Download Wall mounted split conditioner Gree Standard Standard Plus 7
Transcript
Change for Life Service Manual 0RGHOV *:+1$.11$$&ROG3ODVPD *:+1$.11%$&ROG3ODVPD *:+1$.11$$ *:+1$.11'$ *:+1%.11($ *:+1$.11$$ *:+1$.11$& *:+1$.11$$0HPEUDQD'HFRUDWLYH6WULS *:+1$.11$$&ROG3ODVPD *:+1$.11%$&ROG3ODVPD *:+1$.11%&&ROG3ODVPD *:+1%.11$$0HPEUDQD'HFRUDWLYH6WULS *:+1%.11$$ *:+1%.11$$&ROG3ODVPD *:+1%.11&& 5HIULJHUDQW5$ GREE ELECTRIC APPLIANCES,INC.OF ZHUHAI 7DEOHRI&RQWHQWV 7DEOHRI&RQWHQWV 6XPPDU\DQG)HDWXUHV 6DIHW\3UHFDXWLRQV 6SHFL¿FDWLRQV 8QLW6SHFL¿FDWLRQV &DSDFLW\9DULDWLRQ5DWLR$FFRUGLQJWR7HPSHUDWXUH 2SHUDWLRQ'DWD &RQVWUXFWLRQ9LHZV ,QGRRU8QLW 2XWGRRU8QLW 5HIULJHUDQW6\VWHP'LDJUDP 6FKHPDWLF'LDJUDP (OHFWULFDO:LULQJ 3ULQWHG&LUFXLW%RDUG )XQFWLRQDQG&RQWURO 5HPRWH&RQWURO2SHUDWLRQV 'HVFULSWLRQRI(DFK&RQWURO2SHUDWLRQ ,QVWDOODWLRQ0DQXDO 1RWLFHVIRU,QVWDOODWLRQ ,QVWDOODWLRQ'LPHQVLRQ'LDJUDP ,QVWDOO,QGRRU8QLW ,QVWDOO2XWGRRU8QLW &KHFNDIWHU,QVWDOODWLRQDQG7HVW2SHUDWLRQ ,QVWDOODWLRQDQG0DLQWHQDQFHRI+HDOWK\)LOWHU 7DEOHRI&RQWHQWV ([SORGHG9LHZVDQG3DUWV/LVW ,QGRRU8QLW 2XWGRRU8QLW 7URXEOHVKRRWLQJ 7URXEOHVKRRWLQJ &RQ¿UPDWLRQ -XGJHPHQWE\)ODVKLQJ/('RI,QGRRU2XWGRRU8QLW +RZWR&KHFN6LPSO\WKH0DLQ3DUW 5HPRYDO3URFHGXUH 5HPRYDO3URFHGXUHRI,QGRRU8QLW 5HPRYDO3URFHGXUHRI2XWGRRU8QLW 6XPPDU\DQG)HDWXUHV 6XPPDU\DQG)HDWXUHV ,QGRRU8QLW *:+1$.11$$,&ROG3ODVPD *:+1$.11$$,&ROG3ODVPD *:+1%.11$$,&ROG3ODVPD *:+1$.11$$, *:+1$.11'$, *:+1%.11($, *:+1$.11$&, *:+1$.11$$, *:+1$.11$$,0HPEUDQD'HFRUDWLYH6WULS *:+1%.11$$,0HPEUDQD'HFRUDWLYH6WULS *:+1%.11$$, *:+1%.11&&, 6XPPDU\DQG)HDWXUHV *:+1$.11%$,&ROG3ODVPD *:+1$.11%$,&ROG3ODVPD *:+1$.11%&,&ROG3ODVPD 2XWGRRU8QLW *:+1$.11%$2 *:+1%.11($2 *:+1$.11%$2 *:+1$.11%&2 *:+1%.11%$2 *:+1%.11%&2 5HPRWH&RQWUROOHU <;) T-ON T-OFF AUTO COOL DRY FAN HEAT SWING SLEEP LOCK SPEED ON/OFF MODE - + FAN SWING SLEEP TIMER 6DIHW\3UHFDXWLRQV 6DIHW\3UHFDXWLRQV Installing, starting up, and servicing air conditioner can be hazardous due to system pressure, electrical components, and equipment location, etc. Only trained, qualified installers and service personnel are allowed to install, start-up, and service this equipment. Untrained personnel can perform basic maintenance functions such as cleaning coils. All other operations should be performed by trained service personnel. Make sure the outdoor unit is installed on a stable, level surface with no accumulation of snow, leaves, or trash beside. When handling the equipment, observe precautions in the manual and on tags, stickers, and labels attached to the equipment. Follow all safety codes. Wear safety glasses andwork gloves. Keep quenching cloth and fire extinguisher nearby when brazing. Follow all the installation instructions to minimize the risk of damage from earthquakes, typhoons or strong winds. Read the instructions thoroughly and follow all warnings or cautions in literature and attached to the unit. Consult local building codes and current editions of national as well as local electrical codes. Recognize the following safety information: Warning Incorrect handling could result in personal injury or death. Caution Incorrect handling may result in minor injury,or damage to product or property. Warning All electric work must be performed by a licensed technician according to local regulations and the instructions given in this manual. Before installing, modifying, or servicing system, main electrical disconnect switch must be in the OFF position. There may be more than 1 disconnect switch. Lock out and tag switch with a suitable warning label. Never supply power to the unit unless all wiring and tubing are completed, reconnected and checked. This system adopts highly dangerous electrical voltage. Incorrect connection or inadequate grounding can cause personal injury or death. Stick to the wiring diagram and all the instructions when wiring. Have the unit adequately grounded in accordance with local electrical codes. Have all wiring connected tightly. Loose connection may lead to overheating and a possible fire hazard. Make sure the ceiling/wall is strong enough to bear the weight of the unit. Make sure the noise of the outdoor unit does not disturb neighbors. Avoid contact between refrigerant and fire as it generates poisonous gas. Apply specified refrigerant only. Never have it mixed with any other refrigerant. Never have air remain in the refrigerant line as it may lead to rupture and other hazards. Make sure no refrigerant gas is leaking out when installation is completed. Should there be refrigerant leakage, the density of refrigerant in the air shall in no way exceed its limited value, or it may lead to explosion. Keep your fingers and clothing away from any moving parts. Clear the site after installation. Make sure no foreign objects are left in the unit. Always ensure effective grounding for the unit. Caution Never install the unit in a place where a combustible gas might leak, or it may lead to fire or explosion. Make a proper provision against noise when the unit is installed at a telecommunication center or hospital. Provide an electric leak breaker when it is installed in a watery place. Never wash the unit with water. Handle unit transportation with care. The unit should not be carried by only one person if it is more than 20kg. Never touch the heat exchanger fins with bare hands. Never touch the compressor or refrigerant piping without wearing glove. Do not have the unit operate without air filter. Should any emergency occur, stop the unit and disconnect the power immediately. Properly insulate any tubing running inside the room to prevent the water from damaging the wall. All installation or repair work shall be performed by your dealer or a specialized subcontractor as there is the risk of fire, electric shock, explosion or injury. 6SHFL¿FDWLRQV 6SHFL¿FDWLRQV 8QLW6SHFL¿FDWLRQV *:+1$.11$$ *:+1$.11$$ *:+1$.11'$ *:+1$.11%$ 0RGHO &$&$ &$&$ &$&$ &$ 3URGXFW&RGH 5DWHG9ROWDJH 3RZHU6XSSO\ 5DWHG)UHTXHQF\ 3KDVHV 3RZHU6XSSO\0RGH &RROLQJ&DSDFLW\ +HDWLQJ&DSDFLW\ &RROLQJ3RZHU,QSXW +HDWLQJ3RZHU,QSXW &RROLQJ3RZHU&XUUHQW +HDWLQJ3RZHU&XUUHQW 5DWHG,QSXW 5DWHG&XUUHQW $LU)ORZ9ROXPH6++0/6/ 'HKXPLGLI\LQJ9ROXPH ((5 &23 6((5 +63) $SSOLFDWLRQ$UHD 9̚ +] : : : : $ $ : $ PK /K :: :: :: :: P 0RGHORILQGRRUXQLW )DQ7\SH 'LDPHWHU/HQJWK';/ PP )DQ0RWRU&RROLQJ6SHHG6++0/6/ UPLQ )DQ0RWRU+HDWLQJ6SHHG6++0/6/ UPLQ 2XWSXWRI)DQ0RWRU : )DQ0RWRU5/$ $ )DQ0RWRU&DSDFLWRU ȝ) ,QSXWRI+HDWHU : (YDSRUDWRU)RUP ,QGRRU8QLW 3LSH'LDPHWHU PP 5RZ¿Q*DS PP &RLO/HQJWK/;';: PP 6ZLQJ0RWRU0RGHO 2XWSXWRI6ZLQJ0RWRU : )XVH $ 6RXQG3UHVVXUH/HYHO6++0/6/ G%$ 6RXQG3RZHU/HYHO6++0/6/ G%$ 'LPHQVLRQ:;+;' PP 'LPHQVLRQRI&DUWRQ%R[/;:;+ PP 'LPHQVLRQRI3DFNDJH/;:;+ PP 1HW:HLJKW NJ *URVV:HLJKW NJ *:+1$.11$$ *:+1$.11$$ ,QGRRU *:+1$.11$$, *:+1$.11$$, *:+1$.11'$, *:+1$.11%$, &URVVÀRZ ĭ; $OXPLQXP)LQFRSSHU7XEH ĭ ;; 03$$ ;; ;; ;; ,QGRRU *:+1$.11$$, *:+1$.11$$, &URVVÀRZ ĭ; $OXPLQXP)LQFRSSHU7XEH ĭ ;; 03$$ ;; ;; ;; 6SHFL¿FDWLRQV 0RGHORI2XWGRRU8QLW &RPSUHVVRU0DQXIDFWXUHU7UDGHPDUN &RPSUHVVRU0RGHO &RPSUHVVRU2LO &RPSUHVVRU7\SH *:+1$.11%$2 *:+1$.11%$2 ;L DQ4LQJ DQ5HIULJHUDWLRQ (TXLSPHQW&R/WG4,1*$1 3$1$621,&:$1%$2 &2035(6625 *8$1*=+28&R/7' 3$1$621,& <=*$< 36($$ 5%(3 )96RUHTXLYDOHQW 5RWDU\ 5RWDU\ $ &RPSUHVVRU5/$ $ &RPSUHVVRU3RZHU,QSXW : %( %+ &DSLOODU\ &DSLOODU\ /5$ 2YHUORDG3URWHFWRU 7KURWWOLQJ0HWKRG 2SHUDWLRQ7HPS & a a $PELHQW7HPS&RROLQJ $PELHQW7HPS+HDWLQJ & & a a a a $OXPLQXP)LQFRSSHU7XEH $OXPLQXP)LQFRSSHU7XEH ĭ ĭ &RQGHQVHU)RUP 3LSH'LDPHWHU PP 5RZV¿Q*DS PP &RLO/HQJWK/;';: PP ;; ;; USP : $ )DQ0RWRU6SHHG 2XWSXWRI)DQ0RWRU 2XWGRRU8QLW )DQ0RWRU5/$ )DQ0RWRU&DSDFLWRU ȝ) PK $[LDOÀRZ $[LDOÀRZ ĭ ĭ 'HIURVWLQJ0HWKRG $XWRPDWLF'HIURVWLQJ $XWRPDWLF'HIURVWLQJ &OLPDWH7\SH ,VRODWLRQ 0RLVWXUH3URWHFWLRQ 7 , ,3 7 , ,3 $LU)ORZ9ROXPHRI2XWGRRU8QLW )DQ7\SH )DQ'LDPHWHU PP 3HUPLVVLEOH([FHVVLYH2SHUDWLQJ3UHVVXUH IRUWKH'LVFKDUJH6LGH 03D 3HUPLVVLEOH([FHVVLYH2SHUDWLQJ3UHVVXUH IRUWKH6XFWLRQ6LGH 03D 6RXQG3UHVVXUH/HYHO+0/ G%$ 6RXQG3RZHU/HYHO+0/ G%$ PP ;; ;; 'LPHQVLRQ:;+;' 'LPHQVLRQRI&DUWRQ%R[/;:;+ PP ;; ;; 'LPHQVLRQRI3DFNDJH/;:;+ PP ;; ;; 1HW:HLJKW *URVV:HLJKW 5HIULJHUDQW NJ NJ 5$ 5$ 5HIULJHUDQW&KDUJH /HQJWK *DV$GGLWLRQDO&KDUJH &RQQHFWLRQ 2XWHU'LDPHWHU/LTXLG3LSH 3LSH 2XWHU'LDPHWHU*DV3LSH 0D['LVWDQFH+HLJKW NJ P JP PP PP P ĭ ĭ ĭ ĭ P 0D['LVWDQFH/HQJWK 7KHDERYHGDWDLVVXEMHFWWRFKDQJHZLWKRXWQRWLFH3OHDVHUHIHUWRWKHQDPHSODWHRIWKHXQLW 6SHFL¿FDWLRQV *:+1$.11$& *:+1$.11%& *:+1$.11%$ &$ &$ &$ 9̚ +] 0RGHO 3URGXFW&RGH 5DWHG9ROWDJH 3RZHU6XSSO\ 5DWHG)UHTXHQF\ 3KDVHV ,QGRRU ,QGRRU &RROLQJ&DSDFLW\ 3RZHU6XSSO\0RGH : +HDWLQJ&DSDFLW\ : &RROLQJ3RZHU,QSXW : +HDWLQJ3RZHU,QSXW : &RROLQJ3RZHU&XUUHQW $ +HDWLQJ3RZHU&XUUHQW $ 5DWHG,QSXW : 5DWHG&XUUHQW $ $LU)ORZ9ROXPH6++0/6/ P K /K ((5 :: &23 :: 6((5 :: +63) :: 'HKXPLGLI\LQJ9ROXPH $SSOLFDWLRQ$UHD P 0RGHORILQGRRUXQLW )DQ7\SH *:+1$.11%$, &URVVÀRZ &URVVÀRZ PP ĭ; ĭ; )DQ0RWRU&RROLQJ6SHHG6++0/6/ UPLQ )DQ0RWRU+HDWLQJ6SHHG6++0/6/ UPLQ : )DQ0RWRU5/$ $ )DQ0RWRU&DSDFLWRU ȝ) ,QSXWRI+HDWHU : (YDSRUDWRU)RUP $OXPLQXP)LQFRSSHU7XEH $OXPLQXP)LQFRSSHU7XEH 3LSH'LDPHWHU PP ĭ ĭ 5RZ¿Q*DS PP &RLO/HQJWK/;';: PP ;; ;; 03$$ 03$$ 6ZLQJ0RWRU0RGHO 'LDPHWHU/HQJWK';/ 2XWSXWRI)DQ0RWRU ,QGRRU8QLW *:+1$.11$&, *:+1$.11%&, 2XWSXWRI6ZLQJ0RWRU : )XVH $ 6RXQG3UHVVXUH/HYHO6++0/6/ G%$ 6RXQG3RZHU/HYHO6++0/6/ G%$ 'LPHQVLRQ:;+;' PP ;; ;; 'LPHQVLRQRI&DUWRQ%R[/;:;+ PP ;; ;; 'LPHQVLRQRI3DFNDJH/;:;+ PP ;; ;; 1HW:HLJKW NJ *URVV:HLJKW NJ 6SHFL¿FDWLRQV 0RGHORI2XWGRRU8QLW &RPSUHVVRU0DQXIDFWXUHU7UDGHPDUN &RPSUHVVRU0RGHO &RPSUHVVRU2LO &RPSUHVVRU7\SH *:+1$.11%&2 *:+1$.11%$2 =+8+$,/$1'$&2035(6625 &2/7'*5(( 3$1$621,&:$1%$2 &2035(6625*8$1*=+28 &R/7'3$1$621,& 4;$%& 36($$ 5%(3 )96RUHTXLYDOHQW 5RWDU\ 5RWDU\ /5$ $ &RPSUHVVRU5/$ $ &RPSUHVVRU3RZHU,QSXW : 2YHUORDG3URWHFWRU 7KURWWOLQJ0HWKRG ,QWHUQDO %+ &DSLOODU\ &DSLOODU\ 2SHUDWLRQ7HPS & a a $PELHQW7HPS&RROLQJ $PELHQW7HPS+HDWLQJ & & a a a a &RQGHQVHU)RUP $OXPLQXP)LQFRSSHU7XEH $OXPLQXP)LQFRSSHU7XEH 3LSH'LDPHWHU PP ĭ ĭ 5RZV¿Q*DS PP &RLO/HQJWK/;';: )DQ0RWRU6SHHG 2XWSXWRI)DQ0RWRU 2XWGRRU8QLW )DQ0RWRU5/$ )DQ0RWRU&DSDFLWRU $LU)ORZ9ROXPHRI2XWGRRU8QLW PP ;; ;; USP : $ ȝ) P K )DQ7\SH )DQ'LDPHWHU PP $[LDOÀRZ $[LDOÀRZ ĭ ĭ 'HIURVWLQJ0HWKRG $XWRPDWLF'HIURVWLQJ $XWRPDWLF'HIURVWLQJ &OLPDWH7\SH ,VRODWLRQ 0RLVWXUH3URWHFWLRQ 7 , ,3 7 , ,3 3HUPLVVLEOH([FHVVLYH2SHUDWLQJ3UHVVXUH IRUWKH'LVFKDUJH6LGH 03D 3HUPLVVLEOH([FHVVLYH2SHUDWLQJ3UHVVXUH IRUWKH6XFWLRQ6LGH 03D 6RXQG3UHVVXUH/HYHO+0/ G%$ 6RXQG3RZHU/HYHO+0/ G%$ 'LPHQVLRQ:;+;' PP ;; ;; 'LPHQVLRQRI&DUWRQ%R[/;:;+ PP ;; ;; 'LPHQVLRQRI3DFNDJH/;:;+ PP ;; ;; 1HW:HLJKW *URVV:HLJKW 5HIULJHUDQW NJ NJ 5$ 5$ 5HIULJHUDQW&KDUJH /HQJWK *DV$GGLWLRQDO&KDUJH &RQQHFWLRQ 2XWHU'LDPHWHU/LTXLG3LSH 3LSH 2XWHU'LDPHWHU*DV3LSH 0D['LVWDQFH+HLJKW NJ P JP PP PP P ĭ ĭ ĭ ĭ P 0D['LVWDQFH/HQJWK 7KHDERYHGDWDLVVXEMHFWWRFKDQJHZLWKRXWQRWLFH3OHDVHUHIHUWRWKHQDPHSODWHRIWKHXQLW 6SHFL¿FDWLRQV 0RGHO *:+1%.11($ 3URGXFW&RGH &$ 5DWHG9ROWDJH 3RZHU6XSSO\ 5DWHG)UHTXHQF\ 9̚ +] 3KDVHV 3RZHU6XSSO\0RGH ,QGRRU &RROLQJ&DSDFLW\ : +HDWLQJ&DSDFLW\ : &RROLQJ3RZHU,QSXW : +HDWLQJ3RZHU,QSXW : &RROLQJ3RZHU&XUUHQW $ +HDWLQJ3RZHU&XUUHQW $ 5DWHG,QSXW : 5DWHG&XUUHQW $ $LU)ORZ9ROXPH6++0/6/ P K /K 'HKXPLGLI\LQJ9ROXPH ((5 :: &23 :: 6((5 :: +63) :: $SSOLFDWLRQ$UHD 0RGHORILQGRRUXQLW )DQ7\SH P 'LDPHWHU/HQJWK';/ PP ĭ; )DQ0RWRU&RROLQJ6SHHG6++0/6/ UPLQ )DQ0RWRU+HDWLQJ6SHHG6++0/6/ UPLQ : )DQ0RWRU5/$ $ )DQ0RWRU&DSDFLWRU ȝ) ,QSXWRI+HDWHU : 2XWSXWRI)DQ0RWRU (YDSRUDWRU)RUP 3LSH'LDPHWHU ,QGRRU8QLW 5RZ¿Q*DS &RLO/HQJWK/;';: $OXPLQXP)LQFRSSHU7XEH PP ĭ PP PP ;; 6ZLQJ0RWRU0RGHO *:+1%.11($, &URVVÀRZ 03$$ 2XWSXWRI6ZLQJ0RWRU : )XVH $ 6RXQG3UHVVXUH/HYHO6++0/6/ G%$ 6RXQG3RZHU/HYHO6++0/6/ G%$ 'LPHQVLRQ:;+;' PP ;; 'LPHQVLRQRI&DUWRQ%R[/;:;+ PP ;; 'LPHQVLRQRI3DFNDJH/;:;+ PP ;; 1HW:HLJKW NJ *URVV:HLJKW NJ 6SHFL¿FDWLRQV 0RGHORI2XWGRRU8QLW *:+1%.11($2 &RPSUHVVRU0DQXIDFWXUHU7UDGHPDUN =+8+$,/$1'$&2035(6625&2/7' &RPSUHVVRU0RGHO 4;$%& &RPSUHVVRU2LO 5%(3 &RPSUHVVRU7\SH 5RWDU\ /5$ $ &RPSUHVVRU5/$ $ &RPSUHVVRU3RZHU,QSXW : 2YHUORDG3URWHFWRU 83 7KURWWOLQJ0HWKRG &DSLOODU\ 2SHUDWLRQ7HPS & a $PELHQW7HPS&RROLQJ $PELHQW7HPS+HDWLQJ & & a a &RQGHQVHU)RUP $OXPLQXP)LQFRSSHU7XEH 3LSH'LDPHWHU PP 5RZV¿Q*DS PP &RLO/HQJWK/;';: PP ;; )DQ0RWRU6SHHG 2XWSXWRI)DQ0RWRU USP : $ )DQ0RWRU5/$ 2XWGRRU8QLW )DQ0RWRU&DSDFLWRU $LU)ORZ9ROXPHRI2XWGRRU8QLW ȝ) PK )DQ7\SH )DQ'LDPHWHU ĭ $[LDOÀRZ PP ĭ 'HIURVWLQJ0HWKRG $XWRPDWLF'HIURVWLQJ &OLPDWH7\SH ,VRODWLRQ 0RLVWXUH3URWHFWLRQ 7 , ,3 3HUPLVVLEOH([FHVVLYH2SHUDWLQJ3UHVVXUH IRUWKH'LVFKDUJH6LGH 03D 3HUPLVVLEOH([FHVVLYH2SHUDWLQJ3UHVVXUH IRUWKH6XFWLRQ6LGH 03D 6RXQG3UHVVXUH/HYHO+0/ G%$ 6RXQG3RZHU/HYHO+0/ G%$ PP ;; 'LPHQVLRQ:;+;' 'LPHQVLRQRI&DUWRQ%R[/;:;+ PP ;; 'LPHQVLRQRI3DFNDJH/;:;+ PP ;; 1HW:HLJKW *URVV:HLJKW 5HIULJHUDQW NJ NJ 5$ 5HIULJHUDQW&KDUJH /HQJWK *DV$GGLWLRQDO&KDUJH &RQQHFWLRQ 2XWHU'LDPHWHU/LTXLG3LSH 3LSH 2XWHU'LDPHWHU*DV3LSH 0D['LVWDQFH+HLJKW NJ P JP PP PP P ĭ ĭ P 0D['LVWDQFH/HQJWK 7KHDERYHGDWDLVVXEMHFWWRFKDQJHZLWKRXWQRWLFH3OHDVHUHIHUWRWKHQDPHSODWHRIWKHXQLW 6SHFL¿FDWLRQV *:+1%.11&& *:+1%.11$$ *:+1%.11$$ &$ &$&$ &$ 9̚ +] ,QGRRU ,QGRRU 0RGHO 3URGXFW&RGH 5DWHG9ROWDJH 3RZHU6XSSO\ 5DWHG)UHTXHQF\ 3KDVHV 3RZHU6XSSO\0RGH &RROLQJ&DSDFLW\ : +HDWLQJ&DSDFLW\ : &RROLQJ3RZHU,QSXW : +HDWLQJ3RZHU,QSXW : &RROLQJ3RZHU&XUUHQW $ +HDWLQJ3RZHU&XUUHQW $ 5DWHG,QSXW : 5DWHG&XUUHQW $LU)ORZ9ROXPH6++0/6/ 'HKXPLGLI\LQJ9ROXPH $ PK /K :: &23 :: 6((5 :: +63) :: P *:+1%.11&&, *:+1%.11$$, *:+1%.11$$, ((5 $SSOLFDWLRQ$UHD 0RGHORILQGRRUXQLW )DQ7\SH &URVVÀRZ &URVVÀRZ 'LDPHWHU/HQJWK';/ PP ĭ; ĭ; )DQ0RWRU&RROLQJ6SHHG6++0/6/ UPLQ )DQ0RWRU+HDWLQJ6SHHG6++0/6/ UPLQ 2XWSXWRI)DQ0RWRU : )DQ0RWRU5/$ $ )DQ0RWRU&DSDFLWRU ȝ) ,QSXWRI+HDWHU : (YDSRUDWRU)RUP ,QGRRU8QLW $OXPLQXP)LQFRSSHU7XEH $OXPLQXP)LQFRSSHU7XEH 3LSH'LDPHWHU PP 5RZ¿Q*DS PP &RLO/HQJWK/;';: PP ;; ;; 03$$ 03$$ 6ZLQJ0RWRU0RGHO 2XWSXWRI6ZLQJ0RWRU )XVH : ĭ ĭ $ 6RXQG3UHVVXUH/HYHO6++0/6/ G%$ 6RXQG3RZHU/HYHO6++0/6/ G%$ 'LPHQVLRQ:;+;' PP ;; ;; 'LPHQVLRQRI&DUWRQ%R[/;:;+ PP ;; ;; 'LPHQVLRQRI3DFNDJH/;:;+ PP ;; ;; 1HW:HLJKW NJ *URVV:HLJKW NJ 6SHFL¿FDWLRQV 0RGHORI2XWGRRU8QLW *:+1%.11%&2 *:+1%.11%$2 =+8+$,/$1'$ =+8+$,/$1'$ &2035(6625&2/7' &2035(6625&2/7' *5(( *5(( &RPSUHVVRU0DQXIDFWXUHU7UDGHPDUN &RPSUHVVRU0RGHO &RPSUHVVRU2LO &RPSUHVVRU7\SH 4;$%& 4;$%& 5%(3 5%(3 5RWDU\ 5RWDU\ /5$ $ &RPSUHVVRU5/$ $ &RPSUHVVRU3RZHU,QSXW : 2YHUORDG3URWHFWRU 7KURWWOLQJ0HWKRG ,QWHUQDO ,QWHUQDO &DSLOODU\ &DSLOODU\ 2SHUDWLRQ7HPS & a a $PELHQW7HPS&RROLQJ $PELHQW7HPS+HDWLQJ & & a a a a $OXPLQXP)LQFRSSHU7XEH $OXPLQXP)LQFRSSHU7XEH &RQGHQVHU)RUP 3LSH'LDPHWHU PP ĭ ĭ 5RZV¿Q*DS PP &RLO/HQJWK/;';: )DQ0RWRU6SHHG 2XWSXWRI)DQ0RWRU 2XWGRRU8QLW)DQ0RWRU5/$ PP ;; ;; USP : $ ȝ) $LU)ORZ9ROXPHRI2XWGRRU8QLW )DQ7\SH PK $[LDOÀRZ $[LDOÀRZ )DQ'LDPHWHU PP ĭ ĭ 'HIURVWLQJ0HWKRG $XWRPDWLF'HIURVWLQJ $XWRPDWLF'HIURVWLQJ &OLPDWH7\SH ,VRODWLRQ 0RLVWXUH3URWHFWLRQ 7 , ,3 7 , ,3 )DQ0RWRU&DSDFLWRU 3HUPLVVLEOH([FHVVLYH2SHUDWLQJ3UHVVXUH IRUWKH'LVFKDUJH6LGH 03D 3HUPLVVLEOH([FHVVLYH2SHUDWLQJ3UHVVXUH IRUWKH6XFWLRQ6LGH 03D 6RXQG3UHVVXUH/HYHO+0/ G%$ 6RXQG3RZHU/HYHO+0/ G%$ 'LPHQVLRQ:;+;' PP ;; ;; 'LPHQVLRQRI&DUWRQ%R[/;:;+ PP ;; ;; 'LPHQVLRQRI3DFNDJH/;:;+ PP ;; ;; 1HW:HLJKW *URVV:HLJKW 5HIULJHUDQW NJ NJ 5$ 5$ 5HIULJHUDQW&KDUJH /HQJWK *DV$GGLWLRQDO&KDUJH 2XWHU'LDPHWHU/LTXLG3LSH &RQQHFWLRQ 3LSH 2XWHU'LDPHWHU*DV3LSH 0D['LVWDQFH+HLJKW NJ P JP PP PP P ĭ ĭ ĭ ĭ P 0D['LVWDQFH/HQJWK 7KHDERYHGDWDLVVXEMHFWWRFKDQJHZLWKRXWQRWLFH3OHDVHUHIHUWRWKHQDPHSODWHRIWKHXQLW 6SHFL¿FDWLRQV &DSDFLW\9DULDWLRQ5DWLR$FFRUGLQJWR7HPSHUDWXUH +HDWOLQJ 110 120 100 100 90 80 Capacity ratio(%) Capacity ratio(%) &RROLQJ 80 70 Condition Indoor:DB27ćWB19ć Indoor air flow: Super High Pipe length:4m or 5m 60 60 40 Condition Indoor:DB20ć Indoor air flow: Super High Pipe length:4m or 5m 20 0 -15 50 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 Outdoor temp.(ć) -10 -5 0 Outdoor temp.( ć ) 5 10 2SHUDWLRQ'DWD &RROLQJ 7HPSHUDWXUHFRQGLWLRQ& ,QGRRU 0RGHOQDPH 2XWGRRU 6WDQGDUGSUHVVXUH +HDWH[FKDQJHUSLSHWHPS ,QGRRUIDQ 2XWGRRUIDQ PRGH PRGHUSP 303D 7& 7& . *:+1%.11($ . a LQa RXWa LQa RXWa 6XSHU+LJK . +HDWOLQJ 7HPSHUDWXUHFRQGLWLRQ& ,QGRRU 2XWGRRU 0RGHOQDPH 6WDQGDUGSUHVVXUH +HDWH[FKDQJHUSLSHWHPS ,QGRRUIDQ 2XWGRRUIDQ PRGH PRGHUSP 303D 7& 7& . *:+1%.11($ . a LQa RXWa LQa RXWa 6XSHU+LJK . 7HYDSRUDWRULQOHWDQGRXWOHWSLSHWHPSHUDWXUH 7FRQGHQVHULQOHWDQGRXWOHWSLSHWHPSHUDWXUH 3SUHVVXUHRIJDVSLSHFRQQHFWLQJLQGRRUDQGRXWGRRUXQLW 127(6 0HDVXUHVXUIDFHWHPSHUDWXUHRIKHDWH[FKDQJHUSLSHDURXQGFHQWHURIKHDWH[FKDQJHUSDWK8EHQW 7KHUPLVWRUWKHPRPHWHU &RQQHFWLQJSLSLQJFRQGLWLRQPRUP &RQVWUXFWLRQ9LHZV &RQVWUXFWLRQ9LHZV ,QGRRU8QLW W D H A B C A B C . *:+1%.11($ . 0RGHOV : + ' $ % & . *:+1%.11($ . 8QLWPP &RQVWUXFWLRQ9LHZV 2XWGRRU8QLW 0RGHOV*:+1$.11%$2*:+1%.11($2 255 720 310 428 660 286 440 8QLWPP 0RGHOV*:+1$.11%$2*:+1$.11%&2*:+1%.11%$2*:+1%.11%&2 257 540 712 776 320 286 510 8QLWPP 5HIULJHUDQW6\VWHP'LDJUDP 5HIULJHUDQW6\VWHP'LDJUDP &RROLQJ+HDWLQJ0RGHOV INDOOR UNIT OUTDOOR UNIT HEAT EXCHANGER (EVAPORATOR) COOLING HEATING 5HIULJHUDQWSLSHGLDPHWHU /LTXLGPP *DVPP*:+1$.11$$*:+1$.11$$*:+1$.11'$*:+1$.11%$ *:+1%.11($*:+1%.11&&*:+1$.11$&*:+1$.11%$*:+1$.11%& *DVPP*:+1$.11$$*:+1$.11$$*:+1%.11$$*:+1%.11$$ 6FKHPDWLF'LDJUDP 6FKHPDWLF'LDJUDP (OHFWULFDO:LULQJ (OHFWULFDO'DWD 6\PERO %8 <( 5' 97 2* :+ &RORUV\PERO %/8( <(//2: 5(' 9,2/(7 25$1*( :+,7( 6\PERO %1 %. <(*1 6\PERO &RORUV\PERO %52:1 %/$&. <(//2:*5((1 3DUWQDPH 3527(&7,9( ($57+ ,QGRRU8QLW 0RGHOV*:+1$.11$$,&ROG3ODVPD*:+1$.11$$,&ROG3ODVPD *:+1$.11%$,&ROG3ODVPD*:+1$.11%$,&ROG3ODVPD *:+1$.11%&,&ROG3ODVPD L N AP1 RT2 RT1 N 2 4 5 6FKHPDWLF'LDJUDP 0RGHOV*:+1$.11'$,*:+1$.11$$,0HPEUDQD'HFRUDWLYH6WULS *:+1$.11$$,*:+1$.11$$,*:+1$.11$&, L N AP1 RT2 RT1 N 2 4 5 0RGHO*:+1%.11($, TUBE TEMP. SENSOR RECEIVER AND DISPLAY BOARD AP1 DISPLAY POWER 0 0 RT1 RT2 ROOM DISP1 DISP2 TUBE AP1 PRINTED CIRCUIT BOARD N1 CAP K1 JUMP AC-L COMP 4V SWING-UD M2 STEPPING MOTOR PG PGF N L OFAN PE EARTH-PLATE YEGN YEGN PE EVAPORATOR XT BU BU N(1) BK BK 2 VT VT 4 OG 5 TERMINAL BLOCK OG C0NNECTING CABLE OUTDOOR UNIT ROOM TEMP. SENSOR BU(WH) BN(BK) YEGN(GN) M1 FAN MOTOR 6FKHPDWLF'LDJUDP 0RGHOV*:+1%.11$$,0HPEUDQD'HFRUDWLYH6WULS*:+1%.11$$, *:+1%.11&&, L N RT2 RT1 N 2 4 5 I II 0RGHO*:+1%.11$$,&ROG3ODVPD L N RT2 RT1 N 2 4 5 I II 6FKHPDWLF'LDJUDP 2XWGRRU8QLW 0RGHOV*:+1$.11%$2*:+1$.11%$2 0RGHO*:+1%.11%$2 6FKHPDWLF'LDJUDP 0RGHOV*:+1%.11($2*:+1$.11%&2*:+1%.11%&2 7KHVHFLUFXLWGLDJUDPVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFHSOHDVHUHIHUWRWKHRQHVXSSOLHGZLWKWKHXQLW 6FKHPDWLF'LDJUDP 3ULQWHG&LUFXLW%RDUG . TOP VIEW 1 2 3 4 5 6 7 8 9 NO. 16 1 2 PG motor 3 Neutral wire 4 5 15 10 11 Outdoor fan 7 Auto button 9 BOTTOM VIEW 12 Up&down swing control terminal Interface feedback from indoor fan 10 Display control terminal 1 11 Display control terminal 2 12 13 13 Live wire of Health function 4-way valve control terminal 6 8 14 Part Name Neutral wire of Health function 14 Interface of pipe temperature sensor Interface of ambient temperature sensor Compressor 15 Live wire 16 Fan capacitor 6FKHPDWLF'LDJUDP *:+1%.11($, ●TOP VIEW 4 5 6 7 8 9 3 1 Compressor control relay K1 2 Fuse 10 3 2 4 Indoor fan control port 5 Auxiliary heating relay K113, K112 6 7 1 11 14 ●BOTTOM VIEW 13 12 Interface of health function neutral wire and control relay K116 4-way valve control control relay K115 Outdoor fan control control relay K113 port and port and 8 Auto button 9 Up & down swing control port 10 Indoor fan feedback interface 11 Display control port 12 Pipe temp sensor interface 13 Ambient temp sensor interface 14 High frequency transformer T1 6FKHPDWLF'LDJUDP . TOP VIEW 3 4 5 6 7 8 9 2 NO. Part name 1 Compressor control relay 2 Protective tube 3 Indoor fan control terminal 4 Neutral wire terminal of power supply 5 4-way valve control terminal & control relay K115 6 1 Outdoor fan control terminal & control relay K114 7 13 10 8 12 11 Auto button Up & down swing control terminal 9 Indoor fan feedback terminal 10 Display control terminal 11 Tube temperature sensor connector 12 Ambient temperature sensor connector BOTTOM VIEW 13 Linear transformer input terminal TR-IN & output terminal TR-OUT )XQFWLRQDQG&RQWURO )XQFWLRQDQG&RQWURO 5HPRWH&RQWURO2SHUDWLRQV 1 ON/OFF Press it to start or stop operation. 2 MODE Press it to select operation mode(AUTO/COOL/DRY/FAN/HEAT). 1 2 3 4 5 6 7 8 3 - : Press it to decrease temperature setting. 4 + : Press it to increase temperature setting. 5 FAN Press it to set fan speed. 6 SWING Press it set swing angle. 7 SLEEP 8 TIMER Press it set auto-on/auto-off timer. 1 ON/OFF : Press this button to start the unit operation .Press this button again to stop the unit operation. 2 MODE : Each time you press the button,a mode is selected in a sequence that goes from AUTO,COOL,DRY, FAN,and HEAT*, as the following: AUTO COOL DRY FAN HEAT * *Note:Only for models with heating function. 3 - : Press this button to decrease set temperature.Holding it down above 2 seconds rapidly decreases set temperature. In AUTO mode, set temperature is not adjustable. 4 + : Press this button to increase set temperature.Holding it down above 2 seconds rapidly increases set temperature. In . AUTO mode, set temperature is not adjustable. 5 FAN: This button is used for setting Fan Speed in the sequence that goes from AUTO, to Auto. Auto Speed 1 Speed 2 6 SWING : Press this key to activate or deactivate the swing. Speed 3 Speed 4 , , to ,then back )XQFWLRQDQG&RQWURO 7 SLEEP: Press this button to go into the SLEEP operation mode. Press it again to cancel. This function is available in COOL , HEAT (Only for models with heating function) or DRY mode to maintain the most comfortable temperature for you. 8 TIMER: Press this button to initiate auto-on/auto-off timer. To cancel auto-timer program, press this button twice. 94 Combination of "+" and "-" buttons: About lock Press " + " and " - " buttons simultaneously to lock or unlock the keypad. If the remote controller is locked , I n this case, press ing any button, is displayed blinks three times. 10 Combination of "MODE " and "-" buttons: About switch between fahrenheit and cenrigrade At unit OFF , press "MODE " and " - " buttons simultaneously to switch between 11 and . Combination of "+" and "FAN" buttons:About Lamp Under switch-on or switch-off state, you may hold "+" and "FAN" buttons simultaneously for 3 seconds to set the lamp on or off and send the code. After being energized, the lamp is defaulted on. Replacement of Batteries 1.Remove the battery cover plate from the rear of the remote controller. (As shown in the figure) 2.Take out the old batteries. 3.Insert two new AAA1.5V dry batteries, and pay attention to the polarity. 4. Close the battery cover plate. Notes: ● When replacing the batteries, do not use old or different types of batteries otherwise, it may cause malfunction. ● Fig.1 If the remote controller will not be used for a long time, please remove batteries to prevent batteries from leaking. ● The operation should be performed in its receiving range. ● ● It should be kept 1m away from the TV set or stereo sound sets. If the remote controller does not operate normally, please take the batteries out and replace them after 30 seconds. If still not operating properly.replace the batteries. Fig.2 )XQFWLRQDQG&RQWURO 'HVFULSWLRQRI(DFK&RQWURO2SHUDWLRQ 1 Temperature Parameters Indoor preset temperature (Tpreset) Indoor ambient temperature (Tamb.) 2 Basic functions (The temperature in this manual is expressed by Centigrade. If Fahrenheit, is used, the switchover between them is Tf=TcX1.8+32.) Once the unit is energized, the compressor shall never be restarted except 3mins interval at least. For the first energization, if the unit is at off status before power failure, the compressor can be restarted without 3-min delay. But if the unit is at on status before power failure, the compressor shall be restarted with 3mins delay. Once the compressor is started up, the compressor won't stop running within 6mins with the change of room temperature. (1)Cooling mode Cooling conditions and process When Tamb. Tpreset+1 , the unit starts cooling operation. In this case, the compressor and the outdoor fan operate and the indoor fan operates at set speed. When Tamb. Tpreset-1 , the compressor and the outdoor fan stop while the indoor fan runs at set speed. When Tpreset-1 Tamb. Tpreset+1 , the unit will maintain its previous running state. In cooling mode, the four-way valve is de-energized; temperature setting range is 16 30 the indoor unit displays operation icon, cooling icon and set temperature. Start cooling Tamb. Tpreset+1 Original operating status Tpreset 1 min. min. min. Stop cooling Compressor Outdoor fan Set Fan speed Indoor fan Stop Run Protection Functions Freeze potection If the system is under freeze protection, the compressor and the outdoor fan stop operation, and the indoor fan operates at set speed. If freeze protection is eliminated and the compressor has been out of operation for 3 minutes, the unit will resume its previous running state. Freeze protection period min Compressor Outdoor fan Set Fan Speed Indoor fan Run Stop )XQFWLRQDQG&RQWURO (2)Dry Mode Dry Conditions and Process When Tamb. Tpreset+2 , the unit will run in dry and cooling mode, in that case the compressor and outdoor fan will run and the indoor fan will run at low speed. Tamb. Tpreset+2 , the unit will run in dry mode, in that case, the indoor fan will run at low speed, the When Tpreset-2 compressor and the outdoor fan will be stopped in 6 min. After 4 min, the compressor and the outdoor fan will be restarted. Dry process is cycled as the above. When Tamb. Tpreset-2 , the compressor and the outdoor fan will stop working and the indoor fan will run at low speed. In this mode, the four-way valve is de-energized, and setting temperature range is between 16 30 . The displayer will display running and drying icons and setting temperature. Tamb. Cooling Tpreset+2 Dehumidfying Tpreset 2 min . Stop min. min. min. Compressor Outdoor fan Indoor fan Low speed Run Stop Protection Freeze potection If freeze protection of the system is detected in dry and cooling mode, the compressor and the outdoor fan will stop running and the indoor fan will run at low speed. When the freeze protection is released and the compressor has been stopped for 3 min, the complete unit will resume its previous running state. Upon the condition that the compressor runs for 6 min and stops for 4 min is met and freeze protection is detected, the compressor and the outdoor fan will stop running and the indoor fan will run at low speed. When the freeze protection is released and the compressor has been stopped for 4 min, the complete unit will resume its previous running state. Other protection Other protections are the same as those in cooling mode. (3)Heating mode Heating conditions and process When Tamb. Tpreset+2 , the unit will run in heating mode, in that case, the four-way valve, the compressor and the outdoor fan will run simultaneously. The indoor fan will delay at most 2mins to run. The indoor fan will run 2 mins delayed at most. When Tamb Tpreset+4 , the compressor and the outdoor fan will stop and the four-way valve will remain energized(keep energizing) and the indoor fan will blow residual heat. T amb. Tpreset +4 , the unit will maintain its previous running state. When Tpreset +2 Under this mode, the four-way valve is energized, and setting temperature range is 16 30 . The displayer will display running and heating icons and setting temperature. stop heating Tpreset original operation status Tpreset Tamb. start heating min min min Compressor Outdoor unit Indoor unit min setting fan speed min setting fan speed 4-way valve Run Stop )XQFWLRQDQG&RQWURO Defrosting Conditions and Process The unit with intelligent defrosting function can defrost according to frosting conditions. Dual8 displays H1. Protection Function High Temp Resistance Protection If it is detected that the evaporator tube temperature is superheating, the outdoor fan will stop working. When the tube temperature resumes to normal condition, the outdoor fan will resume running. Noise Silencing Protection If the unit is stopped by pressing ON/OFF or during switchover of modes, the reversing valve will be stopped after 2 min. (4)Fan mode In this mode, indoor fan runs at setting speed, and the compressor, the outdoor fan, the four-way valve and the electric heating tube will stop running. In this mode, temperature setting range is 16 30 . Displayer displays running icons and the setting temperature. (5)Auto Mode In this mode, the air conditioner will automatically select its running mode (cooling, heating or fan) with the change of ambient temperature. The displayer will display the running icons, actual running mode icon and setting temperature. There is 30s delay protection for mode switching. Protection functions are the same as those in any other mode. 3 Other Control (1)Timer function The mainboard combines general timer and clock timer functions. Timer functions are selected by equipping remote controller with different functions. General Timer: Timer ON can be set under off state of unit. If timer ON reaches, the controller will run under previous setting mode. Timing interval is 0.5hr and the setting range is 0.5-24hr. Timer OFF can be set under on state of unit. If timer OFF reaches, the unit is turned off. Timing interval is 0.5hr within the range of 0.5-24hr. Clock Timer: If timer on is set under running state of unit, the system will continue running. If timer on is set under off state of unit, the system will run in presetting mode when timer on reaches. If timer off is set under off state of unit, the system will keep standby state. If timer off is set under on state of unit, the system will stop running when timer off reaches. Timer Change: If the system is under timer state, the unit can be turned on/off by ON/OFF button of remote controller. Timing can also be reset and then the system runs according to the final setting. If timer on and timer off is set at the same time under running state of system, the system will keep present running state till timer off reaches and then it will stop running. If timer on and timer off are set at the same time under off state of system, the system will keep stopping till timer on reaches and then it will start running. In the future, the system will run in presetting mode when timer on reaches and stop when timer off reaches every day. If timer on and timer off have the same setting, timer off is prevails. (2)Auto Button If press this button, the system will run in auto mode, and the indoor fan motor will run at auto speed; meanwhile, the swing motor will be running. Repress this button to turn off the unit. (3)Buzzer When the controller is energized or receives any command or signal from the buttons or the remote controller, the buzzer will give out a beep. (4)Sleep Function Choose the sleeping curve according to the preset temperature. (5)Turbo Function This function can be set in cooling or heating mode. )XQFWLRQDQG&RQWURO (6)Dry Function This function can be set in cooling or dry mode. (7)Automatic Control of Fan Speed In this mode, the indoor fan will automatically select high, medium or low speed with the change of ambient temperature. (8)Up & Down Swing After energization, up & down swing motor will rotate guide louver anticlockwise to position 0 to close air outlet. After turning on the unit, if swing function has not been set, up & down guide louver will clockwise turn to position D in heating mode, or clockwise turn to level position L in other modes. If the unit is turned on with swing function setting, the guide louver will swing between W and D. There are 7 kinds of swing states of guide louver: There are position L, A, B, C, D, and it swings and stops between L and D ( angle between L and D is equiangular). Upon stop of unit, the guide louver will close to position O. Swing action is valid only when swing command is set and indoor fan is running. Note: If the position is set between L and B, A and C or B and D by remote controller, the guide louver will swing between L and D. degree L A B C D (9)Display Running icon and Mode icon Upon energization, the unit will display all icons. Under standby state, running indicating icon is displayed in red. If the unit is started by remote controller, running indicating icon gives off light; Meanwhile, the present setting running mode icon will be displayed(mode LED: cooling, heating and dry mode). If the light button is turned off, all icons display will be closed. Dual-8 Display After starting the unit for the first time, the nixie tube will display present setting temperature in default (16-30 ) the nixie tube will default to display the preset temperature. When displaying setting temperature signal is received, the nixie tube will display setting temp. If displaying ambient temperature signal is received, the nixie tube will display present indoor ambient temperature. If other states are set by remote controller, the display will keep previous. If remote controller receives valid signal during displaying ambient temperature, ambient temperature will be displayed after setting temperature is displayed for 5s. F1 is displayed for ambient temperature sensor malfunction, F2 for tube temp sensor malfunction of indoor unit and C5 for jumper cap has malfunction. Some models: The remote controller will display present setting temp when this display is set. The controller will display ambient temp for 5s and then setting temp only when indoor ambient temp displaying state is switched from other displaying states by remote controller. (10)Locked protection to PG motor When starting the fan, if motor’s rotational speed is slow for a period of time, the unit will display Locked and stop running to avoid auto protection for motor. If the unit is on currently, error code H6 will be displayed by the dual-8 nixie tube. If the unit is off currently, this locked malfunction information won’t be displayed. (11)Power-off memory Memory content includes mode, up&down swing, light, setting temp and setting fan speed. Upon power failure, the unit after power recovery will automatically start to run according to memory content. The system, last remote-control command without timer setting, will memorize the last remote-control signal and run according to it. If the last remote controller command has general timer function and the system is de-energized before setting time, the system will memorize the last timer function in remote controller command after re-energization and time will be recalculated. If there is function in the last remote controller command but setting time has reached, the system will act as timer on/off setting before de-energization. After re-energization, the system memorizes the running states before power failure without timer action. Clock timer can not be memorized. ,QVWDOODWLRQ0DQXDO ,QVWDOODWLRQ0DQXDO 1RWLFHVIRU,QVWDOODWLRQ ,PSRUWDQW1RWLFHV 7KHXQLWLQVWDOODWLRQZRUNPXVWEHGRQHE\TXDOL¿HGSHUVRQQHODFFRUGLQJWRWKHORFDOUXOHVDQGWKLVPDQXDO %HIRUH LQVWDOODWLQJ SOHDVH FRQWDFW ZLWK ORFDO DXWKRUL]HG PDLQWHQDQFH FHQWHU LI XQLW LV QRW LQVWDOOHG E\ WKH DXWKRUL]HG PDLQWHQDQFHFHQWHUWKHPDOIXQFWLRQPD\QRWVROYHG GXHWRGLVFRPPRGLRXVFRQWDFWV :KHQUHPRYLQJWKHXQLWWRWKHRWKHUSODFHSOHDVH¿UVWO\FRQWDFWZLWKWKHDXWKRUL]HG0DLQWHQDQFH&HQWHULQWKHORFDODUHD WKHDSSOLDQFHPXVWEHSRVLWLRQHGVRWKDWWKHSOXJLVDFFHVVLEOH $IWHUSXOORXWWKHSRZHUSOXJWKHQPDNHWKHDSSOLDQFHRSHUDWLRQDJDLQWRDYRLGWKHLFLQJRIRXWGRRUXQLWGDPDJHD[LDO ÀRZ IDQVKRXOGHOHFWULI\WKHDSSOLDQFHEXWQRWRSHUDWLRQIRUKRXUVIRUZDUPXSSXUSRVH ,QVWDOODWLRQ6LWH,QVWUXFWLRQV ,QVWDOOLQWKHIROORZLQJSODFHPD\FDXVHPDOIXQFWLRQ,ILWLVXQDYRLGDEOHFRQWDFWZLWKVHUYLFHFHQWHUSOHDVH ƔVWURQJKHDWVRXUFHVYDSRXUVÀDPPDEOHJDVRUYRODWLOHOLTXLGVDUHHPLWWHG ƔKLJKIUHTXHQF\HOHFWURPDJQHWLFZDYHVDUHJHQHUDWHGE\UDGLRHTXLSPHQWZHOGHUVDQGPHGLFDOHTXLSPHQW ƔVDOWODGHQDLUSUHYDLOVVXFKDVFORVHWRFRDVWDODUHDV ƔWKHDLULVFRQWDPLQDWHGZLWKLQGXVWULDOYDSRXUVDQGRLOV ƔWKHDLUFRQWDLQVVXOSKXUHVJDVVXFKDVLQKRWVSULQJ]RQHV ƔFRUURVLRQRUSRRUDLUTXDOLW\H[LVWV ,QVWDOODWLRQ6LWHRI,QGRRU8QLW 7KHDLULQOHWDQGRXWOHWVKRXOGEHDZD\IURPWKHREVWUXFWLRQV(QVXUHWKHDLUFDQEHEORZQWKURXJKWKHZKROHURRP 6HOHFWDVLWHZKHUHWKHFRQGHQVDWHFDQEHHDVLO\GUDLQHGRXWDQGZKHUHLWLVHDVLO\FRQQHFWHGWRRXWGRRUXQLW 6HOHFWDSODFHZKHUHLWLVRXWRIUHDFKRIFKLOGUHQ 6HOHFWDSODFHZKHUHWKHZDOOLVVWURQJHQRXJKWRZLWKVWDQGWKHIXOOZHLJKWDQGYLEUDWLRQRIWKHXQLW %HVXUHWROHDYHHQRXJKVSDFHWRDOORZDFFHVVIRUURXWLQHPDLQWHQDQFH7KHLQVWDOODWLRQVLWHVKRXOGEHFPRUPRUHDERYH WKHÀRRU 6HOHFWDSODFHDERXWPRUPRUHDZD\IURP79VHWRUDQ\RWKHUHOHFWULFDSSOLDQFH 6HOHFWDSODFHZKHUHWKH¿OWHUFDQEHHDVLO\WDNHQRXW 0DNHVXUHWKDWWKHLQGRRUXQLWLVLQVWDOOHGLQDFFRUGDQFHZLWKLQVWDOODWLRQGLPHQVLRQLQVWUXFWLRQV 'RQRWXVHWKHXQLWLQWKHODXQGU\RUE\VZLPPLQJSRROHWF ,QVWDOODWLRQ6LWHRI2XWGRRU8QLW 6HOHFWDVLWHZKHUHQRLVHDQGRXWÀRZDLUHPLWWHGE\WKHXQLWZLOOQRWDQQR\QHLJKERUV 6HOHFWDVLWHZKHUHWKHUHLVVXI¿FLHQWYHQWLODWLRQ 6HOHFWDVLWHZKHUHWKHUHLVQRREVWUXFWLRQEORFNLQJWKHLQOHWDQGRXWOHW 7KHVLWHVKRXOGEHDEOHWRZLWKVWDQGWKHIXOOZHLJKWDQGYLEUDWLRQ 6HOHFWDGU\SODFHEXWGRQRWH[SRVHWKHXQLWWRGLUHFWVXQOLJKWRUVWURQJZLQG 0DNHVXUHWKDWWKHRXWGRRUXQLWLVLQVWDOOHGLQDFFRUGDQFHZLWKWKHLQVWDOODWLRQLQVWUXFWLRQVDQGLVFRQYHQLHQWIRUPDLQWHQDQFH DQGUHSDLU 7KHKHLJKWGLIIHUHQFHEHWZHHQLQGRRUDQGRXWGRRUXQLWVLVZLWKLQ;PDQGWKHOHQJWKRIWKHFRQQHFWLQJWXELQJGRHVQRWH[FHHG<P 0RGHO . . . ; < ,QVWDOODWLRQ0DQXDO 6HOHFWDSODFHZKHUHLWLVRXWRIUHDFKRIFKLOGUHQ 6HOHFWDSODFHZKHUHWKHXQLWGRHVQRWKDYHQHJDWLYHLPSDFWRQSHGHVWULDQVRURQWKHFLW\ 6DIHW\3UHFDXWLRQVIRU(OHFWULF$SSOLDQFHV $GHGLFDWHGSRZHUVXSSO\FLUFXLWVKRXOGEHXVHGLQDFFRUGDQFHZLWKORFDOHOHFWULFDOVDIHW\UHJXODWLRQV 'RQ WGUDJWKHSRZHUFRUGZLWKH[FHVVLYHIRUFH 7KHXQLWVKRXOGEHUHOLDEO\HDUWKHGDQGFRQQHFWHGWRDQH[FOXVLYHHDUWKGHYLFHE\WKHSURIHVVLRQDOV 7KHDLUVZLWFKPXVWKDYHWKHIXQFWLRQVRIPDJQHWLFWULSSLQJDQGKHDWWULSSLQJWRSUHYHQWVKRUWFLUFXLWDQGRYHUORDG 7KHPLQLPXPGLVWDQFHEHWZHHQWKHXQLWDQGFRPEXVWLYHVXUIDFHLVP 7KHDSSOLDQFHVKDOOEHLQVWDOOHGLQDFFRUGDQFHZLWKQDWLRQDOZLULQJUHJXODWLRQV $QDOOSROHGLVFRQQHFWLRQVZLWFKZLWKDFRQWDFWVHSDUDWLRQRIDWOHDVWPPLQDOOSROHVVKRXOGEHFRQQHFWHGLQ¿[HGZLULQJ 1RWH Ɣ0DNHVXUHWKHOLYHZLUHQHXWUDOZLUHDQGHDUWKZLUHLQWKHIDPLO\SRZHUVRFNHWDUHSURSHUO\FRQQHFWHG Ɣ7KHUHVKRXOGEHUHOLDEOHFLUFXLWLQWKHGLDJUDP,QDGHTXDWHRULQFRUUHFWHOHFWULFDOFRQQHFWLRQVPD\FDXVHHOHFWULFVKRFNRU¿UH (DUWKLQJ5HTXLUHPHQWV $LUFRQGLWLRQHULVW\SH,HOHFWULFDSSOLDQFH3OHDVHHQVXUHWKDWWKHXQLWLVUHOLDEO\HDUWKHG 7KH\HOORZJUHHQZLUHLQDLUFRQGLWLRQHULVWKHHDUWKLQJZLUHZKLFKFDQQRWEHXVHGIRURWKHUSXUSRVHV,PSURSHUHDUWKLQJPD\ FDXVHHOHFWULFVKRFN 7KHHDUWKUHVLVWDQFHVKRXOGDFFRUGWRWKHQDWLRQDOFULWHULRQ 7KHSRZHUPXVWKDYHUHOLDEOHHDUWKLQJWHUPLQDO3OHDVHGRQRWFRQQHFWWKHHDUWKLQJZLUHZLWKWKHIROORZLQJ ķ :DWHUSLSHĸ *DVSLSHĹ &RQWDPLQDWLRQSLSHĺ 2WKHUSODFHWKDWSURIHVVLRQDOSHUVRQQHOFRQVLGHULVXQUHOLDEOH 7KHPRGHODQGUDWHGYDOXHVRIIXVHVVKRXOGDFFRUGZLWKWKHVLONSULQWRQIXVHFRYHURUUHODWHG3&% ,QVWDOODWLRQ0DQXDO ,QVWDOODWLRQ'LPHQVLRQ'LDJUDP Space to the ceiling 15cm Above Space to the wall 15cm Above 15cm Above Space to the wall 250 cm Above 300cm Above Air outlet side Space to the floor The dimensions of the space necessary for correct installation of the appliance including the minimum permissible distances to adjacent structures Space to the obstruction 50cm Above ● Air inlet side e ov cm 30cm Above Ab 30 Space to the wall Space to the wall 50cm Above e ov cm Ab 0 20 Air outlet side ,QVWDOODWLRQ0DQXDO ,QVWDOO,QGRRU8QLW ,QVWDOODWLRQRI0RXQWLQJ3ODWH 0RXQWLQJSODWHVKRXOGEHLQVWDOOHGKRUL]RQWDOO\$VWKHZDWHUWUD\ VRXWOHWIRUWKHLQGRRUXQLWLVWZRZD\W\SHGXULQJLQVWDOODWLRQ WKHLQGRRUXQLWVKRXOGVOLJKWO\VODQWWRZDWHUWUD\ VRXWOHWIRUVPRRWKGUDLQDJHRIFRQGHQVDWH )L[WKHPRXQWLQJSODWHRQWKHZDOOZLWKVFUHZV:KHUHLVSUHFRYHUHGZLWKSODVWLFJUDQXOD %HVXUHWKDWWKHPRXQWLQJSODWHKDVEHHQ¿[HG¿UPO\HQRXJKWRZLWKVWDQGDERXWNJ0HDQZKLOHWKHZHLJKWVKRXOGEHHYHQO\ VKDUHGE\HDFKVFUHZ Wall Space to the wall 150mm above Mark on the middle of it Gradienter Wall Space to the wall 150mm above Right Left Ф 55mm Ф 55mm (Rear piping hole) (Rear piping hole) 'ULOO3LSLQJ+ROH Outdoor Indoor Wall pipe 6ODQWWKHSLSLQJKROHĭRQWKHZDOOVOLJKWO\GRZQZDUGWRWKHRXWGRRUVLGH Seal pad ,QVHUWWKHSLSLQJKROHVOHHYHLQWRWKHKROHWRSUHYHQWWKHFRQQHFWLRQSLSLQJDQG ZLULQJIURPEHLQJGDPDJHGZKHQSDVVLQJWKURXJKWKHKROH Φ55 ,QVWDOODWLRQRI'UDLQ+RVH &RQQHFWWKHGUDLQKRVHWRWKHRXWOHWSLSHRIWKHLQGRRUXQLW%LQGWKHMRLQWZLWK UXEEHUEHOW 3XWWKHGUDLQKRVHLQWRLQVXODWLQJWXEH :UDSWKHLQVXODWLQJWXEHZLWKZLGHUXEEHUEHOWWRSUHYHQWWKHVKLIWRILQVXODWLQJWXEH outlet pipe of indoor unit drain hose outlet pipe of indoor unit rubber belt outlet pipe of indoor unit 6ODQWWKHGUDLQKRVHGRZQZDUGVOLJKWO\IRUVPRRWKGUDLQDJHRIFRQGHQVDWH drain hose rubber belt insulating tube rubber belt outlet pipe of indoor unit 1RWH7KHLQVXODWLQJWXEHVKRXOGEHFRQQHFWHGUHOLDEO\ZLWKWKHVOHHYHRXWVLGHWKHRXWOHW SLSH7KHGUDLQKRVHVKRXOGEHVODQWHGGRZQZDUGVOLJKWO\ZLWKRXWGLVWRUWLRQEXOJHRU ÀXFWXDWLRQ'RQRWSXWWKHRXWOHWLQWKHZDWHU connected insulating tube bulge distortion Flooded &RQQHFWLQJ,QGRRUDQG2XWGRRU(OHFWULF:LUHV 2SHQWKHIURQWSDQHO Wiring Cover 5HPRYHWKHZLULQJFRYHU&RQQHFWDQG¿[SRZHUFRQQHFWLRQFRUGDQGVLJQDOFRQWUROZLUH WRWKHWHUPLQDOERDUG$VVKRZQLQ)LJ BU BK 0DNHWKHSRZHUFRQQHFWLRQFRUGDQGVLJQDOFRQWUROZLUHWKURXJKWKHKROHDWWKHEDFNRI OG YE-GN Outdoor unit connection LQGRRUXQLW GWH09NB-K3NNE2A/I 5HLQVWDOOWKHFRUGDQGZLULQJFRYHU 5HLQVWDOOWKHIURQWSDQHO VT N(1) Fig.2 BU BK VT OG YE-GN Outdoor unit connection ,QVWDOODWLRQ0DQXDO 127( $OOZLUHVEHWZHHQLQGRRUDQGRXWGRRUXQLWVPXVWEHFRQQHFWHGE\WKHTXDOL¿HGHOHFWULFFRQWUDFWRU Ɣ(OHFWULFZLUHVPXVWEHFRQQHFWHGFRUUHFWO\,PSURSHUFRQQHFWLRQPD\FDXVHPDOIXQFWLRQ Ɣ7LJKWHQWKHWHUPLQDOVFUHZVVHFXUHO\ Ɣ$IWHUWLJKWHQLQJWKHVFUHZVSXOOWKHZLUHVOLJKWO\WRFRQ¿UPZKHWKHULWLV¿UPRUQRW Ɣ0DNHVXUHWKDWWKHHOHFWULFFRQQHFWLRQVDUHHDUWKHGSURSHUO\WRSUHYHQWHOHFWULFVKRFN Ɣ0DNHVXUHWKDWDOOZLULQJFRQQHFWLRQVDUHVHFXUHDQGWKHFRYHUSODWHVDUHUHLQVWDOOHGSURSHUO\3RRULQVWDOODWLRQPD\FDXVH ¿UHRUHOHFWULFVKRFN ,QVWDOODWLRQRI,QGRRU8QLW Ɣ7KHSLSLQJFDQEHRXWSXWIURPULJKWULJKWUHDUOHIWRUOHIWUHDU Gas side pipe :KHQURXWLQJWKHSLSLQJDQGZLULQJIURPWKHOHIWRUULJKWVLGHRILQGRRUXQLWFXWRII WKHWDLOLQJVIURPWKHFKDVVLVZKHQQHFHVVDU\$VVKRZQLQ)LJ External connection electric wire Liquid side piping Tailing 2 side piping Tailing 1 Gas insulation &XWRIIWDLOLQJZKHQURXWLQJWKHZLULQJRQO\ Fig.3 Liquid side Piping insulation Finally wrap it Water drainage pipe with tape &XWRIIWDLOLQJDQGWDLOLQJZKHQURXWLQJERWKWKHZLULQJDQGSLSLQJ 7DNHRXWWKHSLSLQJIURPERG\FDVHZUDSWKHSLSLQJSRZHUFRUGVGUDLQKRVHZLWK WKHWDSHDQGWKHQPDNHWKHPSDVVWKURXJKWKHSLSLQJKROH$VVKRZQLQ)LJ Left +DQJWKHPRXQWLQJVORWVRIWKHLQGRRUXQLWRQWKHXSSHUKRRNVRIWKHPRXQWLQJ Left rear Right Fig.4 Right rear SODWHDQGFKHFNLILWLV¿UPHQRXJK$VVKRZQLQ)LJ Fixing hook 7KHLQVWDOODWLRQVLWHVKRXOGEHFPRUPRUHDERYHWKHÀRRU Mounting plate Mounting plate ,QVWDOODWLRQRI&RQQHFWLRQ3LSH Fig.5 $OLJQWKHFHQWHURIWKHSLSHÀDUHZLWKWKHUHODWHGYDOYH 6FUHZLQWKHÀDUHQXWE\KDQGDQGWKHQWLJKWHQWKHQXWZLWKVSDQQHUDQGWRUTXH ZUHQFKE\UHIHUULQJWRWKHIROORZLQJ (N·m) 15 20 31 35 50 55 60 65 70 75 Hex nut diameter Tightening torque Ф6 Ф 9.52 Ф 12 Ф 16 Ф 19 Indoor unit piping Taper nut Piping Spanner Torque wrench 127(&RQQHFWWKHFRQQHFWLRQSLSHWRLQGRRUXQLWDW¿UVWDQGWKHQWRRXWGRRUXQLW +DQGOHSLSLQJEHQGLQJZLWKFDUH'RQRWGDPDJHWKHFRQQHFWLRQSLSH(QVXUHWKDWWKH MRLQWQXWLVWLJKWHQHG¿UPO\RWKHUZLVHLWPD\FDXVHOHDNDJH ,QVWDOO2XWGRRU8QLW (OHFWULF:LULQJ Handle 5HPRYHWKHKDQGOHRQWKHULJKWVLGHSODWHRIRXWGRRUXQLW 7DNHRIIZLUHFRUGDQFKRUDJH&RQQHFWDQG¿[SRZHUFRQQHFWLRQFRUGDQG VLJQDOFRQWUROZLUHWRWKHWHUPLQDOERDUG:LULQJVKRXOG¿WWKDWRILQGRRUXQLW )L[WKHSRZHUFRQQHFWLRQFRUGDQGVLJQDOFRQWUROZLUHZLWKZLUHFODPSVDQG WKHQFRQQHFWWKHFRUUHVSRQGLQJFRQQHFWRU &RQ¿UPLIWKHZLUHKDVEHHQ¿[HGSURSHUO\ 5HLQVWDOOWKHKDQGOH N(1) 2 4 5 blue black violet orange yellowgreen Indoor unit connection 127( Ɣ,QFRUUHFWZLULQJPD\FDXVHPDOIXQFWLRQRIVSDUHSDUW Ɣ$IWHUWKHZLUHKDVEHHQ¿[HGHQVXUHWKHUHLVIUHHVSDFHEHWZHHQWKHFRQQHFWLRQDQG¿[LQJSODFHVRQWKHOHDGZLUH 6FKHPDWLFGLDJUDPEHLQJUHIHUHQFHRQO\SOHDVHUHIHUWRUHDOSURGXFWIRUDXWKHQWLFLQIRUPDWLRQ ,QVWDOODWLRQ0DQXDO $LU3XUJLQJDQG/HDNDJH7HVW &RQQHFWFKDUJLQJKRVHRIPDQLIROGYDOYHWRFKDUJHHQGRIORZSUHVVXUHYDOYH ERWKKLJKORZSUHVVXUHYDOYHVPXVWEHWLJKWO\VKXW Manifold Valve &RQQHFWMRLQWRIFKDUJLQJKRVHWRYDFXXPSXPS Multimeter -76cmHg )XOO\RSHQWKHKDQGOHRI/RPDQLIROGYDOYH 2SHQWKHYDFXXPSXPSIRUYDFXXPL]DWLRQ$WWKHEHJLQQLQJVOLJKWO\ORRVHQ MRLQWQXWRIORZSUHVVXUHYDOYHWRFKHFNLIWKHUHLVDLUFRPLQJLQVLGH,IQRLVHRI Manometer Hi handle Lo Handle YDFXXPSXPSKDVEHHQFKDQJHGWKHUHDGLQJRIPXOWLPHWHULV7KHQWLJKWHQ WKHQXW Charging hose .HHSYDFXXPLQJIRUPRUHWKDQPLQVDQGPDNHVXUHWKHUHDGLQJRIPXOWL PHWHULV; SDFP+J Low pressure valve )XOO\RSHQKLJKORZSUHVVXUHYDOYHV 5HPRYHFKDUJLQJKRVHIURPFKDUJLQJHQGRIORZSUHVVXUHYDOYH 7LJKWHQOLGRIORZSUHVVXUHYDOYH$VVKRZQLQ)LJ Vacuum pump Fig.6 2XWGRRU&RQGHQVDWH'UDLQDJHRQO\IRUKHDWSXPSXQLW 'XULQJKHDWLQJRSHUDWLRQWKHFRQGHQVDWHDQGGHIURVWLQJZDWHUVKRXOGEHGUDLQHGRXW UHOLDEO\WKURXJKWKHGUDLQKRVH,QVWDOOWKHRXWGRRUGUDLQFRQQHFWRULQDĭKROHRQWKH EDVHSODWHDQGDWWDFKWKHGUDLQKRVHWRWKHFRQQHFWRUVRWKDWWKHZDVWHZDWHUIRUPHG LQWKHRXWGRRUXQLWFDQEHGUDLQHGRXW7KHKROHGLDPHWHUPXVWEHSOXJJHG:KHWKHU Drain-water hole Bottom frame WRSOXJRWKHUKROHVZLOOEHGHWHUPLQHGE\WKHGHDOHUVDFFRUGLQJWRDFWXDOFRQGLWLRQV &KHFNDIWHU,QVWDOODWLRQDQG7HVW2SHUDWLRQ Drain connecter Hose (available commercially, inner dia. 16mm) &KHFNDIWHU,QVWDOODWLRQ Items to be checked Possible malfunction Has it been fixed firmly? The unit may drop, shake or emit noise. Have you done the refrigerant leakage test? It may cause insufficient cooling(heating) capacity Is heat insulation sufficient? It may cause condensation and dripping. Is water drainage satisfactory? It may cause condensation and dripping. Is the voltage in accordance with the rated voltage marked on the nameplate? Is the electric wiring and piping connection installed correctly and securely? Has the unit been connected to a secure earth connection? It may cause electric malfunction or damage the product. It may cause electric malfunction or damage the part. It may cause electrical leakage. Is the power cord specified? It may cause electric malfunction or damage the part. Are the inlet and outlet openings blocked? It may cause insufficient cooling(heating) capacity. Is the length of connection pipes and refrigerant capacity been recorded? The refrigerant capacity is not accurate. ,QVWDOODWLRQ0DQXDO 2SHUDWLRQ7HVW %HIRUH2SHUDWLRQ7HVW 'RQRWVZLWFKRQSRZHUEHIRUHLQVWDOODWLRQLV¿QLVKHGFRPSOHWHO\ (OHFWULFZLULQJPXVWEHFRQQHFWHGFRUUHFWO\DQGVHFXUHO\ &XWRIIYDOYHVRIWKHFRQQHFWLRQSLSHVVKRXOGEHRSHQHG $OOWKHLPSXULWLHVVXFKDVVFUDSVDQGWKUXPVPXVWEHFOHDUHGIURPWKHXQLW 2SHUDWLRQ7HVW0HWKRG 6ZLWFKRQSRZHUSUHVV³212))´EXWWRQRQWKHZLUHOHVVUHPRWHFRQWUROWRVWDUWWKHRSHUDWLRQ 3UHVV02'(EXWWRQWRVHOHFWWKH&22/+($7)$1WRFKHFNZKHWKHUWKHRSHUDWLRQLVQRUPDORUQRW ,QVWDOODWLRQDQG0DLQWHQDQFHRI+HDOWK\)LOWHU ,QVWDOODWLRQRI+HDOWK\)LOWHU /LIWXSWKHIURQWSDQHOIURPLWVWZRHQGVDVVKRZQE\WKHDUURZGLUHFWLRQDQGWKHQ UHPRYHWKHDLU¿OWHU$VVKRZQLQ)LJD $WWDFKWKHKHDOWK\¿OWHURQWRWKHDLU¿OWHU$VVKRZQLQ)LJE ,QVWDOOWKHDLU¿OWHUSURSHUO\DORQJWKHDUURZGLUHFWLRQLQ)LJFDQGWKHQFORVHWKH SDQHO Fig. a Fig. b Air filter Healthy filter &OHDQLQJDQG0DLQWHQDQFH Fig. c 5HPRYHWKHKHDOWK\¿OWHUDQGUHLQVWDOOLWDIWHUFOHDQLQJDFFRUGLQJWRWKHLQVWDOODWLRQLQVWUXFWLRQ'RQRWXVHEUXVKRUKDUG REMHFWVWRFOHDQWKH¿OWHU$IWHUFOHDQLQJEHVXUHWRGU\LWLQWKHVKDGH 6HUYLFH/LIH 7KHJHQHUDOVHUYLFHOLIHIRUWKHKHDOWK\¿OWHULVDERXWRQH\HDUXQGHUQRUPDOFRQGLWLRQ$VIRUVLOYHULRQ¿OWHULWLVLQHIIHFWLYH ZKHQLWVVXUIDFHEHFRPHVEODFNJUHHQ 7KLVVXSSOHPHQWDU\LQVWUXFWLRQLVSURYLGHGIRUUHIHUHQFHWRWKHXQLWZLWKKHDOWK\¿OWHU,IWKHJUDSKLFVSURYLGHGKHUHLQDUH GLIIHUHQWIURPWKHDFWXDOSURGXFWSOHDVHUHIHUWRWKHDFWXDOSURGXFW7KHTXDQWLW\RIKHDOWK\¿OWHUVLVEDVHGRQWKHDFWXDO GHOLYHU\ ([SORGHG9LHZVDQG3DUWV/LVW ([SORGHG9LHZVDQG3DUWV/LVW ,QGRRU8QLW 0RGHOV*:+1$.11$$,&ROG3ODVPD*:+1$.11$$,&ROG3ODVPD *:+1%.11$$,&ROG3ODVPD ([SORGHG9LHZVDQG3DUWV/LVW 3DUW&RGH 12 'HVFULSWLRQ *:+1$.11$$, *:+1$.11$$, &ROG3ODVPD &$1 &ROG3ODVPD &$1 3URGXFW&RGH )URQW3DQHO$VV\ )LOWHU6XE$VV\ 6FUHZ&RYHU (OHFWULF%R[&RYHU )URQW&DVH $[LOH%XVK *XLGH/RXYHU $LU/RXYHU $LU/RXYHU +HOLFRLG7RQJXH $[LOH%XVK 5HDU&DVHDVV\ &URVV)ORZ)DQ )DQ%HDULQJ 2*DVNHWVXEDVV\RI%HDULQJ 2*DVNHWRI&URVV)DQ%HDULQJ 5LQJRI%HDULQJ 5HPRWH&RQWUROOHU 'UDLQDJH+RVH :DOO0RXQWLQJ)UDPH (YDSRUDWRU$VV\ &ROG3ODVPD*HQHUDWRU6XEDVV\ &RQQHFWLQJ&DEOH &RQQHFWLQJ&DEOH 3RZHU&RUG (YDSRUDWRU6XE$VV\ 5HFHLYHU:LQGRZ 7XEH6HQVRU $PELHQW7HPSHUDWXUH6HQVRU 0DLQ%RDUG 7HUPLQDO%RDUG (OHFWULF%R[ (OHFWULF%R[$VV\ 'LVSOD\%RDUG &UDQN 6WHS0RWRU 5XEEHU3OXJ:DWHU7UD\ 0RWRU3UHVV3ODWH )DQ0RWRU 3LSH&ODPS )XVH -XPSHU &DSDFLWRU&%% 6KLHOG%R[(OHFWULF%R[ (OHFWULF%R[&RYHU 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH 4W\ ([SORGHG9LHZVDQG3DUWV/LVW 12 'HVFULSWLRQ 3DUW&RGH *:+1%.11$$,&ROG3ODVPD 4W\ 3URGXFW&RGH &$1 )URQW3DQHO$VV\ )LOWHU6XE$VV\ 6FUHZ&RYHU (OHFWULF%R[&RYHU )URQW&DVH $[LOH%XVK *XLGH/RXYHU $LU/RXYHU $LU/RXYHU +HOLFRLG7RQJXH $[LOH%XVK 5HDU&DVHDVV\ &URVV)ORZ)DQ )DQ%HDULQJ 2*DVNHWVXEDVV\RI%HDULQJ 2*DVNHWRI&URVV)DQ%HDULQJ 5LQJRI%HDULQJ 5HPRWH&RQWUROOHU 'UDLQDJH+RVH :DOO0RXQWLQJ)UDPH (YDSRUDWRU$VV\ &ROG3ODVPD*HQHUDWRU6XEDVV\ &RQQHFWLQJ&DEOH &RQQHFWLQJ&DEOH 3RZHU&RUG (YDSRUDWRU6XE$VV\ 5HFHLYHU:LQGRZ 7XEH6HQVRU $PELHQW7HPSHUDWXUH6HQVRU 0DLQ%RDUG 7HUPLQDO%RDUG (OHFWULF%R[ (OHFWULF%R[$VV\ 'LVSOD\%RDUG &UDQN 6WHS0RWRU 5XEEHU3OXJ:DWHU7UD\ 0RWRU3UHVV3ODWH )DQ0RWRU 3LSH&ODPS )XVH -XPSHU &DSDFLWRU&%% 6KLHOG%R[(OHFWULF%R[ (OHFWULF%R[&RYHU 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH ([SORGHG9LHZVDQG3DUWV/LVW 0RGHOV*:+1$.11'$,*:+1$.11$$, 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 37 1 36 35 34 33 32 31 30 29 28 27 25 26 42 41 40 GWH07NA-K3NND2A/I GWH07NA-K3NNA8A/I 39 38 ([SORGHG9LHZVDQG3DUWV/LVW 12 'HVFULSWLRQ 3URGXFW&RGH 3DUW&RGH *:+1$.11$$, *:+1$.11'$, &$1 &$1 4W\ )URQW3DQHO$VV\ )LOWHU6XE$VV\ 6FUHZ&RYHU (OHFWULF%R[&RYHU )URQW&DVH $[LOH%XVK *XLGH/RXYHU $LU/RXYHU $LU/RXYHU +HOLFRLG7RQJXH $[LOH%XVK 5HDU&DVHDVV\ &URVV)ORZ)DQ )DQ%HDULQJ 2*DVNHWVXEDVV\RI%HDULQJ 2*DVNHWRI&URVV)DQ%HDULQJ 5LQJRI%HDULQJ 5HPRWH&RQWUROOHU 'UDLQDJH+RVH :DOO0RXQWLQJ)UDPH (YDSRUDWRU$VV\ &RQQHFWLQJ&DEOH &RQQHFWLQJ&DEOH 3RZHU&RUG 'LVSOD\%RDUG $PELHQW7HPSHUDWXUH6HQVRU 7HPSHUDWXUH6HQVRU 0DLQ%RDUG 7HUPLQDO%RDUG (OHFWULF%R[ (OHFWULF%R[$VV\ &UDQN 6WHS0RWRU 5XEEHU3OXJ:DWHU7UD\ 0RWRU3UHVV3ODWH )DQ0RWRU 3LSH&ODPS )XVH -XPSHU &DSDFLWRU&%% 6KLHOG%R[(OHFWULF%R[ (OHFWULF%R[&RYHU 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH ([SORGHG9LHZVDQG3DUWV/LVW 0RGHOV*:+1$.11$$,0HPEUDQD'HFRUDWLYH6WULS *:+1$.11$$,*:+1$.11$&, ([SORGHG9LHZVDQG3DUWV/LVW 12 'HVFULSWLRQ 3URGXFW&RGH )URQW3DQHO$VV\ 3DUW&RGH *:+1$.11$$, 0HPEUDQD'HFRUDWLYH6WULS &$1 4W\ )LOWHU6XE$VV\ 6FUHZ&RYHU )URQW&DVH $[LOH%XVK *XLGH/RXYHU $LU/RXYHU +HOLFRLGWRQJXH 'LVSOD\%RDUG $[LOH%XVK 5HDU&DVHDVV\ &URVV)ORZ)DQ )DQ%HDULQJ 2*DVNHWRI&URVV)DQ%HDULQJ 2*DVNHWVXEDVV\RI%HDULQJ 5LQJRI%HDULQJ 5HPRWH&RQWUROOHU 'UDLQDJHKRVH &RQQHFWLQJ&DEOH (YDSRUDWRU$VV\ &RQQHFWLQJ&DEOH 3RZHU&RUG 5HFHLYHU:LQGRZ )XVH (OHFWULF%R[&RYHU -XPSHU 7XEH6HQVRU $PELHQW7HPSHUDWXUH6HQVRU 0DLQ%RDUG 7HUPLQDO%RDUG $LU/RXYHU (OHFWULF%R[ &DSDFLWRU&%% (OHFWULF%R[$VV\ &UDQN 6WHS0RWRU 5XEEHU3OXJ:DWHU7UD\ )DQ0RWRU 0RWRU3UHVV3ODWH 3LSH&ODPS :DOO0RXQWLQJ)UDPH 6KLHOGER[HOHFWULFER[ (OHFWULF%R[&RYHU 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH ([SORGHG9LHZVDQG3DUWV/LVW 12 'HVFULSWLRQ 3DUW&RGH *:+1$.11$$, *:+1$.11$&, &$1 &$1 3URGXFW&RGH )URQW3DQHO$VV\ )LOWHU6XE$VV\ 6FUHZ&RYHU )URQW&DVH $[LOH%XVK *XLGH/RXYHU $LU/RXYHU +HOLFRLGWRQJXH 'LVSOD\%RDUG $[LOH%XVK 5HDU&DVHDVV\ &URVV)ORZ)DQ )DQ%HDULQJ 2*DVNHWRI&URVV)DQ%HDULQJ 2*DVNHWVXEDVV\RI%HDULQJ 5LQJRI%HDULQJ 5HPRWH&RQWUROOHU 'UDLQDJHKRVH &RQQHFWLQJ&DEOH (YDSRUDWRU$VV\ &RQQHFWLQJ&DEOH 3RZHU&RUG 5HFHLYHU:LQGRZ )XVH (OHFWULF%R[&RYHU -XPSHU 7XEH6HQVRU $PELHQW7HPSHUDWXUH6HQVRU 0DLQ%RDUG 7HUPLQDO%RDUG $LU/RXYHU (OHFWULF%R[ &DSDFLWRU&%% (OHFWULF%R[$VV\ &UDQN 6WHS0RWRU 5XEEHU3OXJ:DWHU7UD\ )DQ0RWRU 0RWRU3UHVV3ODWH 3LSH&ODPS :DOO0RXQWLQJ)UDPH 6KLHOGER[HOHFWULFER[ (OHFWULF%R[&RYHU 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH 4W\ ([SORGHG9LHZVDQG3DUWV/LVW 0RGHO*:+1%.11($, 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 24 25 3 26 2 27 28 30 29 31 32 35 39 38 37 34 33 36 40 41 1 ([SORGHG9LHZVDQG3DUWV/LVW 12 'HVFULSWLRQ 3URGXFW&RGH *:+1%.11($, 4W\ &$1 )URQW3DQHO$VV\ 'LVSOD\%RDUG )LOWHU6XE$VV\ (OHFWULF%R[&RYHU 6FUHZ&RYHU )URQW&DVH $[LOH%XVK *XLGH/RXYHU $LU/RXYHU $LU/RXYHU +HOLFRLG7RQJXH $[LOH%XVK 5HDU&DVHDVV\ &URVV)ORZ)DQ 2*DVNHWVXEDVV\RI%HDULQJ 5LQJRI%HDULQJ 'UDLQDJH+RVH :DOO0RXQWLQJ)UDPH (YDSRUDWRU$VV\ (YDSRUDWRU6XSSRUW &RQQHFWLQJ&DEOH &RQQHFWLQJ&DEOH 3RZHU&RUG 3LSH&ODPS )DQ0RWRU 0RWRU3UHVV3ODWH 5XEEHU3OXJ:DWHU7UD\ 6WHS0RWRU &UDQN (OHFWULF%R[$VV\ +LJK)UHTXHQF\7UDQVIRUPHU (OHFWULF%R[ 7HUPLQDO%RDUG 6KLHOG&RYHURI(OHFWULF%R[6XEDVV\ (OHFWULF%R[&RYHU &DSDFLWRU&%% -XPSHU $PELHQW7HPSHUDWXUH6HQVRU 0DLQ%RDUG 7HPSHUDWXUH6HQVRU 5HPRWH&RQWUROOHU 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH 3DUW&RGH ([SORGHG9LHZVDQG3DUWV/LVW 0RGHOV*:+1%.11$$,0HPEUDQD'HFRUDWLYH6WULS *:+1%.11$$, ([SORGHG9LHZVDQG3DUWV/LVW 12 'HVFULSWLRQ *:+1%.11$$,0HPEUDQD'HFRUDWLYH6WULS 4W\ 3URGXFW&RGH )URQW3DQHO$VV\ &$1 )URQWSDQHO% 6 )LOWHU6XE$VV\ 6FUHZ&RYHU (OHFWULF%R[&RYHU )URQW&DVH $[LOH%XVK *XLGH/RXYHU $LU/RXYHU $LU/RXYHU +HOLFRLGWRQJXH $[LOH%XVK 5HDU&DVHDVV\ &URVV)ORZ)DQ )DQ%HDULQJ 2*DVNHWVXEDVV\RI%HDULQJ 2*DVNHWRI&URVV)DQ%HDULQJ 5LQJRI%HDULQJ 5HPRWH&RQWUROOHU 'UDLQDJHKRVH :DOO0RXQWLQJ)UDPH (YDSRUDWRU$VV\ (YDSRUDWRU6XSSRUW &RQQHFWLQJ&DEOH &RQQHFWLQJ&DEOH 3RZHU&RUG 7XEH6HQVRU $PELHQW7HPSHUDWXUH6HQVRU 0DLQ%RDUG 7HUPLQDO%RDUG (OHFWULF%R[ 7UDQVIRUPHU (OHFWULF%R[$VV\ 'LVSOD\%RDUG &UDQN 6WHS0RWRU 5XEEHU3OXJ:DWHU7UD\ 0RWRU3UHVV3ODWH )DQ0RWRU 3LSH&ODPS -XPSHU &DSDFLWRU&%% 6KLHOGFRYHURI(OHFWULF%R[VXEDVV\ 6KLHOGFRYHURI(OHFWULF%R[ (OHFWULF%R[&RYHU 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH 3DUW&RGH ([SORGHG9LHZVDQG3DUWV/LVW 12 'HVFULSWLRQ 3DUW&RGH *:+1%.11$$, 4W\ 3URGXFW&RGH &$1 )URQW3DQHO$VV\ )URQWSDQHO% 6 )LOWHU6XE$VV\ 6FUHZ&RYHU (OHFWULF%R[&RYHU )URQW&DVH $[LOH%XVK *XLGH/RXYHU $LU/RXYHU $LU/RXYHU +HOLFRLGWRQJXH $[LOH%XVK 5HDU&DVHDVV\ &URVV)ORZ)DQ )DQ%HDULQJ 2*DVNHWVXEDVV\RI%HDULQJ 2*DVNHWRI&URVV)DQ%HDULQJ 5LQJRI%HDULQJ 5HPRWH&RQWUROOHU 'UDLQDJHKRVH :DOO0RXQWLQJ)UDPH (YDSRUDWRU$VV\ (YDSRUDWRU6XSSRUW &RQQHFWLQJ&DEOH &RQQHFWLQJ&DEOH 3RZHU&RUG 7XEH6HQVRU $PELHQW7HPSHUDWXUH6HQVRU 0DLQ%RDUG 7HUPLQDO%RDUG (OHFWULF%R[ 7UDQVIRUPHU (OHFWULF%R[$VV\ 'LVSOD\%RDUG &UDQN 6WHS0RWRU 5XEEHU3OXJ:DWHU7UD\ 0RWRU3UHVV3ODWH )DQ0RWRU 3LSH&ODPS -XPSHU &DSDFLWRU&%% 6KLHOGFRYHURI(OHFWULF%R[VXEDVV\ 6KLHOGFRYHURI(OHFWULF%R[ (OHFWULF%R[&RYHU 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH ([SORGHG9LHZVDQG3DUWV/LVW 0RGHO*:+1%.11&&, ([SORGHG9LHZVDQG3DUWV/LVW 12 'HVFULSWLRQ 3URGXFW&RGH )URQW3DQHO$VV\ )URQW3DQHO 3DUW&RGH *:+1%.11&&, 4W\ &$1 )LOWHU6XE$VV\ 6FUHZ&RYHU (OHFWULF%R[&RYHU )URQW&DVH $[LOH%XVK *XLGH/RXYHU $LU/RXYHU $LU/RXYHU +HOLFRLGWRQJXH $[LOH%XVK 5HDU&DVHDVV\ &URVV)ORZ)DQ )DQ%HDULQJ 2*DVNHWRI&URVV)DQ%HDULQJ 2*DVNHWVXEDVV\RI%HDULQJ 5LQJRI%HDULQJ 5HPRWH&RQWUROOHU 'UDLQDJHKRVH :DOO0RXQWLQJ)UDPH (YDSRUDWRU$VV\ &RQQHFWLQJ&DEOH (YDSRUDWRU6XSSRUW &RQQHFWLQJ&DEOH 3RZHU&RUG 'HFRUDWLYH%RDUG 6 7XEH6HQVRU $PELHQW7HPSHUDWXUH6HQVRU 0DLQ%RDUG 7HUPLQDO%RDUG (OHFWULF%R[ 7UDQVIRUPHU (OHFWULF%R[$VV\ 'LVSOD\%RDUG &UDQN 6WHS0RWRU 5XEEHU3OXJ:DWHU7UD\ 0RWRU3UHVV3ODWH )DQ0RWRU 3LSH&ODPS -XPSHU &DSDFLWRU&%% 6KLHOGFRYHURI(OHFWULF%R[VXEDVV\ 6KLHOGFRYHURI(OHFWULF%R[ (OHFWULF%R[&RYHU 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH ([SORGHG9LHZVDQG3DUWV/LVW 0RGHOV*:+1$.11%$,&ROG3ODVPD*:+1$.11%$,&ROG3ODVPD *:+1$.11%&,&ROG3ODVPD 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 44 8 43 7 42 6 5 41 4 40 3 39 2 38 1 37 36 35 34 33 32 31 30 29 28 27 26 25 46 24 45 ([SORGHG9LHZVDQG3DUWV/LVW 12 'HVFULSWLRQ 3DUW&RGH *:+1$.11%$, *:+1$.11%$, *:+1$.11%&, 3URGXFW&RGH &ROG3ODVPD &$1 &ROG3ODVPD &$1 &ROG3ODVPD &$1 )URQW3DQHO$VV\ )URQW3DQHO )LOWHU6XE$VV\ 6FUHZ&RYHU )URQW&DVH $[LOH%XVK *XLGH/RXYHU $LU/RXYHU +HOLFRLG7RQJXH $[LOH%XVK 5HDU&DVHDVV\ &URVV)ORZ)DQ )DQ%HDULQJ 2*DVNHWRI&URVV)DQ%HDULQJ 2*DVNHWVXEDVV\RI%HDULQJ 5LQJRI%HDULQJ 5HPRWH&RQWUROOHU 'UDLQDJH+RVH (YDSRUDWRU$VV\ &RQQHFWLQJ&DEOH &RQQHFWLQJ&DEOH 3RZHU&RUG &ROG3ODVPD*HQHUDWRU6XEDVV\ 'HFRUDWH3LHFH 'LVSOD\%RDUG 'LVSOD\&RYHU )XVH -XPSHU (OHFWULF%R[&RYHU $PELHQW7HPSHUDWXUH6HQVRU 7HPSHUDWXUH6HQVRU 0DLQ%RDUG 7HUPLQDO%RDUG (OHFWULF%R[ &DSDFLWRU&%% (OHFWULF%R[$VV\ $LU/RXYHU 6WHS0RWRU &UDQN 5XEEHU3OXJ:DWHU7UD\ )DQ0RWRU 0RWRU3UHVV3ODWH 3LSH&ODPS :DOO0RXQWLQJ)UDPH 6KLHOG%R[(OHFWULF%R[ (OHFWULF%R[&RYHU 3 3 3 3 6 4W\ 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH ([SORGHG9LHZVDQG3DUWV/LVW 2XWGRRU8QLW 0RGHOV*:+1$.11%$2*:+1%.11($2 21 20 19 18 22 23 17 24 16 25 15 14 13 1 2 3 4 5 6 7 8 9 10 11 12 ([SORGHG9LHZVDQG3DUWV/LVW 12 'HVFULSWLRQ 3URGXFWFRGH 3DUW&RGH *:+1$.11%$2 &$: *:+1%.11($2 &$: 4W\ )URQW*ULOO )URQW3DQHO 3 3 )DQ0RWRU &KDVVLV6XEDVV\ 3 3 'UDLQDJH&RQQHFWHU &RPSUHVVRUDQG¿WWLQJV 0DJQHW&RLO ZD\9DOYH$VV\ &DSLOODU\6XE$VV\ 5LJKW6LGH3ODWH6XE$VV\ 9DOYH 9DOYH %LJ+DQGOH 9DOYH6XSSRUW 7HUPLQDO%RDUG &DSDFLWRU&%% &DSDFLWRU&%% (OHFWULF%R[$VV\ 5HDUJULOO &RQGHQVHU$VV\ 7RS&RYHU3ODWH 3 0RWRU6XSSRUW6XE$VV\ &ODSERDUG6XE$VV\ $[LDO)ORZ)DQ 6PDOO+DQGOH 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH ([SORGHG9LHZVDQG3DUWV/LVW 0RGHOV*:+1$.11%$2*:+1%.11%$2 21 20 19 18 22 23 17 24 16 25 15 26 14 13 12 11 1 2 3 4 5 6 7 8 9 10 ([SORGHG9LHZVDQG3DUWV/LVW 12 'HVFULSWLRQ 3URGXFW&RGH 3DUW&RGH *:+1$.11%$2 *:+1%.11%$2 &$: &$: 4W\ )URQW*ULOO )URQW3DQHO 3 3 &KDVVLV6XEDVV\ 3 3 &RPSUHVVRUDQG¿WWLQJV 0DJQHW&RLO ZD\9DOYH$VV\ &DSLOODU\6XE$VV\ 9DOYH 9DOYH %LJ+DQGOH 9DOYH6XSSRUW 3 3 5LJKW6LGH3ODWH6XE$VV\ (OHFWULF%R[$VV\ &DSDFLWRUFODPSVXE 7HUPLQDO%RDUG 7HUPLQDO%RDUG &DSDFLWRU&%% &DSDFLWRU&%% 5HDUJULOO &RQGHQVHU$VV\ 7RS&RYHU6XE$VV\ &ODSERDUG6XE$VV\ 0RWRU6XSSRUW )DQ0RWRU 6PDOO+DQGOH $[LDO)ORZ)DQ 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH ([SORGHG9LHZVDQG3DUWV/LVW 0RGHOV*:+1$.11%$2*:+1$.11%&2*:+1%.11%&2 ([SORGHG9LHZVDQG3DUWV/LVW 12 'HVFULSWLRQ 3URGXFW&RGH 3DUW&RGH *:+1$.11%$2 *:+1$.11%&2 *:+1%.11%&2 4W\ &$: &$: &$: )URQW3DQHO 3 3 3 &KDVVLV6XEDVV\ 3 3 3 'UDLQDJH&RQQHFWHU &RPSUHVVRUDQG¿WWLQJV 0DJQHW&RLO ZD\9DOYH$VV\ ZD\9DOYH )URQWJULOO 6WUDLQHU$ &DSLOODU\6XE$VV\ 9DOYH 9DOYH %LJ+DQGOH 9DOYH6XSSRUW 3 3 3 5LJKW6LGH3ODWH6XE$VV\ (OHFWULF%R[$VV\ 7HUPLQDO%RDUG 7HUPLQDO%RDUG &DSDFLWRU&%% &DSDFLWRU&%% 5HDUJULOO &RQGHQVHU$VV\ 7RS&RYHU6XE$VV\ &ODSERDUG6XE$VV\ 0RWRU6XSSRUW )DQ0RWRU 6PDOO+DQGOH $[LDO)ORZ)DQ 7KHGDWDDERYHDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH 7URXEOHVKRRWLQJ 7URXEOHVKRRWLQJ 7URXEOHVKRRWLQJ %HFDXWLRXVGXULQJLQVWDOODWLRQDQGPDLQWHQDQFH'RRSHUDWLRQIROORZLQJWKHUHJXODWLRQVWRDYRLGHOHFWULFVKRFNDQGFDVXDOW\ RUHYHQGHDWKGXHWRGURSIURPKLJKDWWLWXGH 6WDWLFPDLQWHQDQFHLVWKHPDLQWHQDQFHGXULQJGHHQHUJL]DWLRQRIWKHDLUFRQGLWLRQHU )RUVWDWLFPDLQWHQDQFHPDNHVXUHWKDWWKHXQLWLVGHHQHUJL]HGDQGWKHSOXJLVGLVFRQQHFWHG G\QDPLFPDLQWHQDQFHLVWKHPDLQWHQDQFHGXULQJHQHUJL]DWLRQRIWKHXQLW %HIRUHG\QDPLFPDLQWHQDQFHFKHFNWKHHOHFWULFLW\DQGHQVXUHWKDWWKHUHLVJURXQGZLUHRQWKHVLWH&KHFNLIWKHUHLVHOHFWULFLW\ RQWKHKRXVLQJDQGFRQQHFWLRQFRSSHUSLSHRIWKHDLUFRQGLWLRQHUZLWKYROWDJHWHVWHU$IWHUHQVXUHLQVXODWLRQSODFHDQGWKH VDIHW\WKHPDLQWHQDQFHFDQEHSHUIRUPHG 7DNHVXI¿FLHQWFDUHWRDYRLGGLUHFWO\WRXFKLQJDQ\RIWKHFLUFXLWSDUWVZLWKRXW¿UVWWXUQLQJRIIWKHSRZHU$WWLPHVVXFKDVZKHQ WKHFLUFXLWERDUGLVWREHUHSODFHGSODFHWKHFLUFXLWERDUGDVVHPEO\LQDYHUWLFDOSRVLWLRQ1RUPDOO\GLDJQRVHWURXEOHVDFFRUGLQJ WRWKHWURXEOHGLDJQRVLVSURFHGXUHDVGHVFULEHGEHORZ5HIHUWRWKHFKHFNSRLQWVLQVHUYLFLQJZULWWHQRQWKHZLULQJGLDJUDPV DWWDFKHGWRWKHLQGRRURXWGRRUXQLWV 12 7URXEOHVKRRWLQJSURFHGXUH &RQ¿UPDWLRQ -XGJHPHQWE\)ODVKLQJ/('RI,QGRRU2XWGRRU8QLW +RZWR&KHFNVLPSO\WKHPDLQSDUW &RQ¿UPDWLRQ &RQ¿UPDWLRQRI3RZHU6XSSO\ &RQ¿UPWKDWWKHSRZHUEUHDNHURSHUDWHV21QRUPDOO\ &RQ¿UPDWLRQRI3RZHU9ROWDJH &RQ¿UPWKDWSRZHUYROWDJHLV$&±±,ISRZHUYROWDJHLVQRWLQWKLVUDQJHWKHXQLWPD\QRWRSHUDWHQRUPDOO\ 7URXEOHVKRRWLQJ -XGJHPHQWE\)ODVKLQJ/('RI,QGRRU2XWGRRU8QLW No. Malfunction Name Error Code Display Method of Indoor Unit Indicator lamp(During blinking,ON for 0.5S and OFF for 0.5S) A/C Status Operation COOL HEAT Lamp Lamp. Lamp. The unit will stop operation as it reaches the temperature point.During cooling and drying OFF 3S operation, except indoor fan and blinks operates,other loads (such as once compressor,outdoor fan,4-way valve) stop operation; During heating operation, the complete unit stops operation. 1 Indoor ambient. temperature sensor is open/ short-circuited F1 2 Indoor evaporator temperature. sensor is open/ short-circuited F2 3 PG motor (indoor fan motor)does not operate H6 OFF 3S and blinks 11 times 4 Malfunction protection of jumper cap C5 OFF 3S and blinks 15 times 5 PG motor(indoor fan)circuit malfunction by zero cross detection U8 OFF 3S and blinks 17 times OFF 3S and blinks twice Possible Causes 1.The wiring terminal between indoor ambient temperature sensor and controller is loosened or poorly contacted; 2.There’s short circuit due to trip-over of the parts on controller; 3.Indoor ambient temperature sensor is damaged(Please check it by referring to the resistance table for temperature sensor) 4.Main board is broken 1.The wiring terminal between indoor The unit will stop operation evaporator temperature sensor and as it reaches the temperature. controller is loosened or poorly contacted; point.During cooling and drying 2.There’s short circuit due to the trip-over of. operation,except indoor fan the parts on controller; operates,other loads stop 3.Indoor evaporator temperature sensor is operation;During heating damaged (Please check it by referring to the operation,the complete unit resistance table for temperature sensor). stops operation 4.Main board is broken. 1.The feedback terminal of PG motor is not connected tightly. Indoor fan, outdoor fan, 2.The control terminal of PG motor is not compressor and electric heat connected tightly. tube stop operation 2 minutes 3.Fan blade rotates unsmoothly due to later,4-way valve stops; improper installation. horizontal louver stops at the 4.Motor is not installed properly and tightly. current position. 5.Motor is damaged. 6.Controller is damaged. 1.There’s not jumper cap on the controller. Operation of remote controller. 2.Jumper cap is not inserted properly and or control panel is available, but tightly. the unit won’t act. 3.Jumper cap is damaged. 4..Controller is damaged. Operation of remote controller or control panel is available,but the unit won’t act. 1.Controller is damaged. 7URXEOHVKRRWLQJ +RZWR&KHFN6LPSO\WKH0DLQ3DUW 0DOIXQFWLRQRIWHPSHUDWXUHVHQVRQ 0DOIXQFWLRQGLDJQRVLVÀRZFKDUW Start Is the wiring terminal between temperature sensor and the controller loosened or poorly contacted? yes Insert the temperature sensor tightly no no Is there short circuit due to trip over Malfunction is eliminated. yes of the parts Make the parts upright no no Is the temperature sensor normal according to the Resistance Table? Malfunction is eliminated. yes no Replace it with a temperature sensor of the same model yes no Malfunction is removed. Replace the controller with one of the same model yes End yes 7URXEOHVKRRWLQJ &0DOIXQFWLRQ Possible causes: 1. There is no jumper cap on the controller; 2. Jumper cap is not inserted properly and tightly; 3. Jumper cap is damaged; 4. Controller is damaged. See the chart below: C5 is displayed on the unit. Is there jumper cap on the controller? Yes No Install a matching jumper cap. Is the malfunction eliminated? No Is the jumper cap inserted incorrectly or improperly? No No Yes Re-insert the jumper cap Is the malfunction eliminated? Yes Replace the jumper cap Is the malfunction eliminated? Yes Yes No The mainboard is defined abnormal replace it End 7URXEOHVKRRWLQJ +0DOIXQFWLRQ Possible causes: 1. Fan motor is locked; 2. The.feedback.terminal of PG motor is not connected tightly; 3. The control terminal of PG motor is not connected tightly; 4. Motor is damaged; 5. Malfunction of the rotation speed detection circuit of the mainboard. See the chart below: “H6”is displayed on the unit. Stir the fan blade with a hand when the unit is DE ENERGIZED. Does the blade rotate unsmoothly? Yes Reinstall the motor and the blade to make it rotate smoothly. Is the malfunction eliminated? No No Is the feedback terminal of PG motor loose? Yes Insert the feedback terminal tightly . Is the malfunction eliminated? No No Is the control terminal of PG motor loose? Yes Insert the control terminal tightly. Is the malfunction eliminated? No No Re-energize to turn on the unit; measure within 1 min after the louvers are opened whether the output voltage on the control terminal of the PG motor is over 50V? No No Mainboard malfunction; Replace it. Yes Yes Yes Replace the fan motor. Is the malfunction eliminated? Yes End 7URXEOHVKRRWLQJ 80DOIXQFWLRQ 3RVVLEOHFDXVHV 7KHFRQWUROOHUGLDJQRVHVLQFRUUHFWO\GXHWRLQVWDQWHQHUJL]DWLRQDIWHUGHHQHUJL]HGZKLOHWKHFDSDFLWRUGLVFKDUJHVVORZO\ 0DOIXQFWLRQRIWKH]HURFURVVGHWHFWLRQFLUFXLWRIWKHPDLQERDUG 6HHWKHÀRZFKDUWEHORZ “ U8” is displayed on the unit. Re-energize 1 minute after deerergization Is “ U8” still displayed ? No The unit returns to normal . Conclusion: U8 is displayed due to instant energization after deenergization while the capacitor discharges slowly . Yes The zero - cross detection circuit of the mainboard is defined abnormal . Replace the mainboard. M alfunction is eliminated. 7URXEOHVKRRWLQJ Appendix 1: Resistance Table for Indoor and Outdoor Ambient Temperature Sensors (15K) Temp. ˄ć˅ ˄kΩ˅ Resistance Temp. ˄ć˅ Resistance˄kΩ˅ ˄ć˅ Temp. ˄kΩ˅ Resistance Temp. ˄ć˅ Resistance ˄kΩ˅ -19 138.1 20 18.75 59 3.848 98 1.071 -18 128.6 21 17.93 60 3.711 99 1.039 -17 121.6 22 17.14 61 3.579 100 1.009 -16 115 23 16.39 62 3.454 101 0.98 -15 108.7 24 15.68 63 3.333 102 0.952 -14 102.9 25 15 64 3.217 103 0.925 -13 97.4 26 14.36 65 3.105 104 0.898 -12 92.22 27 13.74 66 2.998 105 0.873 -11 87.35 28 13.16 67 2.896 106 0.848 -10 82.75 29 12.6 68 2.797 107 0.825 -9 78.43 30 12.07 69 2.702 108 0.802 -8 74.35 31 11.57 70 2.611 109 0.779 -7 70.5 32 11.09 71 2.523 110 0.758 -6 66.88 33 10.63 72 2.439 111 0.737 -5 63.46 34 10.2 73 2.358 112 0.717 -4 60.23 35 9.779 74 2.28 113 0.697 0.678 -3 57.18 36 9.382 75 2.206 114 -2 54.31 37 9.003 76 2.133 115 0.66 -1 51.59 38 8.642 77 2.064 116 0.642 0 49.02 39 8.297 78 1.997 117 0.625 1 46.6 40 7.967 79 1.933 118 0.608 2 44.31 41 7.653 80 1.871 119 0.592 3 42.14 42 7.352 81 1.811 120 0.577 4 40.09 43 7.065 82 1.754 121 0.561 5 38.15 44 6.791 83 1.699 122 0.547 6 36.32 45 6.529 84 1.645 123 0.532 7 34.58 46 6.278 85 1.594 124 0.519 8 32.94 47 6.038 86 1.544 125 0.505 9 31.38 48 5.809 87 1.497 126 0.492 10 29.9 49 5.589 88 1.451 127 0.48 11 28.51 50 5.379 89 1.408 128 0.467 12 27.18 51 5.197 90 1.363 129 0.456 13 25.92 52 4.986 91 1.322 130 0.444 14 24.73 53 4.802 92 1.282 131 0.433 15 23.6 54 4.625 93 1.244 132 0.422 16 22.53 55 4.456 94 1.207 133 0.412 17 21.51 56 4.294 95 1.171 134 0.401 18 20.54 57 4.139 96 1.136 135 0.391 19 19.63 58 3.99 97 1.103 136 0.382 7URXEOHVKRRWLQJ Temp.˄ć˅ -19 -18 -17 -16 -15 -14 -13 -12 -11 -10 -9 -8 -7 -6 -5 -4 -3 -2 -1 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 Resistance˄kΩ˅ 181.4 171.4 162.1 153.3 145 137.2 129.9 123 116.5 110.3 104.6 99.13 94 89.17 84.61 80.31 76.24 72.41 68.79 65.37 62.13 59.08 56.19 53.46 50.87 48.42 46.11 43.92 41.84 39.87 38.01 36.24 34.57 32.98 31.47 30.04 28.68 27.39 26.17 Appendix 2: Resistance Table for Indoor and Outdoor Tube Temperature Sensor (20K) Temp.˄ć˅ Resistance˄kΩ˅ Temp. ˄ć˅ Resistance˄kΩ˅ Temp.˄ć˅ 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 25.01 23.9 22.85 21.85 20.9 20 19.14 18.13 17.55 16.8 16.1 15.43 14.79 14.18 13.59 13.04 12.51 12 11.52 11.06 10.62 10.2 9.803 9.42 9.054 8.705 8.37 8.051 7.745 7.453 7.173 6.905 6.648 6.403 6.167 5.942 5.726 5.519 5.32 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 5.13 4.948 4.773 4.605 4.443 4.289 4.14 3.998 3.861 3.729 3.603 3.481 3.364 3.252 3.144 3.04 2.94 2.844 2.752 2.663 2.577 2.495 2.415 2.339 2.265 2.194 2.125 2.059 1.996 1.934 1.875 1.818 1.736 1.71 1.658 1.609 1.561 1.515 1.47 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 Resistance ˄kΩ˅ 1.427 1.386 1.346 1.307 1.269 1.233 1.198 1.164 1.131 1.099 1.069 1.039 1.01 0.983 0.956 0.93 0.904 0.88 0.856 0.833 0.811 0.77 0.769 0.746 0.729 0.71 0.692 0.674 0.658 0.64 0.623 0.607 0.592 0.577 0.563 0.549 0.535 0.521 0.509 7URXEOHVKRRWLQJ Temp.˄ć˅ -29 -28 -27 -26 -25 -24 -23 -22 -21 -20 -19 -18 -17 -16 -15 -14 -13 -12 -11 -10 -9 -8 -7 -6 -5 -4 -3 -2 -1 0 1 2 3 4 5 6 7 8 9 Appendix 3: Resistance Table for Outdoor Discharge Temperature Sensor (50K) Resistance Resistance˄kΩ˅ Temp.˄ć˅ ˄kΩ˅ Temp. ˄ć˅ Resistance˄kΩ˅ Temp.˄ć˅ 853.5 799.8 750 703.8 660.8 620.8 580.6 548.9 516.6 486.5 458.3 432 407.4 384.5 362.9 342.8 323.9 306.2 289.6 274 259.3 245.6 232.6 220.5 209 198.3 199.1 178.5 169.5 161 153 145.4 138.3 131.5 125.1 119.1 113.4 108 102.8 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 Note: The information above is for reference only. 98 93.42 89.07 84.95 81.05 77.35 73.83 70.5 67.34 64.33 61.48 58.77 56.19 53.74 51.41 49.19 47.08 45.07 43.16 41.34 39.61 37.96 36.38 34.88 33.45 32.09 30.79 29.54 28.36 27.23 26.15 25.11 24.13 23.19 22.29 21.43 20.6 19.81 19.06 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 18.34 17.65 16.99 16.36 15.75 15.17 14.62 14.09 13.58 13.09 12.62 12.17 11.74 11.32 10.93 10.54 10.18 9.827 9.489 9.165 8.854 8.555 8.268 7.991 7.726 7.47 7.224 6.998 6.761 6.542 6.331 6.129 5.933 5.746 5.565 5.39 5.222 5.06 4.904 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 Resistance˄kΩ˅ 4.754 4.609 4.469 4.334 4.204 4.079 3.958 3.841 3.728 3.619 3.514 3.413 3.315 3.22 3.129 3.04 2.955 2.872 2.792 2.715 2.64 2.568 2.498 2.431 2.365 2.302 2.241 2.182 2.124 2.069 2.015 1.963 1.912 1.863 1.816 1.77 1.725 1.682 1.64 5HPRYDO3URFHGXUH 5HPRYDO3URFHGXUH 5HPRYDO3URFHGXUHRI,QGRRU8QLW :DUQLQJ%HVXUHWRZDLWIRUDPLQLPXPRIPLQXWHVDIWHU 7DNH$SDQHOIRUH[DPSOH WXUQLQJRIIDOOSRZHUVXSSOLHVEHIRUHGLVDVVHPEO\ 1.Remove the filter 1 Open the front panel. panel 2 Loosen the clasp of the filter. clasp 3 Take out the filter. filter 2.Remove the horizontal louver 1 Remove the axile bush on the horizontal louver. axile bush 5HPRYDO3URFHGXUH 2 Pull the horizontal louver outward to remove it. horizontal louver 3. Remove the panel Push the rotor shaft on both sides of the panel to make it separate from the groove. rotor shaft Remove the panel. panel 4.Remove the electric box cover 1 Loosen the screws of the electric box cover. screw 5HPRYDO3URFHGXUH electric box cover 2 2 Remove the electric box cover. 5.Remove the front case 1 Open the screw cap on the front case. Remove the screws fixing the front case. screw clasps 2 Loosen the clasps of the front case. left front case 3 middle right Remove the front case. 5HPRYDO3URFHGXUH 6.Remove the vertical louver 1 Loosen the clasp connecting the vertical louver and bottom case subassembly. clasp 2 Remove the vertical louver. vertical louver 7.Remove the electric box heat exchanger thermistor 1 Disconnect the indoor tube temperature sensor. screw 2 Remove the screws of the electric box. screws 3 Remove the screws at the joint of the ground wire and evaporator. ground wire 5HPRYDO3URFHGXUH 4 Loosen the clasp at the joint of the electric box cover and the electric box. clasp fan motor signal wire 5 6 Disconnect the plug of the motor. Disconnect the plug of step motor. plug of step motor 7 Remove the 2 screws of the display. screws electric box 8 Remove the electric box. 5HPRYDO3URFHGXUH 8.Remove pipe clamp of connecting pipe pipe clamp auxiliary piping screws 1 Remove the screws of the pipe clamp of connecting pipe. pipe clamp 2 Remove pipe clamp of connecting pipe. 9.Remove the evaporator 1 Remove the screws at the joint of the evaporator and bottom case. screws auxiliary piping 2 Adjust the pipe slightly to separate the connecting pipe and the evaporator. 5HPRYDO3URFHGXUH heat 3 Remove the evaporator. exchanger 10.Remove motor and cross flow fan step motor 1 Remove the screw of the step motor and remove the step motor. motor clamp 2 Remove the screw of the motor clamp. Remove the press plate. 5HPRYDO3URFHGXUH cross flow blade motor 3 Remove the cross flow blade and motor. O-gasket sub-assy of bearing ring of bearing 4 Remove the rubber cushion of the bearing. cross flow blade 5 Remove the screws at the joint of the cross flow blade and the motor. Take down the motor. motor 5HPRYDO3URFHGXUH 5HPRYDO3URFHGXUHRI2XWGRRU8QLW :DUQLQJ%HVXUHWRZDLWIRUDPLQLPXPRIPLQXWHVDIWHU WXUQLQJRIIDOOSRZHUVXSSOLHVEHIRUHGLVDVVHPEO\ *:+1$.11%$2*:+1%.11($2 1. Remove big handle a Before disassembly. b Remove the screw fixing the big handle. Remove the big handle. handle 2. Remove top panel top panel Remove the 3 screws connecting the top panel with the front panel and the right side panel. Remove the top cover. 5HPRYDO3URFHGXUH 3.Remove front grille and front panel a Remove the 2 screws connecting the front grille with front panel. Remove front grille. front grille b Remove the 5 screws connecting the front panel with the chassis and the motor support. Remove the front panel. front panel 4. Remove right side panel Remove the 6 screws connecting the right side panel with the chassis, the valve support and the electric box. Remove the right side panel. right side panel 5HPRYDO3URFHGXUH 5. Remove axial flow blade and motor a Remove the nut on the blade. Remove the axial flow blade. axial flow blade motor support b Remove the tapping screws fixing the motor; disconnect the leading wire insert of the motor. Remove the motor. Remove the tapping screws fixing the motor support. Lift the motor support to remove it. motor 6. Remove electric box electric box Remove screws fixing the electric box subassembly. Loosen the wire bundle; unplug the wiring terminals and lift the electric box to remove it. 5HPRYDO3URFHGXUH 7. Remove isolation sheet Remove the 3 screws fixing the isolation sheet. Remove the isolation sheet. isolation sheet 8. Remove soundproof sponge Remove the soundproof sponge wrapping the compressor. soundproof sponge 9. Remove magnet moil Remove the screw fixing the magnet moil. Remove the coil. magnet moil 5HPRYDO3URFHGXUH 10. Remove compressor a Remove the 2 screws fixing the gas valve. Unsolder the welding joint connecting the gas valve and the air-return pipe. Remove the gas valve. (NOTE: when unsoldering, wrap the gas valve with a wet cloth completely to avoid damage to the valve caused by high temperature.) Remove the 2 screws fixing the liquid valve. Unsolder the welding joint connecting the liquid valve and the Y-type pipe. Remove the liquid valve. (NOTE: Discharge the refrigerant completely before unsoldering.) liquid valve gas valve 4-way valve b Unsolder welding joint connecting the capillary, the valve and the outlet pipe of condenser to remove the capillary. Do not block the capillary with welding slag during unsoldering. Unsolder the pipes connected to the compressor. Unsolder the welding joint connecting the 4-way valve to remove it. capillary c Remove the 3 foot nuts on the compressor. Remove the compressor. compressor 5HPRYDO3URFHGXUH :DUQLQJ%HVXUHWRZDLWIRUDPLQLPXPRIPLQXWHVDIWHU WXUQLQJRIIDOOSRZHUVXSSOLHVEHIRUHGLVDVVHPEO\ *:+1$.11%$2*:+1$.11%&2*:+1%.11%$2*:+1%.11%&2 1. Before disassembly 2. Remove big handle Remove the connection screw fixing the big handle and then remove the handle. big handle 3. Remove top panel top panel Remove connection screws connecting the top panel with the front panel and the right side plate, and then remove the top panel. 5HPRYDO3URFHGXUH 4. Remove front grille Remove connection screws between the front grille and the front panel. Then remove the front grille. front grille 5. Remove front panel Remove connection screws connecting the front panel with the chassis and the motor support, and then remove the front panel. front panel 6. Remove right side plate right side plate Remove connection screws connecting the right side plate with the chassis, the valve support and the electric box. Then remove the right side plate. 7. Remove axial flow blade Remove the nut on the blade and then remove the axial flow blade. axial flow blade 5HPRYDO3URFHGXUH 8. Remove motor and motor support motor support Remove the 4 tapping screws fixing the motor and disconnect the leading wire insert of the motor. Then remove the motor. Remove the 2 tapping screws fixing the motor support and lift the motor support to remove it. motor 9. Remove electric box electric box Remove screws fixing the electric box subassembly; loosen the wire bundle and unplug the wiring terminals. Then lift the electric box to remove it. 10. Remove isolation sheet Remove the 3 screws fixing the isolation sheet and then remove the isolation sheet. isolation sheet 11. Remove soundproof sponge Remove the soundproof sponge wrapping the compressor. soundproof sponge 5HPRYDO3URFHGXUH 12. Remove magnet coil magnet coil Remove the screw fixing the magnet coil and then remove the coil. 13. Remove valves and 4-way valve subassembly 4-way valve Unsolder welding joint connecting the capillary, the valve and the outlet pipe of condenser to remove the capillary. Do not block the capillary with welding slag during unsoldering. Remove the 2 screws fixing the gas valve and unsolder the welding point between the gas valve and the air-return pipe to remove the gas valve. (NOTE: Discharge the refrigerant completely before unsoldering; when unsoldering, wrap the gas valve with a wet cloth completely to avoid damage to the valve caused by high temperature). Remove the 2 screws fixing the liquid valve and unsolder the welding joint connecting the liquid valve to the Y-type pipe to remove the liquid valve. Unsolder the welding joint connecting the 4-way valve, the compressor and the condenser to remove the 4-way valve. 14. Remove compressor liquid valve gas valve foot nuts compressor Remove the foot nuts on the compressor and then remove the compressor. JF00300988 GREE ELECTRIC APPLIANCES, INC. OF ZHUHAI Add: West Jinji Rd, Qianshan, Zhuhai, Guangdong, China, 519070 Tel: (+86-756) 8522218 Fax: (+86-756) 8669426 E-mail: gree @gree. com. cn www .gree. com For continuous improvement in the products, Gree reserves the right to modidy the product specification and appearance in this manual without notice and without incurring any obligations.