$762(9(5 5(68/7,1*)520/2662)86('$7$25352),76:+(7+(5,1 $1 $&7,21 2) &2175$&7 1(*/,*(1&( 25 27+(5 7257,286 $&7,21$5,6,1*2872)25,1&211(&7,21:,7+7+(86(25 3(5)250$1&(2)7+('$7$),/(62562)7:$5( ([FHSWDVFRQWDLQHGLQWKLVQRWLFHWKHQDPHRIDFRS\ULJKWKROGHU shall not be used in advertising or otherwise to promote the sale, use or other dealings in these Data Files or Software without prior written authorization of the copyright holder." Blu-ray DiscTM-Player BDX1250KE Bedienungsanleitung Inhalt Wichtig . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-4 Sicherheit und wichtige Hinweise . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Entsorgung des alten Produkts und der Batterien . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-4 2 Produktüberblick. Regionalcodes . . . . Produktüberblick . . . Fernbedienung . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5-7 .. 5 .. 6 .. 7 3 Anschlüsse. . . . . . . . . . . . . . . . . . Anschluss an ein TV-Gerät . . . . . . . . Optionaler Anschluss . . . . . . . . . . . . Anschluss eines USB-Datenspeichers. Netzanschluss. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8-9 .. 8 .. 8 .. 9 .. 9 4 Vorbereitung . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 Vorbereitung der Fernbedienung. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 Einrichtung des Players . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 5 Wiedergabe . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-13 Wiedergabe-Funktionen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-13 6 Individuelle Anpassung. Allgemeine Einstellungen . . Anzeige-Einstellungen . . . . Audio-Einstellungen. . . . . . System-Informationen . . . . 7 Technische Daten . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 8 Fehlerbeseitigung . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22-23 9 Glossar. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24-25 D 1 2 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14-20 14-18 18-19 . . 20 . . 20 Entsorgung des alten Produkts und der Batterien Sicherheit und wichtige Hinweise Warnung: hEHUKLW]XQJVJHIDKU6WHOOHQ6LHGDV3URGXNW niemals in einem beengten Raum auf. Für die Belüftung sollte immer mindestens 10 cm Freiraum auf allen Seiten bestehen. Stellen Sie sicher, dass niemals Gardinen oder andere Objekte die Belüftungsschlitze des Produkts abdecken. %ULQJHQ6LHGDV3URGXNWGLH)HUQVWHXHUXQJ oder Batterien niemals in die Nähe von offenem Feuer oder anderen Wärmequellen, einschließlich direktem Sonnenlicht. 9HUZHQGHQ6LHGLHVHV3URGXNWQXULQ Innenräumen. Halten Sie dieses Produkt von :DVVHU)HXFKWLJNHLWXQGÀVVLJNHLWVJHIOOWHQ Gegenständen fern. 6WHOOHQ6LHGLHVHV3URGXNWQLHPDOVDXIDQGHUH Elektrogeräte. +DOWHQ6LHZlKUHQG*HZLWWHUQ$EVWDQGYRP Gerät. :HQQGHU1HW]VWHFNHURGHUHLQH Gerätekupplung als Netztrenngerät verwendet wird, muss dieses Netztrenngerät immer leicht zugänglich sein. LASER VORSICHT: WENN ANDERE ALS DIE HIERIN ANGEGEBENEN BEDIENUNGS- UND VERFAHRENSWEISEN $86*()h+57:(5'(1.$11',(6=8 GEFÄHRLICHER STRAHLUNGSEXPOSITION )h+5(1 VORSICHT: SICHTBARE UND UNSICHTBARE LASERSTRAHLUNG BEI ÖFFNUNG UND BESCHÄDIGTEN VERRIEGELUNGEN. NICHT IN DEN STRAHL SEHEN. ORT: INNEN, IN DER NÄHE DER LAUFWERKMECHANIK. Hinweis zur Einhaltung der EU-Richtlinien Dieses Produkt ist mit der „CE”-Kennzeichnung markiert und entspricht den zutreffenden harmonisierten europäischen Normen, der Niederspannungsrichtlinie 2006/95/EC und der EMC-Richtlinie 2004/108/EC. ErP-Richtlinie 2009/125/EC Verantwortlich für die CE-Markierung ist TOSHIBA EUROPE GMBH Hammfelddamm 8, D-41460 Neuss, Deutschland. Pb,Hg,Cd Folgende Informationen sind nur für EU-Mitgliedstaaten gültig: Entsorgung des Produkts Das durchgestrichene Mülltonnensymbol zeigt an, dass die Produkte gesammelt und separat vom Hausmüll entsorgt werden müssen. Integrierte Batterien und Akkus können mit dem Produkt entsorgt werden. Sie werden in den Recycling-Zentren getrennt. Der schwarze Balken zeigt an, dass die Produktmarkteinführung nach dem 13. August 2005 stattgefunden hat. Durch die Mitwirkung an der separaten Sammlung von Produkten und Batterien unterstützen Sie die korrekte Entsorgung der Produkte und Batterien und helfen somit, mögliche negative Auswirkungen auf die Umwelt und die menschliche Gesundheit zu vermeiden. Für detailliertere Informationen über Abfallsammlung und Recyclingprogramme, die in Ihrem Land zur Verfügung stehen, kontaktieren Sie den Händler, bei dem Sie das Produkt erworben haben. Entsorgung von Batterien und/oder Akkus Das durchgestrichene Mülltonnensymbol zeigt an, dass die Batterien und/oder Akkus gesammelt und separat vom Hausmüll entsorgt werden müssen. Wenn die Batterie oder der Akku mehr als die angegebenen Werte von Blei (Pb), Quecksilber (Hg) und/oder Kadmium (Cd) enthalten, die in der Batterie-Richtlinie (2006/66/EC) definiert werden, dann erscheinen die chemischen Symbole für Blei (Pb), Quecksilber (Hg) und/oder Kadmium (Cd) unter dem durchgestrichenen Mülltonnensymbol. Durch die Mitwirkung an der separaten Sammlung von Batterien unterstützen Sie die korrekte Entsorgung der Produkte und Batterien und helfen somit, mögliche negative Auswirkungen auf die Umwelt zu verhindern. Für detailliertere Informationen über Abfallsammlung und Recyclingprogramme, die in Ihrem Land zur Verfügung stehen kontaktieren Sie den Händler, bei dem Sie das Produkt erworben haben. Copyright-Hinweis Dieses Produkt enthält Copyright-geschützte Technologie, die durch US-Patente und andere Rechte für geistiges Eigentum geschützt sind. Die Nutzung dieser Copyright-geschützten Technologie muss von der Rovi Corporation autorisiert sein und ist nur für die Heimanwendung und andere eingeschränkte Vorführanwendungen bestimmt, sofern keine anderslautende Autorisierung durch die Rovi Corporation vorliegt. Reverse Engineering und Demontage sind verboten. 3 D 1 Wichtig Hinweis zu Markenzeichen D +'0,GDV+'0,/RJRXQG+LJK'H¿QLWLRQ Multimedia Interface sind Warenzeichen oder eingetragene Warenzeichen der HDMI Licensing LLC in den Vereinigten Staaten und anderen Ländern. BONUSVIEW ™ Blu-ray DiscTM, Blu-rayTM, BD-LiveTM, BONUSVIEWTM und die Logos sind Warenzeichen der Blu-ray Disc Association. Hergestellt unter Lizenz von Dolby Laboratories. Dolby und das Doppel-D-Symbol sind Warenzeichen von Dolby Laboratories. Oracle und Java sind eingetragene Warenzeichen von Oracle und/oder dessen Tochtergesellschaften. Andere Namen können Warenzeichen ihrer jeweiligen Eigentümer sein. h%(5',9;9,'(2 DivX® ein digitales Videoformat, das von DivX, ,QFHQWZLFNHOWZXUGH'LHVLVWHLQRI¿]LHOO DivX®]HUWL¿]LHUWHV*HUlWGDV'LY;9LGHRV wiedergibt. Besuchen Sie www.divx.com für weitere Informationen und Software, um Ihre Dateien in DivX-Videodateien umzuwandeln. h%(5',9;9,'(221'(0$1'),/0($8) ABRUF: 'LHVHV'LY;&HUWL¿HG®-Gerät muss registriert werden, um erworbene DivX Video-on-Demand (VOD)-Filme wiederzugeben. Um Ihren Registriercode zu erhalten, suchen Sie den DivX-VOD-Abschnitt im Einrichtungsmenü des Geräts. Weitere Informationen zur Registrierung ¿QGHQ6LHXQWHUZZZYRGGLY[FRP DivX®'LY;&HUWL¿HG® und zugehörige Logos sind Markenzeichen von DivX, Inc. und werden lizenziert verwendet. Hergestellt unter Lizenz unter U.S.-Patentnummern: 5,956,674; 5,974,380; 6,226,616; 6,487,535; 7,392,195; 7,272,567; 7,333,929; 7,212,872 und andere. USA und weltweite Patente sind ausgestellt und angemeldet. DTS-HD, das Symbol und DTS-HD und das Symbol zusammen sind eingetragene Warenzeichen und DTS-HD Master Audio | Essential ist ein Warenzeichen von DTS, Inc. Das Produkt umfasst Software. © DTS, Inc. Alle Rechte vorbehalten. 'AVCHD' und das 'AVCHD'-Logo sind Warenzeichen der Panasonic Corporation und der Sony Corporation. 'DVD Video' ist ein Warenzeichen der DVD Format/Logo Licensing Corporation. 4 Für den HD-Test-Kit 1080p v1.1 sowie spätere Versionen: 'LY;&HUWL¿HG® zur Wiedergabe von DivX® 9LGHR'DWHLHQELV]XU+'$XÀ|VXQJS inklusive Premium Inhalten. Region Regionalcodes Sowohl der Blu-ray Disc -Player, als auch die Discs sind nach Regionen codiert. Diese Regionalcodes müssen übereinstimmen, damit die Disc wiedergegeben werden kann. Wenn die Codes nicht übereinstimmen, wird die Disc nicht wiedergegeben. Die Regionalnummer dieses Blu-ray DiscTMPlayers ist auf der Rückseite des Blu-ray DiscTM-Players angegeben. TM Region $ $! $ "&' %! $"#! $" #! Wiedergebbare DVDs ALL 1 ALL 2 ALL 3 ALL 4 $""$ ALL 5 "" "$$#$ " ALL 6 Wiedergebbare Blu-rayTM Nordamerika, Mittelamerika, Südamerika, Korea, Japan, Taiwan, Hongkong und Südostasien Europa, Griechenland, Französische Gebiete, Mittlerer Osten, Afrika, Australien und Neuseeland D 2 Produktüberblick Indien, China, Russland, Mittel- und Südasien Besondere Ausstattungsmerkmale Unterhaltung im HD-Format. Genießen Sie HD-Discs mit HDTV +LJK'H¿QLWLRQ7HOHYLVLRQ$QVFKOXVVEHU Hochgeschwindigkeits-HDMI-Kabel. Genießen Sie GLHH[]HOOHQWH%LOGTXDOLWlWPLWHLQHU$XÀ|VXQJ von bis zu 1080p und 24 Bildern pro Sekunde im Progressiv-Scan-Verfahren. BD-LiveTM Sie können mit diesem Player verschiedene aktuelle Inhalte (z. B. aktualisierte Filmvorschauen und exklusives Bonusmaterial) über den LAN-Anschluss auf den Webseiten der Filmstudios aufrufen. Blu-ray DiscTM Java Blu-ray DiscTM Java (BD-J) Anwendung Das BD-ROM-Format unterstützt Java für interaktive Funktionen. „BD-J” bietet Inhaltsanbietern fast unbegrenzte Funktionalitäten beim Erstellen von interaktiven BD-ROM-Titeln. 5 Produktüberblick Hauptgerät 6 7 5 4 3 2 1 D NR. Element Funktion a Einschalten des Geräts oder Wechseln in den Stand-by-Modus. b #9 Wiedergabe/Pause. c Y Wiedergabestopp. d ; Öffnen oder Schließen der Disc-Lade. e Displayfenster Zeigt Informationen zum aktuellen Status des Geräts an. f IR-Sensor Richten Sie die Fernbedienung auf den IR-Sensor. g Disc-Lade Lädt eine Disc in das Disc-Laufwerk. 1 NR. 6 2 3 4 5 Element Funktion a AC-Netzkabel Anschluss an Standard-Netzsteckdose. b COAXIAL-Buchse Ausgang von digitalen Audiosignalen, wenn ein Koaxial-Digitalkabel angeschlossen ist. c HDMI OUTPUT-Buchse d LAN-Buchse Für den Anschluss an ein Netzwerk mit immer eingeschalteter Breitbandverbindung. Dieser ist reserviert für die zukünftige Verwendung von BD-Live™. e USB-Buchse Schließen Sie einen USB-Datenspeicher an. Ausgang für Video/Audio-Signale zum Anschluss von TV-Gerät, Monitor oder AV-Verstärker. Anschluss für TV-Gerät, Monitor oder AV-Verstärker mit HDMI-Eingang. Fernbedienung OPEN/CLOSE 57!!) )#'$ 6 ) , $- FERNBEDIENUNGSSIGNAL SENDER 5 ,) $ )/)"/! ) )-*,/! , ,*).+'.. ,$#. ) ON/STANDBY 5:,$ /-1#'0*) 3$!! ,. )' ( ). )$( ): 5:,$ $, &. $)" 0*),&+$. '$. ' #' )--1*,. OSC 5:, )/",$!!/!-$'-#$,(( ): CLEAR 5:,-9-# ) $) -$).,"-* , $)" -. ''. ) - 3 $# )-/),*",((MC( $ ). ,) 5:,7 - $ ). , POP MENU/MENU 5:,$ )3 $" $) -/!0$ ' )'/,2 $- $ * $-- ).#'. ) ) ):OK 5 -.8.$" ) , ):/-1#' 50$".$*)/,-*,-. )!:,'$)&-, #.-/! 3$ # ) 5 ,:& )$ 18#, ) ,$ ," 0*)/($ &./ '' #*.*'$-. 3/ ,*.$ , ) $ $ ," 0*)1$, % *#)" #'. ) RETURN 5/,:&3/' .3. ( ): TOP MENU 5:,$ )3 $" - $-$. '- $ $ ," PROGRAM 5:,-7!!) ) ,,*",(('$-. DIGEST 5($ *,-#/)3 $" 18#, ) , $ ," 3/9!!) ) SUBTITLE 5:,$ /-1#' ,). ,.$. '1$ ,#*'.,:& )/( 0 ,-#$ ) /! , $-0 ,!:", ). ,.$. '3/18#' ) AUDIO 5:,$ /-1#' ,*)-+/,1$ ,#*'.,:& )/( 0 ,-#$ ) /! , $-0 ,!:", *)-+/, )3/ 18#' ) ANGLE 5(-#'. ) -( ,1$)& '- $ ,$ ," <C2%"3*/3$)"-4&/0%&2%"3$)"-4&/*/%&/ 4"/%#80%53%&3-52"8*3$>-"8&23 SETUP D Zahlen-Tasten <@''/&40%&2#&&/%&4%"3834&.*/2*$)45/(3.&/C REPEAT A-B 5:,$ $ ,#*'/)"0*)A $- REPEAT 5:,$ /-1#'0 ,-#$ ) ,$ ,#*'(*$ SEARCH 5:,$ /# $)$. '+$. ')#,& * ,$ ," 3 $. DISPLAY 5:,)3 $" $) - )-. ,-/($. '+$. ' * ,,&3/4) ) 5*!*,.$ ,#*'/)"*!*,./# F.R & F.F 5#) '',:&18,.-#) ''0*,18,.PLAY/PAUSE 5.,.)#'. ) ,$ ," PREV & NEXT 5+,$)" )3/' .3. ()8#-. (+$. '$. ',& STOP 5$ ," -.*++ 5$ . . $) )')"-( )*,-+,/)" $)*,(' ,$ ," 5#'. .$(/- */-0*) $'3/$'1 $. , ZOOM <C2%"3&2(2B=&2/&2,-&*/&2/ BOOKMARK <C2%"3*/'C(&/&*/&3&3&9&*$)&/3"/&*/&. #&-*&#*(&/ *&%&2("#&9&*415/,4 PIP (Picture in Picture) <*/0%&2533$)"-4&/%&397&*4&/*-%3 PIP AUDIO <*/0%&2533$)"-4&/%&3 5%*040/3%&3 *-%3&*/0%&2"53 HDMI <C2?/%&25/(%&25;B35/(%&3*%&0"53("/(3 952/1"335/("/TV&2A491*537 7 3 Anschlüsse Die folgenden Anschlüsse sind für die Benutzung dieses Produkts herzustellen: Optionaler Anschluss Option 1: Anschluss an Digitalverstärker/ Empfänger Anschluss an Netzwerk Anschluss an ein TV-Gerät Option 2: Schließen Sie das Gerät an ein TV-Gerät an, um die Disc wiederzugeben. Option 1: Anschluss an eine HDMI-Buchse Leitet Ton von diesem Player an anderes Gerät weiter, um die Audioausgabe zu verbessern. Anschluss an Digitalverstärker/ Empfänger DIGITAL AUDIO INPUT D COAXIAL HDMI IN 1. Schließen Sie ein HDMI-Kabel von der HDMI-Ausgangsbuchse an diesem Produkt an die HDMI-Eingangsbuchse des TV-Geräts an. Hinweis: Ͳ ŝĞsŝĚĞŽĂƵƐŐĂďĞŬĂŶŶŽƉƟŵŝĞƌƚǁĞƌĚĞŶ͕ ŝŶĚĞŵĚŝĞdĂƐƚĞ,D/ǁŝĞĚĞƌŚŽůƚŐĞĚƌƺĐŬƚ ǁŝƌĚ͕ƵŵĚŝĞďĞƐƚĞƵŇƂƐƵŶŐnjƵǁćŚůĞŶ͕ĚŝĞ ǀŽŵdsͲ'ĞƌćƚƵŶƚĞƌƐƚƺƚnjƚǁŝƌĚ͘ 1. Schließen Sie ein Koaxialkabel von der COAXIAL-Buchse an diesem Gerät an die COAXIAL-Buchse des anzuschließenden Geräts an. Option 2: Anschluss an Netzwerk Schließen Sie das Gerät an das Netzwerk an, um zusätzliche BD-LiveTM-Inhalte genießen zu können und um das Software-Upgrade über das Netzwerk ausführen zu können. 1. Schließen Sie ein Netzwerkkabel von der LAN-Buchse am Produkt an die LAN-Buchse des Netzwerkes an. 8 Anschluss des USB-Datenspeichers D Ein USB-Datenspeicher bietet zusätzlichen Speicherplatz für Software-Upgrades und BD-LiveTM-Bonus-Inhalte. Zudem können Sie die auf dem USB-Gerät gespeicherten MP3/JPEG/MPEG4/DivX®-Dateien wiedergeben. 1. Schließen Sie das USB-Flash-Gerät an die USB-Buchse dieses Geräts an. Hinweise: Ͳ ^ĐŚůŝĞƘĞŶ^ŝĞŶƵƌĞŝŶh^Ͳ&ůĂƐŚͲ'ĞƌćƚĂŶĚŝĞ h^ͲƵĐŚƐĞĚŝĞƐĞƐ'ĞƌćƚƐĂŶ͘ Ͳ tĞŶŶ^ŝĞͲ>ŝǀĞΡͲŽŶƵƐͲ/ŶŚĂůƚĞŐĞŶŝĞƘĞŶ ŵƂĐŚƚĞŶ͕ǀĞƌǁĞŶĚĞŶ^ŝĞĂůƐůŽŬĂůĞŶ^ƉĞŝĐŚĞƌ einen USB-‐Datenspeicher mit mindestens 1GB͘ Ͳ ĞŝĞŝŶŝŐĞŶůƵͲƌĂLJdDͲŝƐĐƐŵŝƚͲ>ŝǀĞdD-‐ &ƵŶŬƟŽŶŵƺƐƐĞŶ^ŝĞĞǀƚů͘ĚĂƐh^Ͳ'ĞƌćƚǀŽƌ ĚĞŵ>ĂĚĞŶĚĞƌŝƐĐĂŶƐĐŚůŝĞƘĞŶ͘^ŽŶƐƚǁŝƌĚ Ğǀƚů͘ĚŝĞŝƐĐŶŝĐŚƚǁŝĞĚĞƌŐĞŐĞďĞŶ͘ Ͳ dK^,/ŐĂƌĂŶƟĞƌƚŬĞŝŶĞϭϬϬйŝŐĞ <ŽŵƉĂƟďŝůŝƚćƚŵŝƚĂůůĞŶh^Ͳ&ůĂƐŚͲ'ĞƌćƚĞŶ͘ Netzanschluss 1. Anschließen des Netzkabels: - an der Netzsteckdose. 'DV*HUlWNDQQMHW]WIUGLH%HQXW]XQJ eingerichtet werden. Hinweise: -‐ sŽƌĚĞŵŶƐĐŚůƵƐƐĚĞƐEĞƚnjŬĂďĞůƐƐƚĞůůĞŶ^ŝĞ ďŝƩĞƐŝĐŚĞƌ͕ĚĂƐƐĂůůĞĂŶĚĞƌĞŶŶƐĐŚůƺƐƐĞ ĂƵƐŐĞĨƺŚƌƚǁƵƌĚĞŶ͘ -‐ 'ĞĨĂŚƌǀŽŶ^ĐŚćĚĞŶĂŵ'Ğƌćƚ͊^ƚĞůůĞŶ^ŝĞ ƐŝĐŚĞƌ͕ĚĂƐƐĚŝĞEĞƚnjƐƉĂŶŶƵŶŐŵŝƚĚĞƌĂƵĨĚĞƌ 'ĞƌćƚĞƌƺĐŬƐĞŝƚĞĂƵĨŐĞĚƌƵĐŬƚĞŶ^ƉĂŶŶƵŶŐ ƺďĞƌĞŝŶƐƟŵŵƚ͘ -‐ ĂƐdLJƉĞŶƐĐŚŝůĚďĞĮŶĚĞƚƐŝĐŚĂƵĨĚĞƌ 'ĞƌćƚĞƌƺĐŬƐĞŝƚĞ͘ 9 4 Vorbereitung Folgen Sie immer den Anweisungen dieses Kapitels genau nach ihrer Reihenfolge. Hinweis: Ͳ tĞŶŶĂŶĚĞƌĞĂůƐĚŝĞŚŝĞƌŝŶĂŶŐĞŐĞďĞŶĞŶ ĞĚŝĞŶƵŶŐƐͲƵŶĚsĞƌĨĂŚƌĞŶƐǁĞŝƐĞŶĂƵƐŐĞĨƺŚƌƚ ǁĞƌĚĞŶ͕ŬĂŶŶĚŝĞƐnjƵŐĞĨćŚƌůŝĐŚĞƌ ^ƚƌĂŚůƵŶŐƐĞdžƉŽƐŝƟŽŶŽĚĞƌĂŶĚĞƌĞŶŐĞĨćŚƌůŝĐŚĞŶ ĞƚƌŝĞďƐnjƵƐƚćŶĚĞŶĨƺŚƌĞŶ͘ Vorbereitung der Fernbedienung D 1. Öffnen Sie den Batteriefachdeckel. 2. Setzen Sie eine R03-Batterie mit der korrekten Polarität (+/-), wie angezeigt, ein. 3. Schließen Sie den Batteriefachdeckel. Hinweise: Ͳ tĞŶŶ^ŝĞĚŝĞ&ĞƌŶďĞĚŝĞŶƵŶŐůćŶŐĞƌĞĞŝƚŶŝĐŚƚ ďĞŶƵƚnjĞŶ͕ĞŶƞĞƌŶĞŶ^ŝĞĚŝĞĂƩĞƌŝĞŶ͘ Ͳ džƉůŽƐŝŽŶƐŐĞĨĂŚƌ͊,ĂůƚĞŶ^ŝĞĂƩĞƌŝĞŶǀŽŶ ,ŝƚnjĞ͕^ŽŶŶĞŶůŝĐŚƚƵŶĚ&ĞƵĞƌĨĞƌŶ͘ŶƚƐŽƌŐĞŶ ^ŝĞĂƩĞƌŝĞŶŶŝĞŵĂůƐŝŵ&ĞƵĞƌ͘ 'LHPD[LPDOHQ)XQNWLRQVEHUHLFKHIU das Gerät sind Folgende: - Sichtlinie: ca. 10 m - Nach jeder Seite von der Mitte aus: ca. 7 m innerhalb 30° - Oberhalb: ca. 7 m innerhalb 30° - Unterhalb: ca. 7 m innerhalb 30° 7m 10 10 m 7m Einrichtung des Players Suchen Sie den korrekten Wiedergabeeingan 1. Drücken Sie auf , um dieses Gerät einzuschalten. 2. Schalten Sie das TV-Gerät ein und wechseln Sie zum korrekten Video-Eingang (siehe Bedienungsanleitung des TV-Geräts zur Auswahl des korrekten Eingangs). Ersteinstellung Wenn Sie dieses Gerät zum ersten Mal einschalten, befolgen Sie bitte die folgenden Schritte: 1. Nach dem Einschalten des Produkts erscheint ein Begrüßungsbildschirm. 2. Drücken Sie auf OK, um die Spracheinstellung zu öffnen. 3. Wählen Sie die gewünschte Sprache, die $XÀ|VXQJXQGGDV%LOGVHLWHQYHUKlOWQLVPLW S/T aus und drücken Sie anschließend auf OK. 4. Drücken Sie auf SETUP, um das Menü „Einstellungen” zu schließen. Menü EINSTELLUNGEN verwenden 1. Drücken Sie auf SETUP, um das Menü „Einstellungen” bei Wiedergabe vom Blu-ray DiscTM-Player oder ohne Disc anzuzeigen. Drücken Sie auf SETUP, um das Menü „Einstellungen” zu schließen. dŝƉƉ͗ Ͳ ĞŝĚĞƌtŝĞĚĞƌŐĂďĞǀŽŶ,ŝŐŚͲĞĮŶŝƟŽŶͲYƵĞůůĞŶ ŵƺƐƐĞŶ^ŝĞĂƵĨSTOP ĚƌƺĐŬĞŶ͕ƵŵĚŝĞ ^ĐŚŶŝƩƐƚĞůůĞĞŝŶƐƚĞůůƵŶŐĞŶ ĂƵĨnjƵƌƵĨĞŶ͘ Auswahl der Menü-Anzeigesprache 1. Drücken Sie auf SETUP, dann wird das Menü [Allgemeine Einstellungen] angezeigt. 2. Wählen Sie [Sprache], dann drücken Sie auf X. 3. Wählen Sie [OSD], dann drücken Sie auf X. - Die Sprachoptionen sind je nach Region unterschiedlich. 4. Drücken Sie auf S/T, um die Sprache zu wählen, dann drücken Sie auf OK. Hinweis: Ͳ tĞŶŶĚŝĞƐĞƌŝƐĐͲWůĂLJĞƌĂŶĞŝŶ,D/ͲͲ ŬŽŵƉĂƚŝďůĞƐdsͲ'ĞƌćƚĂŶŐĞƐĐŚůŽƐƐĞŶŝƐƚ͕ ƺďĞƌƐƉƌŝŶŐĞŶ^ŝĞĚŝĞƐĞŝŶƐƚĞůůƵŶŐ͘ƐǁŝƌĚ ĂƵƚŽŵĂƚŝƐĐŚĚŝĞŐůĞŝĐŚĞK^ͲŽĚĞƌ ŝůĚƐĐŚŝƌŵŵĞŶƺƐƉƌĂĐŚĞǁŝĞŝŶĚĞŶ dsͲ'ĞƌćƚĞĞŝŶƐƚĞůůƵŶŐĞŶǀĞƌǁĞŶĚĞƚ͘ Wiedergabe-Funktionen Normale Wiedergabe 1. Drücken Sie auf den Schalter an der Frontplatte oder auf der Fernbedienung, dann schaltet sich Ihr Blu-ray Disc™-Player ein. Das Gerät benötigt 20 Sekunden für das Aufwärmen. 2. Schalten Sie das TV-Gerät ein, dann wählen Sie die Eingangseinstellung auf dem TV-Gerät, die der Anschlussmethode entspricht, mit welcher der Player angeschlossen ist. 3. Drücken Sie auf OPEN/CLOSE ;, um die Disc-Lade zu öffnen. 4. Legen Sie eine Disc in die Lade mit der Beschriftung nach oben ein und drücken Sie dann auf OPEN/CLOSE ;, um die Lade wieder zu schließen. Die Disc-Ladezeit ist abhängig vom eingelegten Disc-Typ und das Laden einer Blu-ray DiscTM-Disc dauert länger. 5. Wenn die automatische Disc-Wiedergabe nicht startet, drücken Sie bitte auf #9, um die Wiedergabe zu starten. 6. Wenn ein Blu-ray DiscTM- oder DVD-Menü angezeigt wird, verwenden Sie den Cursor, um PLAY zu wählen. Drücken Sie dann zum Bestätigen auf OK. 7. Für den Auswurf der Disc drücken Sie auf OPEN/CLOSE ;. Wiedergabe pausieren. 1. Drücken Sie auf #9, um die Wiedergabe zu unterbrechen. Der Ton wird stumm geschaltet. 2. Drücken Sie #9, um die normale Wiedergabe fortzusetzen. Wiedergabe stoppen 1. Drücken Sie einmal auf die Taste STOP , um in den Wiederaufnahme-Modus zu schalten, auf dem TV-Bildschirm wird das Wiederaufnahme-Logo angezeigt. 2. Drücken Sie zweimal auf STOP , um die Wiedergabe vollständig abzubrechen. 3. Drücken Sie auf #9, um die Wiedergabe am Stopppunkt der Wiedergabe oder ab dem Anfang wieder aufzunehmen, nachdem die Wiedergabe vollständig abgebrochen wurde. Nicht alle Blu-rayTM-Discs unterstützen die Wiederaufnahme-Funktion. 2. Drücken Sie #9, um die normale Wiedergabe fortzusetzen. 3. Drücken Sie für den schnellen Rückwärtslauf durch die Disc auf F. R N. Die RückwärtsGeschwindigkeit ändert sich je nachdem, wie oft die Taste gedrückt wird. Die Geschwindigkeit wird in folgender Reihenfolge gesteigert: 2X, 4X, 8X, 16X, 32X 4. Drücken Sie #9, um die normale Wiedergabe fortzusetzen. Sofort-Suche und Sofort-Wiederholung 1. Wenn Sie während der Wiedergabe die Taste . drücken und halten, können Sie den Suchlauf 30 Sekunden vorwärts starten. 2. Drücken und halten Sie bei der Wiedergabe die Taste N, dann werden die letzten 10 Sekunden wiederholt. Zurück und Weiter Drücken Sie bei der Wiedergabe auf die Taste PREV , dann können Sie zum letzten Kapitel oder Track zurückspringen. Jeder Druck dieser Taste gestattet den Sprung zu einem Kapitel oder Track bis zum Anfang der Disc. Drücken Sie bei der Wiedergabe auf die Taste NEXT , dann können Sie zum nächsten Kapitel oder Track vorwärts springen. Langsam vorwärts 1. Drücken Sie während der normalen Wiedergabe auf #. Die Geschwindigkeit des langsamen Vorwärtslaufs ist standardmäßig 1/16. 2. Um die langsame Vorwärtsgeschwindigkeit zu ändern, drücken Sie wiederholt auf #, dann ändert sich die Vorwärtsgeschwindigkeit in der folgenden Reihenfolge: 1/16, 1/8, 1/4, 1/2, Normal. 3. Um den langsamen Vorwärts-Modus zu beenden und zur normalen Wiedergabe zurückzukehren, drücken Sie auf #9. Schritt vorwärts Verwenden Sie diese Funktion, um ein Video Bild für Bild zu genießen. 1. Drücken Sie bei normaler Wiedergabe auf #9, dann schaltet die Wiedergabe in den Pause-Status um. 2. Drücken Sie wiederholt auf #, um von Bild zu Bild vorwärts zu wechseln. 3. Drücken Sie auf #9, um die normale Wiedergabe fortzusetzen. Schnell vorwärts und schnell rückwärts HDMI 1. Drücken Sie auf F.F . für den schnellen Vorwärtslauf durch die Disc. Die VorwärtsGeschwindigkeit ändert sich je nachdem, wie oft die Taste gedrückt wird. Die Geschwindigkeit wird in folgender Reihenfolge gesteigert: 2X, 4X, 8X, 16X, 32X Bei der Wiedergabe einer Datei oder einer Disc GDUIGLH$XÀ|VXQJQLFKWEHUGLH+'0,7DVWHDXI der Fernbedienung umgeschaltet werden. 11 D 5 Wiedergabe D Erweiterte Wiedergabe DISPLAY Durch Drücken dieser Taste zeigt der Bildschirm, wie folgt, einige Informationen zur Disc an: Titelnummer, Abschnittsnummer, Track-Nummer, Vergangene Zeit, Modus, Audio, Winkel und Untertitelsprachen. Drücken Sie diese Taste erneut, um die Informationsanzeige auszuschalten. REPEAT Drücken Sie wiederholt auf REPEAT, um die unterschiedlichen Wiederholungsmodi auszuwählen. DVD: Kapitel wiederholen, Titel wiederholen und Alle. VCD PBC Aus/CD/JPEG/MP3: Track wiederholen und Alle. A-B Für die Wiederholung eines bestimmten Abschnitts im Video oder im Titel drücken Sie auf die Taste A-B, um den Startpunkt festzulegen. Erneutes Drücken von A-B legt den Endpunkt fest und beendet die Einstellung. Der ausgewählte Abschnitt wird wiederholt. Drücken Sie die Taste A-B ein drittes Mal, um die Funktion abzubrechen. Der Endpunkt muss mindestens 5 Sekunden nach dem Startpunkt festgelegt werden. SEARCH Bei der Wiedergabe drücken Sie auf die Taste SEARCH, um Titel, Abschnitt und Zeit zu bearbeiten. Drücken Sie auf W/X und auf OK auf der Fernbedienung, um Titel, Abschnitt oder Zeit auszuwählen. Drücken Sie dann auf die ZahlenTasten oder auf S/T und dann auf OK. Die Wiedergabe springt an die gewünschte Stelle. Für die Zeitsuche drücken Sie auf S/T, um die Titel- oder Kapitelsuche auszuwählen. SUBTITLE Nach wiederholtem Drücken dieser Taste wird „X/XX XXX” oder „Aus” angezeigt. Das „X” zeigt die aktuelle Nummer in dieser Sprache an; „XX” zeigt die Gesamtzahl in der Sprache an; „XXX” zeigt die Sprache an. Die Zahl der verfügbaren Sprachen ist von der Disc abhängig. RETURN Drücken Sie auf diese Taste, um zum letzten Bildschirmmenü im Setup-Menü zurückzukehren, z. B. Ext. Speicher-Information, Kinderschutz, Länder Code usw. Drücken Sie ein Mal RETURN während der MP3/ JPEG/VIDEO-Wiedergabe, dann kehrt der Player zur Seite Medienzentrum zurück. Bei der Wiedergabe einer VCD-Disc, wenn PBC Ein gewählt ist, drücken Sie auf die Taste, um zum PBC-Menü zurückzukehren. ANGLE Bei der Wiedergabe drücken Sie auf diese Taste, um den Bildwinkel zu ändern. Auf dem Bildschirm wird „Winkel X/X” angezeigt. Das erste „X” zeigt die aktuelle Winkelnummer an und das zweite „X” zeigt die Gesamtzahl der Winkel an. Nicht alle Blu-rayTM oder DVDs besitzen die Mehrfach-Winkelfunktion. Das Gerät benötigt ca. 5 Sekunden für das Wechseln. TOP MENU Diese Taste kann jederzeit gedrückt werden, dann wird bei der Blu-ray DiscTM- oder DVDVideowiedergabe das Disc-Menü angezeigt. 12 POP MENU/MENU Drücken Sie während der Blu-ray-DiscTMWiedergabe auf POP MENU/MENU, um den Disc-Titel im Menü auf dem Bildschirm anzuzeigen, ohne die Wiedergabe zu stoppen. 1. Drücken Sie die Tasten S/T/W/X, um eine Option auszuwählen und drücken Sie zum Bestätigen auf OK. 2. Drücken Sie auf POP MENU/MENU, um das Menü zu schließen. Bei der DVD-Wiedergabe drücken Sie auf POP MENU/MENU, um das Disc-Menü zu öffnen. Bei der VCD-Wiedergabe drücken Sie auf POP MENU/MENU, um PBC ein- bzw. auszuschalten. Bei der Anzeige von USB-Datenspeichern- und Daten-Disc-Dateiinhalten im Medienzentrum drücken Sie auf POP MENU/MENU, um Foto/Musik/ Video-Dateien zur Wiedergabeliste hinzuzufügen. 1. Drücken Sie S/T/W/X, um eine Option aus den Foto/Musik/Video-Dateien zu wählen. 2. Drücken Sie im Dateibrowser auf X, um die Dateien auszuwählen, die zur Wiedergabeliste KLQ]XJHIJWZHUGHQVROOHQÄ¥´HUVFKHLQW neben den ausgewählten Dateien. 3. Drücken Sie die Taste POP MENU/MENU. Ein Pop-Up-Menü erscheint. Drücken Sie anschließend S/T und auf die Taste OK, um „Zur Wiedergabeliste hinzufügen” auszuwählen und die Dateien zur Wiedergabeliste hinzuzufügen. Die Optionen „Alle auswählen” und „Alle entfernen” sind ebenfalls verfügbar. Wählen Sie „Abbruch”, um das Pop-Up-Menü zu schließen. Alle gewählten Dateien werden zum Ordner „Wiedergabeliste” hinzugefügt. Die Dateien in der Wiedergabeliste können entweder wiedergegeben oder gelöscht werden. Drücken Sie POP MENU/MENU, um die ausgewählten Dateien in der „Wiedergabeliste” zu löschen. SETUP Drücken Sie auf die Taste SETUP, dann werden einige Informationen, wie folgt, über den Player angezeigt: Allgemeine Einstellungen Anzeige-Einstellungen Audio-Einstellungen System-Informationen PROGRAM Bei der CD/DVD/VCD-Wiedergabe können Sie auf diese Taste drücken, um die Reihenfolge der Wiedergabeliste zu bearbeiten. BOOKMARK Bei der Wiedergabe einer VCD/DVD/DivX®-Disc drücken Sie die Taste BOOKMARK, um ein Lesezeichen hinzuzufügen und halten Sie diese einige Sekunden, um die bereits bestehende Lesezeichenliste anzuzeigen, dann können Sie auf die Taste OK drücken, um das Lesezeichen auszuwählen oder auf die Taste CLEAR, um das Lesezeichen zu löschen. AUDIO Drücken Sie auf die Taste AUDIO auf der Fernbedienung, um die Audiospuren zu wählen, die auf der Blu-rayTM- oder DVD-Disc vorhanden sind. Der Bildschirm zeigt Folgendes an: AUDIO: X/XX XXX XXXX „X” - Die aktuelle Audiospurnummer „XX” - Die Gesamtzahl der Audiospuren „XXX” - Audio-Sprache „XXXX” - Audio-Technologie [Subtitle-Stil]: Bei der Wiedergabe von Blu-ray DiscTM-Discs oder DVDs, wenn sie externe Untertitel enthalten, werden diese im OSC- oder Bildschirmmenü angezeigt. [Bitrate]: Verwenden Sie S/T, um die gewünschte Bitrate zu wählen. [Weiterhin Aus]: Beenden der Standbild-Funktion der DVD-Disc. Bei einigen DVD-Discs werden bestimmte Videobilder während der Wiedergabe als Standbilder angezeigt, damit der Zuschauer ein einzelnes Bild besser sehen kann. Um die Wiedergabe fortzusetzen, wählen Sie Weiterhin Aus. [Schnelle Suche]: Sofortige Suche um 30 Sekunden vorwärts. [Schneller Rücklauf]: Wiederholung der letzten 10 Sekunden. dŝƉƉƐ͗ Ͳ ŝĞĂŶŐĞŐĞďĞŶĞ&ƵŶŬƟŽŶǀĂƌŝŝĞƌƚĨƺƌũĞĚĞƐůĞŵĞŶƚ ũĞŶĂĐŚŝƐĐͲdLJƉ͘ŝŶŝŐĞůĞŵĞŶƚĞƐŝŶĚŶƵƌǀĞƌĨƺŐďĂƌ͕ ǁĞŶŶƐŝĞǀŽŶĚĞƌŝƐĐƵŶƚĞƌƐƚƺƚnjƚǁĞƌĚĞŶ͘ Ͳ ĞƌŝǀyΠͲhŶƚĞƌƟƚĞůĚĂƚĞŝŶĂŵĞ;͘ƐƵďͿŵƵƐƐƵŶƚĞƌ ĚĞŵŐůĞŝĐŚĞŶĂƚĞŝŶĂŵĞŶǁŝĞĚĞƌ&ŝůŵ;͘ĂǀŝͿŝŵ ƐĞůďĞŶKƌĚŶĞƌ;nj͘͘KƌĚŶĞƌ͗ĂďĐ͘ĂǀŝƵŶĚĂďĐ͘ƐƵďͿ ŐĞƐƉĞŝĐŚĞƌƚǁĞƌĚĞŶ͘ Blu-ray DiscTM BONUSVIEWTM Die Funktion zum Abspielen des 2. Videos (Bild-in-Bild) und des 2. Audiotons ist nur für Blu-ray DiscTM-Discs verfügbar. Das 2. Video kann von einer Disc wiedergegeben werden, die mit der Bild-in-Bild-Funktion kompatibel ist. Details zur Wiedergabemethode siehe Anweisungen der Disc. 1. Schalten Sie das 2. Video ein, indem Sie die Taste PIP drücken. 2. Drücken Sie auf die Taste PIP AUDIO, um den 2. Audioton zu wählen und wählen Sie eine der Optionen außer Aus. Der 2. Audioton wird geöffnet und Sie hören den Ton zum 2. Bild der Disc. Um den 2. Audioton zu hören, muss die PIP-Funktion der Disc eingeschaltet sein. 3. Drücken Sie die PIP-Taste erneut, um das 2. Video auszuschalten. Hauptvideo Bild-in-Bild Video Diese Funktion ist nicht verfügbar, wenn das 1. Video in den Modi Suche, Zeitlupe oder Bild-für-Bild oder Schnell Vor-/Rückwärts wiedergegeben wird. Um den 2. Audioton zu hören, muss der digitale Audioausgang auf „Bitstream”, „Neu kodieren” oder „PCM” eingestellt sein. Sonst kann nur der 1. Audioton gehört werden. Hinweise: Ͳ EŝĐŚƚĂůůĞůƵͲƌĂLJdDͲŝƐĐƐƵŶƚĞƌƐƚƺƚnjĞŶĚŝĞƐĞ &ƵŶŬƟŽŶ͘ Ͳ ,ŝŐŚĞĮŶŝƟŽŶͲW/W;Ϯ͘sŝĚĞŽͿǁŝƌĚŶŝĐŚƚƵŶƚĞƌƐƚƺƚnjƚ͘ 13 D MC Drücken Sie auf diese Taste, um Mediendateien auf dem USB-Datenspeicher wiederzugeben. ZOOM Drücken Sie wiederholt auf ZOOM, um das Bild bei der Wiedergabe zu vergrößern/verkleinern. Zoom-Modus: Zoom 2x -> Zoom 3x -> Zoom 4x -> Zoom 1/2 -> Zoom 1/3 -> Zoom 1/4. DIGEST Bei der Wiedergabe einer JPEG-Disc drücken Sie auf DIGEST, um eine Seite mit 12 Vorschaubildern anzuzeigen. - Verwenden Sie S/T/W/X, um eine Option zu wählen. Drücken Sie auf OK, um das ausgewählte Bild in Vollbildschirmanzeige zu sehen, die folgenden Bilder werden automatisch nacheinander angezeigt. - Drücken Sie auf PREV /NEXT , um den letzten oder nächsten Vorschaubildschirm anzuzeigen. PIP AUDIO Drücken Sie auf die Taste PIP AUDIO, um den 2. Audioton des 2. Bilds aufzurufen (PIP-Video 2. Bild). OSC Drücken Sie auf OSC, um das Bildschirmmenü bei der Wiedergabe zu öffnen. In diesem Menü können Sie einige Steuerbefehle in Bezug auf die Wiedergabe wählen. Das Bildschirmmenü enthält die folgenden Elemente: [Titel]: Der Titel der aktuellen Wiedergabe/alle Titel. Wählen Sie den gewünschten Titel für die Wiedergabe. [Abschnitt]: Das Kapitel der aktuellen Wiedergabe/alle Kapitel. Wählen Sie das gewünschte Kapitel für die Wiedergabe. [Zeit]: Anzeige der vergangenen/verbleibenden Wiedergabezeit von Titel/Kapitel. Verwenden Sie S/T, um Folgendes anzuzeigen: die vergangene Wiedergabezeit des Titels, die verbleibende Wiedergabezeit des Titels, die vergangene Wiedergabezeit des Kapitels, die verbleibende Wiedergabezeit des Kapitels. [Modus]: Wiedergabemodus unter Mischen, Zufall und Normal auswählen. [Audio]: Die Blu-ray DiscTM/DVD-SoundtrackSprache. Verwenden Sie S/T, um die verfügbaren Audiosprachen der Disc anzuzeigen und den gewünschten Audiotyp zu wählen. [Winkel]: Die Winkelansicht der aktuellen Wiedergabe/alle Winkel. Weitere Details siehe Wiedergabe > Angle. Verwenden Sie S/T, um die gewünschte Winkelansicht zu wählen. [Untertitel]: Die Untertitel der aktuellen Wiedergabe. Verwenden Sie S/T, um die verfügbaren Untertitelsprachen der Disc anzuzeigen und den gewünschten Typ zu wählen oder die Untertitel auszuschalten. Hinweis: Ͳ ĞŝƵŶƚĞƌƐĐŚŝĞĚůŝĐŚĞŶŝƐĐƐƐŝŶĚƵŶƚĞƌƐĐŚŝĞĚůŝĐŚĞ hŶƚĞƌƟƚĞůĞŶƚŚĂůƚĞŶ͘ĞŝƐƉŝĞůƐǁĞŝƐĞ͗ DŝƩĞůĞƵƌŽƉĂ <LJƌŝůůŝƐĐŚ >ĂƚĞŝŶŝƐĐŚ/ 'ƌŝĞĐŚŝƐĐŚ dƺƌŬŝƐĐŚ ,ĞďƌćŝƐĐŚ 6 Individuelle Anpassung Dieser Abschnitt beschreibt die verschiedenen Einstelloptionen dieses Blu-ray DiscTM-Players. Wenn diese Einstelloption grau unterlegt ist, bedeutet dies, dass die Einstellung im aktuellen Status nicht geändert werden kann. Allgemeine Einstellungen D 1. Drücken Sie die SETUP-Taste auf der Fernbedienung. Das Einstellungsmenü erscheint. 2. Drücken Sie auf T drücken, um eine Option zu wählen, dann drücken Sie auf X, um sie zu öffnen. 3. Drücken Sie auf S/T, um eine Option zu wählen, dann drücken Sie auf X. 4. Wählen Sie die Einstellung, die geändert werden soll und drücken Sie zum Bestätigen auf OK. - Drücken Sie auf W, um zum letzen Menü zurückzukehren. [System] Für die Änderung der folgenden Systemoptionen, um Ihren Blu-ray DiscTM-Player einzurichten. [Bildschirmschoner] Ein- oder Ausschalten des Bildschirmschoners. Er schützt den TV-Bildschirm. {Ein} - Aktiviert den Bildschirmschoner nach ca. 5 Minuten ohne Betrieb. Drücken Sie die Taste SETUP, um den Bildschirmschoner auszuschalten. - Der Blu-ray DiscTM-Player schaltet in den Stand-by-Modus, wenn nach Einschalten des Bildschirmschoners ca. 10 Minuten lang kein Betrieb erfolgt ist. {Aus} - Ausschalten des BildschirmschonerModus. [Automatische Wiedergabe] Für das Ein- oder Ausschalten des automatischen Disc-Wiedergabemodus. {Ein} - Die Disc-Wiedergabe startet automatisch nach dem Laden. {Aus} - Ausschalten des automatischen Wiedergabemodus. [CEC] Dieser Player unterstützt REGZA-LINK, der das HDMI-CEC-Protokoll (Consumer Electronics Control) verwendet. Eine einzige Fernbedienung kann zur Steuerung aller REGZA-LINK-kompatiblen Geräte verwendet werden, die über HDMI-Stecker angeschlossen sind. 14 {Ein} - Schaltet die REGZA-LINK-Funktionen ein. - Bei eingeschaltetem CEC-Modus drücken Sie auf SETUP, während sich das TV-Gerät im 6WDQGE\0RGXVEH¿QGHWXQGGHU%OXUD\ DiscTM-Player eingeschaltet ist, dann wird durch Drücken von SETUP, PLAY/PAUSE das TV-Gerät eingeschaltet. Wenn Sie das TV-Gerät ausschalten, schaltet sich automatisch auch dieses Gerät aus. {Aus} - Schaltet die REGZA-LINK-Funktionen aus. [Standardeinstellungen laden] Setzt alle Einstellungen des Blu-ray DiscTMPlayer auf die Werkseinstellungen zurück. - Folgen Sie den Anweisungen auf dem TV-Bildschirm, um die Wiederherstellung der Werkseinstellungen zu bestätigen. 1. Wählen Sie Standardeinstellungen laden. 2. Ein Dialogfeld öffnet sich, wie unten gezeigt. Wählen Sie OK. 3. Es dauert eine gewisse Zeit, bis das Laden der Werkseinstellungen startet. Bitte warten... 4. Das TV-Gerät zeigt Folgendes an: 5. Drücken Sie auf OK, um die Spracheinstellung zu öffnen. Drücken Sie auf S/T, um eine Sprachoption zu wählen. Drücken Sie auf S/T, um eine Option zu wählen. Drücken Sie auf OK. Wählen Sie „Ja” oder „Nein” mit S/T. 7. Drücken Sie auf OK, um die Einstellung des Bildseitenverhältnisses zu öffnen. Drücken Sie auf S/T, um eine Option zu wählen. Drücken Sie auf OK. 8. Drücken Sie auf OK, um das Menü [Allgemeine Einstellungen] zu öffnen. [Aktualisieren] Für Software-Upgrades zur Leistungsverbesserung können Sie die folgende Upgrade-Methode verwenden und das Upgrade starten. {Disk}/{USB-Speicherung}/{Netzwerk} Software-Upgrade über Disc/USBSpeicherung Upgrade der Software von der Disc oder dem USB-Datenspeicher aus. 1. Disc einlegen oder den USB-Datenspeicher mit dem Upgrade-Dateipaket anschließen. 2. Folgen Sie den Anweisungen auf dem TV- Bildschirm, um die Ausführung des Upgrades zu bestätigen. - Das System startet nach 5 Sekunden neu, außer die OK-Taste wird gedrückt. Hinweise: Ͳ tĞŶŶƵƚŽŵĂƟƐĐŚĞtŝĞĚĞƌŐĂďĞĂƵĨƵƐ ŐĞƐĞƚnjƚŝƐƚ͕ŵƵƐƐŶĂĐŚĚĞŵŝŶůĞŐĞŶĚĞƌŝƐĐ ŵŝƚĚĞŶ/ŶĨŽƌŵĂƟŽŶĞŶĨƺƌĚĞŶ^LJƐƚĞŵͲhƉŐƌĂĚĞ ĚĂƐhƉŐƌĂĚĞŵŝƚĚŝĞƐĞƌKƉƟŽŶĂƵƐĚĞŵDĞŶƺ ĞŝŶƐƚĞůůƵŶŐĞŶŐĞƐƚĂƌƚĞƚǁĞƌĚĞŶ͘ Ͳ tĞŶŶĚĂƐhƉŐƌĂĚĞͲĂƚĞŝƉĂŬĞƚĚŝĞ mďĞƌƉƌƺĨƵŶŐŶŝĐŚƚďĞƐƚĂŶĚĞŶŚĂƚ͕ǁŝƌĚĞŝŶĞ &ĞŚůĞƌŵĞůĚƵŶŐĂŶŐĞnjĞŝŐƚ͕ĚĂŶŶŵƵƐƐĚĂƐ WĂŬĞƚŶŽĐŚŵĂůƐƺďĞƌƉƌƺŌǁĞƌĚĞŶ;nj͘͘ŽďĚĂƐ WĂŬĞƚǀŽůůƐƚćŶĚŝŐŝƐƚͿ͘ Ͳ ĐŚƚĞŶ^ŝĞĚĂƌĂƵĨ͕ĚĂƐƐĚŝĞ&ŝƌŵǁĂƌĞͲsĞƌƐŝŽŶ ŬĞŝŶĞĂůƚĞsĞƌƐŝŽŶŝƐƚ͘ Ͳ Ğŝŵ^LJƐƚĞŵͲhƉŐƌĂĚĞŵŝƩĞůƐĞŝŶĞƐh^Ͳ'ĞƌćƚƐ ƐŽůůĞŶ^ŝĞĞŝŶĞŶŶĞƵĞŶKƌĚŶĞƌĞƌƐƚĞůůĞŶƵŶĚŝŚŶ hW'ͺ>>ŶĞŶŶĞŶƵŶĚĚŝĞhƉŐƌĂĚĞͲĂƚĞŝĞŶ ŚŝŶĞŝŶŬŽƉŝĞƌĞŶ͘ Software-Upgrade über Netzwerk Es gibt die zwei folgenden Methoden für das Upgrade über das Internet: Automatischer Modus und Interaktiver Modus. Automatischer Modus: Der Player kontrolliert automatisch beim Einschalten, ob eine Verbindung zum Internet besteht. Wenn eine Verbindung besteht, versucht der Player, die Verbindung zum Toshiba-Server herzustellen, um zu kontrollieren, ob neue Firmware für den Player vorhanden ist. Falls dies zutrifft, zeigt der Player eine Meldung auf dem Bildschirm an, die Sie informiert, dass ein Firmware-Upgrade im Internet zur Verfügung steht. Sie können wählen, ob der Upgrade ausgeführt werden soll. Interaktiver Modus: Das Netzwerk-Upgrade kann auch über das Menü Einstellungen ausgeführt werden. Achten Sie darauf, dass der Player vorher bereits mit dem Internet verbunden ist. Drücken Sie auf der Fernbedienung auf die Taste „SETUP”, wählen Sie dann „System -> Aktualisieren -> Netzwerk” und drücken Sie auf „OK”. Dann stellt der Player die Verbindung zum ToshibaServer her, um zu kontrollieren, ob neue Firmware für den Player vorhanden ist. 15 D 6. Drücken Sie auf OK, um die Auflösungseinstellung zu öffnen. Falls dies zutrifft, zeigt der Player auf dem Bildschirm eine Meldung an und Sie können wählen, ob der Upgrade ausgeführt werden soll. 3. Drücken Sie auf OK, um „Löschen” zu wählen, dann werden die Daten im Ordner BUDA gelöscht. [Sprache] Wählen Sie das OSD/Bildschirmmenü, Menü, Audio und die Standardsprache für die Untertitel des Players. Falls keine neue Firmware vorhanden ist, zeigt der Player auf dem Bildschirm eine Meldung an, dass keine neue Firmware für den Player vorhanden ist. D ŶŵĞƌŬƵŶŐ͗ tĞŶŶĚĂƐŶĞƵĞ&ŝƌŵǁĂƌĞͲhƉŐƌĂĚĞĂƵƐŐĞǁćŚůƚǁŝƌĚ͕ ϭ͘ ^ƚĂƌƚĞƚĚĞƌWůĂLJĞƌĚĞŶŽǁŶůŽĂĚĚĞƌhƉŐƌĂĚĞͲĂƚĞŝ ƵŶĚnjĞŝŐƚĞŝŶĞDĞůĚƵŶŐƺďĞƌĚĞŶ&ŽƌƚƐĐŚƌŝƚƚĂŶ͘ Ϯ͘ tĞŶŶĚĞƌŽǁŶůŽĂĚďĞĞŶĚĞƚŝƐƚ͕njĞŝŐƚĚĞƌWůĂLJĞƌ ĞŝŶĞDĞůĚƵŶŐĂŶƵŶĚ^ŝĞŬƂŶŶĞŶǁćŚůĞŶ͕ ŽďĚĞƌ hƉŐƌĂĚĞĂƵƐŐĞĨƺŚƌƚǁĞƌĚĞŶƐŽůůŽĚĞƌŶŝĐŚƚ͘tĞŶŶ ^ŝĞĚĂƐhƉŐƌĂĚĞǁćŚůĞŶ͕ďĞŐŝŶŶƚĚĞƌWůĂLJĞƌŵŝƚ ĚĞŵhƉŐƌĂĚĞƵŶĚnjĞŝŐƚĞŝŶĞDĞůĚƵŶŐƺďĞƌĚĞŶ &ŽƌƚƐĐŚƌŝƚƚĂŶ͘EĂĐŚďƐĐŚůƵƐƐĚĞƐhƉŐƌĂĚĞƐ ƐƚĂƌƚĞƚĚĞƌWůĂLJĞƌŶĞƵ͘ $FKWXQJ6FKDOWHQ6LHZlKUHQGGHP Firmware-Upgrade NICHT die Stromzufuhr DXV'LHVNDQQ]XU)XQNWLRQVXQWFKWLJNHLWGHV Player führen. >([W6SHLFKHU@ Der ext. Speicher wird bei der BD-LiveTMFunktion verwendet. Beim Anschließen eines USB-Datenspeichers mit mindestens 1GB freiem Speicherplatz für die Wiedergabe der BD-LiveTM-Funktion wird automatisch vom Blu-ray DiscTM-System ein Verzeichnis mit der Bezeichnung BUDA erstellt. Daten-Info zeigt die freie Speicherkapazität an. 1. Drücken Sie auf OK. 2. Folgen Sie den Anweisungen auf dem TV-Bildschirm, um {Daten-Info} zu wählen. 16 [OSD] Wählen Sie die StandardBildschirmmenüsprache. [Menü] Wählen Sie die Standardsprache für das Menü. [Audio] Wählen Sie die Standard-Audiosprache. [Untertitel] Wählen Sie die Standard-Untertitelsprache. [Wiedergabe] [Kamerawinkel Option] Einige Blu-rayTM-Discs/DVDs enthalten Szenen, die mit mehreren Winkeln aufgenommen wurden, wodurch Sie diese Videos in den gewünschten Aufnahmewinkeln genießen können. Deshalb wird das WinkelSymbol nur angezeigt, wenn die Blu-ray Disc™/DVD mehrere Winkel unterstützt und die Kamerawinkel Option auf EIN gesetzt ist. {Ein} - Zeigt die Kamerawinkel-Option an. {Aus} - Verbirgt die Kamerawinkel-Option. [BiB Option] Der Bild-in-Bild-Modus (PIP) zeigt gleichzeitig zwei Bilder auf dem TV-Bildschirm an, das Vollbild wird 1. Bild genannt und das kleine Bildfenster wird 2. Bild genannt. Das PIPZeichen wird angezeigt, wenn der PIP-Modus aktiv ist und die BiB-Option auf EIN gesetzt ist. {Ein} - Zeigt die BiB-Option an. {Aus} - Verbirgt die BiB-Option. Hinweis: Ͳ ,ŝŐŚĞĮŶŝƟŽŶͲW/W;Ϯ͘sŝĚĞŽͿǁŝƌĚŶŝĐŚƚƵŶƚĞƌƐƚƺƚnjƚ͘ ͻ [Sekundäre Audiooption] {Ein} - Zeigt die Sekundäre Audiooption an. {Aus} - Verbirgt die Sekundäre Audiooption. [Passwort ändern] Folgen Sie den Hinweisen auf dem TV-Bildschirm oder ändern Sie das Passwort für gesperrte Discs und geben Sie gesperrte DVD-Discs wieder. 1. Verwenden Sie die ZAHLEN-Tasten, um das alte 4-stellige Passwort einzugeben. Das Standardpasswort ist „0000”. 2. Geben Sie das neue Passwort ein. 3. Geben Sie das neue Passwort erneut zur Bestätigung ein. [Länder Code] Dies stellt sicher, dass alle Szenen wiedergegeben werden, die für Ihr/e momentane/s Land/Region gedacht sind. Verwenden Sie die Zahlen-Tasten, um Ihr Passwort einzugeben, dann können Sie Ihr/e Land/Region wählen. [Kinderschutz] Verhindert den Zugriff von Kindern auf Discs, die für sie nicht geeignet sind. Diese Discs müssen mit einer Alterskennzeichnung aufgezeichnet worden sein. 1. Drücken Sie auf OK. 2. Verwenden Sie die ZAHLEN-Tasten, um das Passwort einzugeben. 3. Wählen Sie eine Altersfreigrenze und drücken Sie dann auf OK. 17 D [Letzte Speicherung] Wenn die Disc-Lade geöffnet wird oder der Blu-ray Disc™-Player bei normaler Wiedergabe in den Stand-by-Modus geschaltet wird, kann der Blu-ray Disc™Player den Wiedergabeendpunkt speichern, der Player startet das nächste Mal die Wiedergabe ab dem gespeicherten Punkt. {Ein} - Aktive Funktion Letzte Speicherung. {Aus} - Desaktivierte Funktion Letzte Speicherung. Hinweis: Ͳ EŝĐŚƚĂůůĞůƵͲƌĂLJdDͲŝƐĐƐƵŶƚĞƌƐƚƺƚnjĞŶĚŝĞƐĞ &ƵŶŬƟŽŶ͘ ͻ [PBC] VCD2.0 hat ein PBC-Wiedergabe-Steuermenü, über das man das System interaktiv steuern kann. {Ein} - Wiedergabesteuermenü wird angezeigt, ZAHLEN-Tasten für Auswahl der gewünschten Option verwenden. {Aus} - Wiedergabesteuermenü verbergen und Wiedergabe von Track 1 automatisch starten. [Mit Untertiteln] Ermöglicht Hörgeschädigten, TV-Sendungen zu verfolgen, indem der Audioton einer Sendung als Text auf dem Bildschirm angezeigt wird. {Ein} - Anzeige Mit Untertiteln. {Aus} - Keine Anzeige Mit Untertiteln. [DivX(R) VOD DRM] DivX(R) VOD DRM bedeutet DivX(R) Video on Demand Digital Right Management Kopierschutzsystem. DivX® ist der Name eines revolutionären neuen Video-Codecs auf Basis des neuen MPEG-4-Kompressionsstandards für Video. Sie können mit diesem Player DivX®-Filme wiedergeben. Sie können mit diesem Geräts nur gemietete und gekaufte DivX®-Videos wiedergeben, die mit dem DivX®-Registriercode ausgestattet sind. Wählen Sie die DivX(R) VOD DRM-Option, GDQQ¿QGHQ6LHGHQ3URGXNWUHJLVWULHUFRGH Weitere Informationen unter http://www.divx.com/vod. [Sicherheit] Elemente Beschreibung Frei ab 6 Ohne Altersbeschränkung G Geeignet für Kinder mit Anleitung PG Elterliche Anleitung PG-13 Elterliche Anleitung für Kinder unter 13 PGR Elterliche Anleitung empfohlen R Eingeschränkt NC-17 Nicht unter 17 Jahre Ab 18 Ab 18 Jahre D Hinweise: Ͳ ŝƐĐƐ͕ĚŝĞĞŝŶĞůƚĞƌƐĨƌĞŝŐƌĞŶnjĞƺďĞƌĚĞƌƵŶƚĞƌ <ŝŶĚĞƌƐĐŚƵƚnjĞŝŶŐĞƐƚĞůůƚĞŶ&^<Ͳ'ƌĞŶnjĞŚĂďĞŶ͕ ĞƌĨŽƌĚĞƌŶĚŝĞŝŶŐĂďĞĚĞƐWĂƐƐǁŽƌƚƐ͘ Ͳ ŝĞ&^<Ͳ'ƌĞŶnjĞŶƐŝŶĚůćŶĚĞƌĂďŚćŶŐŝŐ͘hŵĚŝĞ tŝĞĚĞƌŐĂďĞĂůůĞƌŝƐĐƐnjƵĞƌůĂƵďĞŶ͕ǁćŚůĞŶ^ŝĞΖƵƐΖ͘ [Netzwerk] ͻ [IP-Einstellungen] {Auto} - Automatische Abfrage der Netzwerkinformationen. {Manuell} - Manuelle Einrichtung der Netzwerk-Information. [Verbindungstest] Zeigt die Statusinformationen der Netzwerkverbindung an. [BD-Live Verbindung] {Erlaubt} - Bei der Wiedergabe einer BD-Live™-Disc kann die Disc alle Informationen vom zugewiesenen Netzwerk automatisch herunterladen. {Teilweise erlaubt} - Bei der Wiedergabe einer BD-Live™-Disc kann die Disc einen Teil der Informationen vom zugewiesenen Netzwerk automatisch herunterladen. {Verwehrt} - Herunterladen von Informationen aus Netzwerk desaktiviert. [Information] Zeigt alle Netzwerkinformationen an. Anzeige-Einstellungen 18 Um BD-Live™-Bonus-Inhalte zu genießen, muss eine Netzwerkverbindung eingerichtet werden. Hinweis: Ͳ ^ƚĞůůĞŶ^ŝĞƐŝĐŚĞƌ͕ĚĂƐƐĚĂƐEĞƚnjǁĞƌŬŬĂďĞů ŬŽƌƌĞŬƚĂŶŐĞƐĐŚůŽƐƐĞŶŝƐƚƵŶĚĚĞƌZŽƵƚĞƌ ĞŝŶŐĞƐĐŚĂůƚĞƚŝƐƚ͘ 1. Schließen Sie den Blu-ray Disc™-Player an ein Breitbandmodem oder einen Router an. 2. Wählen Sie im Menü Einstellungen die Option [Netzwerk] und drücken Sie anschließend auf X. 3. Wählen Sie im Menü dann [IP-Einstellungen] und drücken Sie danach auf OK, um [Auto] zu wählen. Eine IP-Adresse wird automatisch bezogen. Wenn keine IP-Adresse bezogen wird, wählen Sie [Manuell], um IP-Adresse, Subnet-Maske, Standard-Gateway, DNS1/ DNS2 einzugeben und drücken Sie auf OK, um die Verbindung zum Netzwerk wiederherzustellen. Er wird erneut versuchen, die IP-Adresse zu erhalten. 4. Drücken Sie auf RETURN oder OK zum Beenden. Hinweise: Ͳ /ŵDŽĚƵƐDĂŶƵĞůůĚƌƺĐŬĞŶ^ŝĞĂƵĨd͕ƵŵĚŝĞ EƵŵŵĞƌnjƵůƂƐĐŚĞŶ͕ĨĂůůƐƐŝĞĨĂůƐĐŚĞŝŶŐĞŐĞďĞŶ ǁƵƌĚĞ͘ Ͳ &ƺƌĚŝĞsĞƌďŝŶĚƵŶŐnjƵŵ/ŶƚĞƌŶĞƚŝƐƚĞŝŶsĞƌƚƌĂŐ ŵŝƚĞŝŶĞŵ/ŶƚĞƌŶĞƚƉƌŽǀŝĚĞƌŶƂƟŐ͘ Ͳ ŝĞƐĞƌWůĂLJĞƌƵŶƚĞƌƐƚƺƚnjƚĚŝĞĂƵƚŽŵĂƟƐĐŚĞ ƌŬĞŶŶƵŶŐǀŽŶƌŽƐƐĞĚͲŽǀĞƌͲ<ĂďĞůŶŶŝĐŚƚ͘ sĞƌǁĞŶĚĞŶ^ŝĞĞŝŶŶŽƌŵĂůĞƐ^ƚĂŶĚĂƌĚͲ>EͲ <ĂďĞů͘ Ͳ ĂƐ>ĂĚĞŶǀŽŶͲ>ŝǀĞΡͲ/ŶŚĂůƚĞŶĂƵƐĚĞŵ /ŶƚĞƌŶĞƚŬĂŶŶ͕ĂďŚćŶŐŝŐǀŽŶĚĞƌĂƚĞŝŐƌƂƘĞ ƵŶĚĚĞƌ/ŶƚĞƌŶĞƚǀĞƌďŝŶĚƵŶŐƐŐĞƐĐŚǁŝŶĚŝŐŬĞŝƚ͕ ĞƚǁĂƐĚĂƵĞƌŶ͘ 1. Drücken Sie auf SETUP, das Menü [Allgemeine Einstellungen] wird angezeigt. 2. Drücken Sie auf X, um [Anzeige-Einstellungen] zu wählen, und drücken Sie anschließend T. 3. Wählen Sie eine Option, drücken Sie auf X zum Öffnen. 4. Drücken Sie auf S/T, um eine Einstellungsoption zu wählen und drücken Sie auf X. 5. Wählen Sie die Einstellung, die geändert werden soll, und drücken Sie zum Bestätigen auf OK. - Drücken Sie auf W, um zum letzen Menü zurückzukehren. - Drücken Sie auf SETUP, um das Menü zu beenden. [TV] [TV Bildschirm] Wählen Sie das Bildschirmformat je nach gewünschter Bilddarstellung auf dem TVGerät. {16:9 Vollbild} - Für Disc mit Bildseitenverhältnis von 4:3, das Ausgabevideo wird auf 16:9 Vollbildschirm gestreckt. {16:9 Normal} - Für Disc mit Bildseitenverhältnis von 4:3, das Ausgabevideo wird vertikal an den Bildschirm angepasst. {4:3 Pan&Scan} - Für Standard-TV, zeigt ein breites Bild auf dem gesamtem Bildschirm an und beschneidet redundante Bereiche. [Video Prozess] [Video Anpassung] :lKOHQ6LHHLQHYRUGH¿QLHUWH Videoeinstellung. 1. Drücken Sie auf OK. 2. Drücken Sie auf W/X, um Helligkeit, Kontrast, Farbton und Farbsättigung einzustellen. {Helligkeit} - Drücken Sie auf W/X, um die Anzeigehelligkeit einzustellen, links bedeutet dunkler und rechts heller. {Kontrast} - Drücken Sie auf W/X, um den Anzeigekontrast einzustellen, nach links bedeutet niedriger und nach rechts hoher Kontrast. {Farbton} - Drücken Sie auf W/X, um den Anzeigefarbton einzustellen, links bedeutet geringere und rechts höhere Farbstärke. {Farbsättigung} - Drücken Sie auf W/X, um die Anzeigesättigung einzustellen, nach links bedeutet geringere und nach rechts höhere Sättigung. 3. Drücken Sie auf RETURN zum Beenden. [Schärfe] Auswahl des Schärfegrads: Hoch, Mittel, Niedrig. {Hoch} - Wählt einen hohen Schärfegrad. {Mittel} - Wählt einen mittleren Schärfegrad. {Niedrig} - Wählt einen niedrigen Schärfegrad. 19 D {/HWWHUER[} - Für Standard-TV, zeigt ein breites Bild mit zwei schwarzen Streifen oben und unten auf dem 4:3-Bildschirm an. >$XÀ|VXQJ@ :lKOHQ6LHHLQH9LGHRDXVJDEHDXÀ|VXQJGLH mit der TV-Bilddarstellungsfähigkeit kompatibel ist. {Auto} - Wählt die am besten geeignete $XÀ|VXQJIUGDV79*HUlW {480i/576i}, {480p/576p}, {720p}, {1080i}, {1080p} - Wählen Sie die beste 9LGHRDXÀ|VXQJVHLQVWHOOXQJIUGDV 79*HUlW:HLWHUH'HWDLOVGD]X¿QGHQ6LH in der TV-Bedienungsanleitung. [Farbraum] :lKOWHLQHQYRUGH¿QLHUWHQ)DUEUDXPIUGDV Bild. {RGB} - Wählt RGB-Farbraum. {YCbCr} - Wählt YCbCr-Farbraum. {YCbCr422} - Wählt YCbCr422-Farbraum. {Volle RGB} - Wählt vollen RGB-Farbraum. [HDMI Deep Color] Diese Funktion ist nur verfügbar, wenn das Anzeigegerät über ein HDMI-Kabel angeschlossen ist und die Funktion Deep Color unterstützt. {30 bits} - Ausgabe 30-bit Farbe. {36 bits} - Ausgabe 36-bit Farbe. {Aus} - Ausgabe Standard 24-bit Farbe. Hinweis: Ͳ tĞŶŶĚĞƌ&ĂƌďƌĂƵŵͣzďƌϰϮϮ͟ŝƐƚ͕ŐŝďƚĞƐ ŬĞŝŶĞĞĞƉŽůŽƵƌͲƵƐŐĂďĞͲĂƵĐŚǁĞŶŶ,D/ ĞĞƉŽůŽƌĂƵĨϯϬͬϯϲďŝƚƐŐĞƐĞƚnjƚŝƐƚ͘ [HDMI 1080/24p] {Ein} - Aktiviert 1080/24p 9LGHRDXÀ|VXQJVHLQVWHOOXQJ {Aus} - Desaktiviert 1080/24p 9LGHRDXÀ|VXQJVHLQVWHOOXQJ ,ŝŶǁĞŝƐĞnjƵ,D/ϭϬϴϬͬϮϰƉ͗ tĞŶŶĚŝĞϮϰͲ,njͲƵƐŐĂďĞĞŝŶŐĞƐƚĞůůƚǁĞƌĚĞŶƐŽůů͕ ŵƺƐƐĞŶϯƵŶƚĞŶƐƚĞŚĞŶĚĞĞĚŝŶŐƵŶŐĞŶĞƌĨƺůůƚ ǁĞƌĚĞŶ͗ ϭ͘ dsͲ'ĞƌćƚƵŶƚĞƌƐƚƺƚnjƚĚŝĞϮϰͲ,njͲŶnjĞŝŐĞ͖ Ϯ͘ /ŵWůĂLJĞƌŵƵƐƐŝŵ^ĞƚƵƉͬŝŶƌŝĐŚƚƵŶŐƐŵĞŶƺĚŝĞ ϮϰͲ,njͲKƉƟŽŶĞŝŶŐĞƐƚĞůůƚƐĞŝŶ͖ ϯ͘ DĞĚŝƵŵŵƵƐƐϮϰͲ,njͲsŝĚĞŽƐĞŝŶ͘ Hinweise: Ͳ ŝĞƐĞƵŇƂƐƵŶŐǁŝƌĚŶƵƌǁŝƌŬƐĂŵ͕ǁĞŶŶĚŝĞ ǁŝĞĚĞƌŐĞŐĞďĞŶĞŶůƵͲƌĂLJŝƐĐΡͲ/ŶŚĂůƚĞ &ŝůŵƋƵĞůůĞŶƐŝŶĚ͘ Ͳ ĞŝĚĞƌ,D/ϭϬϴϬͬϮϰƉͲtŝĞĚĞƌŐĂďĞƐƚĞŚƚŬĞŝŶĞ ŽŵƉŽƐŝƚĞͲƵƐŐĂďĞnjƵƌsĞƌĨƺŐƵŶŐ͘ Audio-Einstellungen 1. Drücken Sie auf SETUP, das Menü [Allgemeine Einstellungen] wird angezeigt. 2. Drücken Sie auf X, um [AudioEinstellungen] zu wählen, und drücken Sie anschließend auf T. 3. Wählen Sie eine Option, drücken Sie auf X zum Öffnen. [Dolby DRC] Wählt den Dynamiksteuermodus, damit bei einen mit geringer Lautstärke wiedergegebenen Film keine Klangqualitätsverluste auftreten. {Aus} - Keine Dynamikkompression. {Ein} - Dynamikkompression. {Auto} - Wählt DRC gemäß Eingangsaudioton. Die Einstellung von 'Auto' ist für Dolby TrueHD geeignet. System-Informationen D 4. Drücken Sie auf S/T, um eine Einstellungsoption zu wählen und drücken Sie auf X. 5. Wählen Sie die Einstellung, die geändert werden soll, und drücken Sie zum Bestätigen auf OK. - Drücken Sie auf W, um zum letzen Menü zurückzukehren. - Drücken Sie auf SETUP, um das Menü zu beenden. [Audio Ausgang] [Spdif] Wählt den Ausgangsmodus für KOAXIALBuchse, Optionen umfassen Bitstream, PCM, Neu kodieren und Aus. {Bitstream} - Ausgangsdigitalsignal ohne Verarbeitung. {PCM} - Ausgangsdigitalsignal mit Verarbeitung, nur zwei Exportkanäle. {Neu kodieren} - Automatische Auswahl des Signaltyps von KOAXIAL-Buchse gemäß Audioton auf Disc. {Aus} - Keine Ausgabe für S/PDIF. [HDMI] Wählt den Ausgangsmodus für HDMI OutBuchse, Optionen umfassen Bitstream, PCM, Neu kodieren und Aus. {Bitstream} - HDMI-Digitalsignal-Ausgabe ohne Verarbeitung. {PCM} - HDMI-Digitalsignal-Ausgabe mit Verarbeitung, nur zwei Kanäle werden gesendet. {Neu-kodieren} - Automatische Auswahl des Signaltyps von HDMI-Ausgangsbuchse gemäß Audioton auf Disc. {Aus} - Keine Ausgabe für HDMI. [Down_samp] Wählt die Digitalaudiosignal-SamplingFrequenz. {48K} - Für Disc, die mit Sampling-Rate von 48 kHz aufgenommen wurde. {96K} - Für Disc, die mit Sampling-Rate von 96 kHz aufgenommen wurde. {192K} - Für Disc, die mit Sampling-Rate von 192 kHz aufgenommen wurde. 20 1. Drücken Sie auf SETUP, das Menü [Allgemeine Einstellungen] wird angezeigt. 2. Drücken Sie auf X, um [System-Informationen] auszuwählen. - Die aktuelle Softwareversion und MACAdresse werden angezeigt. - Drücken Sie auf W, um zum letzen Menü zurückzukehren. - Drücken Sie auf SETUP, um das Menü zu beenden. 7 Technische Daten Video Signalsystem: PAL/NTSC HDMI-Ausgang: 480i/576i, 480p/576p, 720p, 1080i, 1080p, 1080/24p. Audio 'LJLWDODXVJDQJ.RD[LDO 0,5 Vp-p (75 Ohm) +'0,$XVJDQJ LAN LAN-Anschluss 10BASE-T/100BASE-TX USB 86%86%)XOOVSHHG86% High-speed 8QWHUVWW]WH%HUHLFKH)ODVK'DWHQVSHLFKHU Kartenlesegeräte, USB-HUB mit 4 Ports, USB-Massenspeichergerät. 8QWHUVWW]WH'DWHLV\VWHPH)$7 8QWHUVWW]WHPD[LPDOH*U|H*% ([WHUQH)HVWSODWWHRKQHHLJHQH Stromversorgung wird nicht unterstützt. <ŽŵƉĂƟďůĞĂƚĞŝĨŽƌŵĂƚĞ MP3-Tracks 8QWHUVWW]WH'DWHLHUZHLWHUXQJ PS 8QWHUVWW]WHU$XGLR&RGHF03 ,62)RUPDW 8QWHUVWW]WHHQWVSUHFKHQGH%LWUDWH 8kbps - 320kbps 8QWHUVWW]WH6DPSOLQJ)UHTXHQ]HQN+] 44,1kHz, 48kHz JPEG 8QWHUVWW]WH'DWHLHUZHLWHUXQJ MSJ RU MSHJ -3(*,62IRUPDW )RWR&'ZLUGQLFKWXQWHUVWW]W DivX® 8QWHUVWW]WH'DWHLHUZHLWHUXQJ ',9; 'LY;+' MKV 8QWHUVWW]WH'DWHLHUZHLWHUXQJ 0.9 8QWHUVWW]WH9LGHR&RGHFV+03+3 DivX, MPEG4 SP/ASP, MPEG1, MPEG2 8QWHUVWW]WH$XGLR&RGHFV$$&.DQDOX 5.1-Kanal, MP3, AC3, DTS, LPCM 8QWHUVWW]WH8QWHUWLWHO7H[W87)66$60, SUB, SRT, ASS :LHGHUJDEHYRQ0.9'DWHLHQLQ&'55:LVW eventuell nicht möglich (LQLJH'LVFVLP0.9)RUPDWN|QQHQHYHQWXHOO DEKlQJLJYRQGHU9LGHRDXÀ|VXQJXQG%LOGUDWH nicht wiedergegeben werden. Andere Formate 03 PS PRY $9, DYL MPEG ('.mpg', '.mpeg') Hauptgerät 6WURPYHUVRUJXQJ 200V-240V 50/60Hz 6WURPYHUEUDXFK: 6WURPYHUEUDXFKLP6WDQGE\0RGXV: $EPHVVXQJHQ%[+[7 360 x 38,5 x 205 (mm) 1HWWRJHZLFKWNJ %HWULHEVWHPSHUDWXU&ELV& %HWULHEVIHXFKWLJNHLW:HQLJHUDOV (ohne Kondensation) 0LWJHOLHIHUWHV=XEHK|U )HUQEHGLHQXQJ 1 R03 (Größe AAA) Batterie (LQIDFKH%$ 21 D Wiedergebbare Medien Dieses Produkt kann Folgendes wiedergeben: %OXUD\'LVF9LGHR%'55(%'$9 '9' '9'9LGHR '9'55: '9'55: DVD+R/-R DL (Dual Layer/Doppelschicht) 9LGHR&'69&' $XGLR&'&'5&'5: $9&+' 86%)ODVK'DWHQVSHLFKHU 8 Fehlerbeseitigung Wenn eine der folgenden Störungen bei der Benutzung dieses Geräts auftritt, suchen Sie in der folgenden Liste nach einer Lösung, bevor Sie den nächstgelegenen TOSHIBA-Händler befragen. Störung Tipp Keine Reaktion von der Fernbedienung. Schließen Sie das Gerät an die Netzsteckdose an. Richten Sie die Fernbedienung auf das Gerät. Setzen Sie die Batterie korrekt ein. Setzen Sie eine neue Batterie in die Fernbedienung ein. D Kein Videosignal auf dem Anzeigegerät. Schalten Sie das TV-Gerät ein. Stellen Sie das TV-Gerät auf den korrekten externen Eingang ein. :lKOHQ6LHGLHNRUUHNWH9LGHRDXÀ|VXQJ Stellen Sie das TV-System korrekt ein. Falsches oder fehlendes Audio/Videosignal auf dem Verstärker/Anzeigegerät über HDMI-Kabel. Wenn das Gerät über das HDMI-Kabel an ein nicht dafür ausgerüstetes Anzeigegerät angeschlossen ist, kann möglicherweise kein Audio/Video-Signal ausgegeben werden. .HLQ+LJK'H¿QLWLRQ Videosignal auf dem TV-Gerät. (QWKlOWGLH'LVF+LJK'H¿QLWLRQ9LGHR"+LJK'H¿QLWLRQ9LGHRLVWQLFKW verfügbar, wenn die Disc dieses nicht enthält. Kein Audiosignal aus den Lautsprechern der Audioanlage. Schalten Sie die Audioanlage ein. Disc kann nicht wiedergegeben werden. Stellen Sie sicher, dass der Blu-ray Disc™-Player die Disc unterstützt. Stellen Sie sicher, dass die Einstellungen am Verstärker/Anzeigegerät zu jenen vom Blu-ray Disc™-Player passen. 8QWHUVWW]WGDV79*HUlW+LJK'H¿QLWLRQ9LGHR"+LJK'H¿QLWLRQ9LGHR ist nicht verfügbar, wenn das TV-Gerät dieses nicht unterstützt. Stellen Sie die Audioanlage auf den korrekten externen Eingang ein. Erhöhen Sie die Lautstärke der Audioanlage. Stellen Sie sicher, dass der Blu-ray Disc™-Player den Regionalcode der DVD oder Blu-ray Disc™ unterstützt. Bei DVD+RW/+R oder DVD-RW/-R stellen Sie sicher, dass die Disc beim Brennen korrekt fertig gestellt wurde. Reinigen Sie die Disc. JPEG-Dateien von einer Disc Stellen Sie sicher, dass die Disc in JPG/ISO-Format aufgenommen können nicht wurde. wiedergegeben werden. DivX®-Dateien können nicht wiedergegeben werden. Stellen Sie sicher, dass die Disc in H.264 oder MPEG-4-Format aufgenommen wurde. MP3-Dateien von einer Disc können nicht wiedergegeben werden. Stellen Sie sicher, dass die Disc in ISO-Format aufgenommen wurde. Stellen Sie sicher, dass die Bitrate der MP3-Dateien zwischen 8 und 320kbps liegt. Stellen Sie sicher, dass die Sampling-Rate der MP3-Dateien 32kHz, 44,1kHz oder 48kHz beträgt. 22 Störung Tipp JPEG-Datei wird nicht gefunden. Stellen Sie sicher, dass die ausgewählte Gruppe (Ordner) nicht mehr als 9.999 Dateien bei DVDs und mehr als 999 Dateien bei CDs enthält. Stellen Sie sicher, dass die Dateierweiterung .jpg, .JPG, .jpeg oder .JPEG ist. MP3-Datei wird nicht gefunden. Stellen Sie sicher, dass der ausgewählte Ordner nicht mehr als 9.999 Dateien bei DVDs und nicht mehr als 999 Dateien bei CDs enthält. Wenn zur System-Aktualisierung ein USB-Datenspeicher verwendet wird, sollte ein neuer Ordner namens UPG_ALL angelegt werden und die Aktualisierungsdatei in diesen Ordner kopiert werden. Achten Sie beim Upgrade der Software des Systems über das Netzwerk darauf, dass der Player vorher bereits mit dem Internet verbunden ist. Manchmal können die Optionen des Einrichtungsmenüs nicht ausgewählt werden. Bei der Wiedergabe einer DVD- oder Blu-ray Disc™ drücken Sie ein Mal auf STOP, dann schaltet der Player in den StoppWiederaufnahme-Modus, in dem einige Einstellungen im Einrichtungsmenü wie Sprachmenü, Audio, Untertitel usw. nicht vorgenommen werden können. Wenn Sie diese ändern wollen, drücken Sie zwei Mal auf STOP, dann schaltet der Player in den vollständigen Stopp-Modus, in dem diese Änderungen vorgenommen werden können. 23 D Stellen Sie sicher, dass die Dateierweiterung .mp3 oder .MP3 ist. Software-Upgrade kann nicht ausgeführt werden. 9 Glossar AVI Audio Video Interleave, bekannt unter der Abkürzung AVI, ist ein MultimediaContainerformat. AVI-Dateien können sowohl Audio- als auch Video-Dateien in einem Container aufnehmen, wodurch die synchrone Wiedergabe von Audio und Video möglich ist. D Bildseitenverhältnis Bildseitenverhältnis bezieht sich auf das Verhältnis Länge zu Höhe der TV-Bildschirmanzeige. Das Verhältnis eines normalen TV-Geräts ist 4:3, während das 9HUKlOWQLVHLQHV+LJK'H¿QLWLRQRGHU%UHLWELOG TV-Geräts 16:9 beträgt. Der Letterbox-Modus macht es möglich, dass Sie ein breiteres Bild auf dem Standard-4:3-Bildschirm genießen können. Blu-ray-DiscTM Blu-ray-DiscTM ist die nächste Generation der optischen Video-Disc, die fünf Mal mehr Daten als eine konventionelle DVD speichern kann. Die große Speicherfähigkeit macht es möglich, EHVRQGHUH)HDWXUHVZLH+LJK'H¿QLWLRQRGHU HD-Videos, Mehrkanal-Surround-Sound, interaktive Menüs usw. zu genießen. BONUSVIEWTM Dies ist ein Blu-ray Disc™-Video (Final Standard 3UR¿OHRGHU3UR¿OHGDVLQWHUDNWLYH,QKDOWH unterstützt, die auf der Disc vorhanden sind, z. B. Bild-in-Bild. Dieses Gerät kann somit das erste und das zweite Video gleichzeitig wiedergeben. Digital-Audio Digital-Audio ist ein Tonsignal, das in numerische Werte konvertiert wurde. Digitaler Ton kann über mehrere Kanäle übertragen werden. Analoger Ton kann nur über zwei Kanäle übertragen werden. DivX® DivX® ist ein Codec (Komprimierung/ Dekomprimierung), der Bilder auf sehr geringe Datenmengen komprimieren kann. 'LY;&HUWL¿HG® zur Wiedergabe von DivX®Video 'DWHLHQELV]XU+'$XÀ|VXQJSLQNOXVLYH Premium Inhalten. h%(5',9;9,'(2 DivX® ein digitales Videoformat, das von DivX, Inc. HQWZLFNHOWZXUGH'LHVLVWHLQRI¿]LHOOHV'LY; &HUWL¿HG® Gerät, welches DivX-Videos wiedergibt. Besuchen Sie www.divx.com für weitere Informationen und Software, um Ihre Dateien in DivX-Videodateien umzuwandeln. 24 h%(5',9;9,'(221'(0$1'),/0($8) ABRUF: 'LHVHV'LY;&HUWL¿HG®-Gerät muss registriert werden, um erworbene DivX Video-on-Demand (VOD)-Filme wiederzugeben. Um Ihren Registriercode zu erhalten, suchen Sie den DivX-VOD-Abschnitt im Einrichtungsmenü des Geräts. Weitere Informationen zur Registrierung ¿QGHQ6LHXQWHUZZZYRGGLY[FRP Dolby® Digital Dies ist ein von Dolby Laboratories entwickeltes System, um Digitalton zu komprimieren. Es bietet Stereo-(2-Kanal) oder Multikanal-Audio. Dolby® Digital Plus Dolby Digital Plus ist die nächste Generation digitaler Audiokompressionstechnologie, die als Erweiterung von Dolby Digital entwickelt wurde. Blu-ray-Disc™ unterstützen 7.1 MultikanalSurround-Sound-Ausgabe. Dolby® TrueHD Dolby TrueHD ist eine verlustlose Codiertechnologie, die für die nächste Generation der optischen Discs entwickelt wurde. Blu-rayDisc™ unterstützen 7.1 Multikanal-SurroundSound-Ausgabe. DTS® DTS ist ein Multikanal-Surround-Soundsystem. Durch Anschluss an einen DTS-Decoder können Sie Filme wie im Kino mit dynamischen und realistischen Ton genießen, DTS SurroundSound-Technologien wurden entwickelt von DTS, Inc. DTS-HD® DTS-HD ist eine verlustlose Codiertechnologie, die als Erweiterung zum ursprünglichen DTS Coherent Acoustics-Format entwickelt wurde. Blu-ray-Disc™ unterstützen 7.1 MultikanalSurround-Sound-Ausgabe. DTS-HD Master AudioTM Eine mit DTS-HD Master Audio aufgezeichnete Disc bietet ALLE Informationen der originalen Master-Aufnahmen - Bit für Bit ist sie identisch mit den Originalaufnahmen der Toningenieure. Besser kann Audio nicht werden. MP3 Ein Dateiformat mit einem TondatenKomprimierungssystem. MP3 ist die Abkürzung von Motion Picture Experts Group 1 (oder MPEG-1) Audio-Schicht 3. Mit dem MP3-Format kann eine CD-R oder CD-RW 10 Mal mehr Daten als eine herkömmliche CD enthalten. HDMI® +LJK'H¿QLWLRQ0XOWLPHGLD,QWHUIDFH+'0,LVW eine digitale Hochgeschwindigkeitsschnittstelle, die nicht komprimierte, hoch aufgelöste Videos und digitalen Multikanal-Audioton überträgt. Sie bietet qualitativ hochwertige Bilder und Tonaufzeichnungen. HDMI ist vollständig rückwärts kompatibel mit DVI. Wie vom HDMIStandard gefordert, führt der Anschluss von HDMI- oder DVI-Geräten ohne HDCP (High bandwidth Digital Content Protection) dazu, dass weder Bild noch Ton ausgegeben werden. MP4 Das MP4-Dateiformat ist ein MultimediaContainer-Format und Bestandteil von MPEG-4. Es wird meist zur Speicherung von digitalen Video- und Audiostreams verwendet (insbesondere von MPEG (MPEG4, H264…), kann jedoch auch zur Speicherung von anderen Daten wie Untertiteln und einzelnen Bildern verwendet werden. JPEG Ein weit verbreitetes digitales Fotobildformat. Ein Standbild-Datenkomprimierungssystem, das von der Joint Photographic Expert Group vorgeschlagen wurde, das sich trotz der hohen Komprimierungsrate durch eine geringe Verminderung der Bildqualität auszeichnet. Dateien sind an ihrer Dateierweiterung '.jpg' oder '.jpeg' zu erkennen. LAN (Local Area Network) Eine Gruppe von miteinander verbundenen Geräten in einer Firma, einer Schule oder einem Haus. Zeigt die Grenzen eines Netzwerks an. Lokaler Speicher Dieser Speicherbereich wird als Speicherort für die Speicherung von zusätzlichen Inhalten von Blu-ray Disc™-Videos mit aktiviertem BD-Live™ verwendet. PBC Wiedergabesteuerung. Ein System, bei dem Sie durch eine Video-CD/Super- VCD mit Bildschirmmenüs navigieren, die auf der Disc aufgezeichnet sind. Sie können die interaktive Wiedergabe und Suche nutzen. PCM Impuls-Code-Modulation. Ein digitales Audiocodierungssystem. Regionalcode Ein System, wodurch die Disc nur in der zugewiesenen Region wiedergegeben werden kann. Dieses Gerät gibt nur Discs wieder, die einen kompatiblen Regionalcode haben. Sie ¿QGHQGHQ5HJLRQDOFRGHDXIGHP*HUlWHVFKLOG Einige Discs sind auch mit mehreren Regionen kompatibel (oder mit ALLEN Regionen). MKV Der Matroska-Multimedien-Container ist ein kostenloses Container-Format mit offenen Standards und kann eine unbegrenzte Anzahl von Video-, Audio-, Bild- oder Untertitel-Tracks in einer einzelnen Datei speichern. Es soll als universelles Format für die Speicherung von klassischen Multimedia-Inhalten dienen, wie beispielsweise Filmen oder TV-Sendungen. 25 D HDCP High-bandwidth Digital Content Protection High-bandwidth Digital Content Protection ist ein Verschlüsselungssystem. Diese Merkmale HUP|JOLFKHQHLQHVLFKHUHhEHUWUDJXQJYRQ digitalen Inhalten zwischen verschiedenen Geräten (um unerlaubte Kopien zu verhindern.)