Download Nexus 1262/1272 Meter User Manual V.1.18
Transcript
7KLVSDJHLQWHQWLRQDOO\OHIWEODQN Nexus® 1262/1272 Meter Installation and Operation Manual Version 1.18 Published by: Electro Industries/GaugeTech 1800 Shames Drive Westbury, NY 11590 All rights reserved. No part of this publication may be reproduced or transmitted in any form or by any means, electronic or mechanical, including photocopying, recording, or information storage or retrieval systems or any future forms of duplication, for any purpose other than the purchaser's use, without the expressed written permission of Electro Industries/GaugeTech. © 2014 Electro Industries/GaugeTech Nexus® and Shark® are registered trademarks of Electro Industries/GaugeTech. Communicator EXTTM is a trademark of Electro Industries/GaugeTech. Modbus® is a registered trademark of Schneider Electric, licensed to the Modbus Organization, Inc. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 i This page intentionally left blank. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 ii Customer Service and Support Customer support is available 9:00 am to 4:30 pm, Eastern Standard Time, Monday through Friday. Please have the model, serial number and a detailed problem description available. If the problem concerns a particular reading, please have all meter readings available. When returning any merchandise to EIG, a return materials authorization number is required. For customer or technical assistance, repair or calibration, phone 516-334-0870 or fax 516-338-4741. Product Warranty Electro Industries/GaugeTech warrants all products to be free from defects in material and workmanship for a period of four years from the date of shipment. During the warranty period, we will, at our option, either repair or replace any product that proves to be defective. To exercise this warranty, fax or call our customer-support department. You will receive prompt assistance and return instructions. Send the instrument, transportation prepaid, to EIG at 1800 Shames Drive, Westbury, NY 11590. Repairs will be made and the instrument will be returned. This warranty does not apply to defects resulting from unauthorized modification, misuse, or use for any reason other than electrical power monitoring. The Nexus® 1262/1272 meter is not a user-serviceable product. THIS WARRANTY IS IN LIEU OF ALL OTHER WARRANTIES, EXPRESSED OR IMPLIED, INCLUDING ANY IMPLIED WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. ELECTRO INDUSTRIES/ GAUGETECH SHALL NOT BE LIABLE FOR ANY INDIRECT, SPECIAL OR CONSEQUENTIAL DAMAGES ARISING FROM ANY AUTHORIZED OR UNAUTHORIZED USE OF ANY ELECTRO INDUSTRIES/GAUGETECH PRODUCT. LIABILITY SHALL BE LIMITED TO THE ORIGINAL COST OF THE PRODUCT SOLD. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 iii Use of Product for Protection Our products are not to be used for primary over-current protection. Any protection feature in our products is to be used for alarm or secondary protection only. Statement of Calibration Our instruments are inspected and tested in accordance with specifications published by Electro Industries/GaugeTech. The accuracy and a calibration of our instruments are traceable to the National Institute of Standards and Technology through equipment that is calibrated at planned intervals by comparison to certified standards.For optimal performance, EIG recommends that any meter, including those manufactured by EIG, be verified for accuracy on a yearly interval using NIST traceable accuracy standards. Disclaimer The information presented in this publication has been carefully checked for reliability; however, no responsibility is assumed for inaccuracies. The information contained in this document is subject to change without notice. Safety Symbols In this manual, this symbol indicates that the operator must refer to an important WARNING or CAUTION in the operating instructions. Please see Chapter 11 for important safety information regarding installation and hookup of the meter. Dans ce manuel, ce symbole indique que l'opérateur doit se référer à un important AVERTISSEMENT ou une MISE EN GARDE dans les instructions opérationnelles. Veuillez consulter le chapitre 11 pour des informations importantes relatives à l'installation et branchement du compteur. The following safety symbols may be used on the meter itself: Les symboles de sécurité suivante peuvent être utilisés sur le compteur même: This symbol alerts you to the presence of high voltage, which can cause dangerous electrical shock. Ce symbole vous indique la présence d’une haute tension qui peut provoquer une décharge électrique dangereuse. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 iv This symbol indicates the field wiring terminal that must be connected to earth ground before operating the meter, which protects against electrical shock in case of a fault condition. Ce symbole indique que la borne de pose des canalisations in-situ qui doit être branchée dans la mise à terre avant de faire fonctionner le compteur qui est protégé contre une décharge électrique ou un état défectueux. About Electro Industries/GaugeTech (EIG) Founded in 1975 by engineer and inventor Dr. Samuel Kagan, Electro Industries/ GaugeTech changed the face of power monitoring forever with its first breakthrough innovation: an affordable, easy-to-use AC power meter. More than thirty years since its founding, Electro Industries/GaugeTech, the leader in power monitoring and control, continues to revolutionize the industry with the highest quality, cutting edge power monitoring and control technology on the market today. An ISO 9001:2000 certified company, EIG sets the industry standard for advanced power quality and reporting, revenue metering and substation data acquisition and control. EIG products can be found on site at mainly all of today's leading manufacturers, industrial giants and utilities. EIG products are primarily designed, manufactured, tested and calibrated at our facility in Westbury, New York. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 v This page intentionally left blank. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 vi 7DEOHRI&RQWHQWV Table of Contents 1:Three-Phase Power Measurement 1-1 7KUHH3KDVH6\VWHP&RQILJXUDWLRQV :\H&RQQHFWLRQ 'HOWD&RQQHFWLRQ 3RZHU(QHUJ\DQG'HPDQG 5HDFWLYH(QHUJ\DQG3RZHU)DFWRU +DUPRQLF'LVWRUWLRQ 3RZHU4XDOLW\ 2: Meter Overview 2-1 7KH1H[XV0XOWLSDUDPHWHU5HYHQXH0HWHU $FFX0HDVXUH707HFKQRORJ\7KHRU\RI2SHUDWLRQ $GYDQFHG0HDVXUHPHQW)XQFWLRQDOLW\ $GYDQFHG5HYHQXH%LOOLQJ&DSDELOLW\ &RPPXQLFDWLRQVDQG,2&DSDELOLWLHV 'LVSOD\6FUHHQV $GGLWLRQDO6ZLWFKHV 1H[XV([WHUQDO,20RGXOHV 2SWLRQDO313131DQG31/('5HPRWH'LVSOD\V 1H[XV0HWHU)RUPV 1H[XV0HWHU$FFXUDF\ 1H[XV0HWHU6SHFLILFDWLRQV2YHUYLHZ 1H[XV0HWHU/RJJLQJ6SHFLILFDWLRQV 5 '139/HYHO 3: Operating Instructions 3-1 1DPHSODWH,QIRUPDWLRQ %DVLF2SHUDWLRQ /&''LVSOD\,QIRUPDWLRQ )LQGLQJ<RXU'LVSOD\¶V)LUPZDUH9HUVLRQV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 72& 7DEOHRI&RQWHQWV 1H[XV3URJUDPPDEOH'LVSOD\1DYLJDWLRQ0DS 8VLQJWKH'LVSOD\&RQILJXUDWRU 8VLQJWKH%DVH3URJUDPPDEOH'LVSOD\ 3UH3URJUDPPHG'LVSOD\6FUHHQV 4: Performing Meter Testing 4-1 7HVWLQJ7RROV 2 7HVW3XOVH/(' /&''LVSOD\ 3 7HVW0RGH (QWHULQJ7HVW0RGH 4 8VLQJ7HVW0RGH 4 7HVW0RGH3UHVHW$FFXPXODWRUV ([LWLQJ7HVW0RGH 5: Serial Communication Wiring 5-1 &RPPXQLFDWLRQ2YHUYLHZ &RPPXQLFDWLQJWRWKH0HWHUWKURXJKWKH$16,7\SH,,2SWLFDO3RUW 566HULDO&RPPXQLFDWLRQ 56:LULQJ)XQGDPHQWDOV3RUWDQG3RUW 8VLQJWKH8QLFRP 5-7HOHSKRQH/LQH&RQQHFWLRQ²0HWHUZLWK,13 ,QWHUQDO0RGHPZLWK'LDO,Q'LDO2XW2SWLRQ 5-&RQQHFWLRQ²0HWHUZLWK,13%DVH72SWLRQ 0RGHP(WKHUQHW&RQQHFWLRQ²0HWHUZLWK,13 &RPER&DUG2SWLRQ 56&RQQHFWLRQ0HWHUWRWKH 31313131/(''LVSOD\ &RPPXQLFDWLRQ3RUWVRQWKH,20RGXOHV 56&RQQHFWLRQ²0HWHUWR,20RGXOHV 6WHSVWR'HWHUPLQH3RZHU1HHGHG 5HPRWH&RPPXQLFDWLRQ2YHU7HOHSKRQH/LQHV 8VLQJWKH563RUW Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 72& 7DEOHRI&RQWHQWV 3URJUDPPLQJ0RGHPVIRU5HPRWH&RPPXQLFDWLRQ 6HOHFWHG0RGHP6WULQJV +LJK6SHHG,QSXWV&RQQHFWLRQ ,5,*%&RQQHFWLRQV 7LPH6\QFKURQL]DWLRQ$OWHUQDWLYHV ,13,QWHUQDO0RGHPZLWK'LDO,Q'LDO2XW2SWLRQ +DUGZDUH2YHUYLHZ +DUGZDUH&RQQHFWLRQ 'LDO,Q)XQFWLRQ 'LDO2XW)XQFWLRQ ,132QERDUG(WKHUQHW +DUGZDUH2YHUYLHZ +DUGZDUH&RQQHFWLRQ ,13(WKHUQHW0RGHP&RPELQDWLRQ +DUGZDUH2YHUYLHZ +DUGZDUH&RQQHFWLRQ )DFWRU\6HWWLQJV 6: Hardware Installation 6-1 0RXQWLQJWKH1H[XV6RFNHW0HWHU &DEOH&RORU.H\ ,QWHUQDO%DWWHU\,QVWDOODWLRQDQG0DLQWHQDQFH %DWWHU\6DIHW\DQG'LVSRVDO 0RXQWLQJWKH([WHUQDO'LVSOD\V 0RXQWLQJWKH1H[XV([WHUQDO,20RGXOHV 7: Time-of-Use Function 7-1 ,QWURGXFWLRQ 7KH1H[XV0HWHU¶V728&DOHQGDU 728)UR]HQDQG$FWLYH5HJLVWHUV 8SGDWLQJ5HWULHYLQJDQG5HSODFLQJ728&DOHQGDUV 'D\OLJKW6DYLQJVDQG'HPDQG Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 72& 7DEOHRI&RQWHQWV 8: Transformer Loss Compensation 8-1 ,QWURGXFWLRQ 1H[XV0HWHU V7UDQVIRUPHU/RVV&RPSHQVDWLRQ /RVV&RPSHQVDWLRQLQ7KUHH(OHPHQW,QVWDOODWLRQV 7KUHH(OHPHQW/RVV&RPSHQVDWLRQ:RUNVKHHW 9: Using the External Displays 9-1 2YHUYLHZ 1H[XV3131/('([WHUQDO'LVSOD\ '\QDPLF5HDGLQJV0RGH 1DYLJDWLRQ0DSRI'\QDPLF5HDGLQJV0RGH 1H[XV,QIRUPDWLRQ0RGH 1DYLJDWLRQ0DSRI1H[XV,QIRUPDWLRQ0RGH 'LVSOD\)HDWXUHV0RGH 1DYLJDWLRQ0DSRI'LVSOD\)HDWXUHV0RGH 2SWLRQDO31/('([WHUQDO5HPRWH'LVSOD\6SHFLILFDWLRQV 10: External I/O Modules 10-1 +DUGZDUH2YHUYLHZ 3RUW2YHUYLHZ ,20RGXOH,QVWDOODWLRQ 3RZHU6RXUFHIRU,20RGXOHV 8VLQJWKH36,2ZLWK0XOWLSOH,20RGXOHV 6WHSVIRU$WWDFKLQJ0XOWLSOH,20RGXOHV )DFWRU\6HWWLQJVDQG5HVHW%XWWRQ $QDORJ7UDQVGXFHU6LJQDO2XWSXW0RGXOHV 2YHUYLHZ 1RUPDO0RGH $QDORJ,QSXW0RGXOHV 2YHUYLHZ 1RUPDO0RGH 'LJLWDO'U\&RQWDFW5HOD\2XWSXW)RUP&0RGXOH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 72& 7DEOHRI&RQWHQWV 2YHUYLHZ &RPPXQLFDWLRQ 1RUPDO0RGH 'LJLWDO6ROLG6WDWH3XOVH2XWSXW.<=0RGXOH 2YHUYLHZ &RPPXQLFDWLRQ 1RUPDO0RGH 'LJLWDO6WDWXV,QSXW0RGXOH 2YHUYLHZ &RPPXQLFDWLRQ 1RUPDO0RGH 11: Electrical Installation 11-1 Considerations when Installing Meters 11-1 11.2: Blade Configuration for for Forms 9S, 36S, and 45S 11-5 11.3: :LULQJ'LDJUDPV 6 460HWHU0RXQWHGLQ6$$GDSWHr 124 12: Switchboard Meter 12-1 ,QWURGXFWLRQ /DEHOV 6SHFLILFDWLRQVDQG'LPHQVLRQV ,QVWDOODWLRQ :LULQJ'LDJUDPV 13: Meter Calculations 13-1 0HDVXUHPHQWVDQG&DOFXODWLRQV 'HPDQG,QWHJUDWRUV 14: EN50160/IEC61000-4-15 Flicker 14-1 2YHUYLHZ 7KHRU\RI2SHUDWLRQ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 72& 7DEOHRI&RQWHQWV $7UDQVIRUPHU/RVV&RPSHQVDWLRQ6SUHDGVKHHWDQG([DPSOHV$ $&DOFXODWLQJ9DOXHV$ $([FHO6SUHDGVKHHWZLWK([DPSOH1XPEHUV$ B: Blade Configuration for Forms 9S, 36S and 45S B-1 %)RUPV % %%ODGH&RQILJXUDWLRQ'UDZLQJV % Glossary GL-1 Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 72& 7KUHH3KDVH3RZHU0HDVXUHPHQW 1:Three-Phase Power Measurement 7KLVLQWURGXFWLRQWRWKUHHSKDVHSRZHUDQGSRZHUPHDVXUHPHQWLVLQWHQGHGWR SURYLGHRQO\DEULHIRYHUYLHZRIWKHVXEMHFW7KHSURIHVVLRQDOPHWHUHQJLQHHURUPHWHU WHFKQLFLDQVKRXOGUHIHUWRPRUHDGYDQFHGGRFXPHQWVVXFKDVWKH((,+DQGERRNIRU (OHFWULFLW\0HWHULQJDQGWKHDSSOLFDWLRQVWDQGDUGVIRUPRUHLQGHSWKDQGWHFKQLFDO FRYHUDJHRIWKHVXEMHFW 1.1: Three-Phase System Configurations 7KUHHSKDVHSRZHULVPRVWFRPPRQO\XVHGLQVLWXDWLRQVZKHUHODUJHDPRXQWVRI SRZHUZLOOEHXVHGEHFDXVHLWLVDPRUHHIIHFWLYHZD\WRWUDQVPLWWKHSRZHUDQG EHFDXVHLWSURYLGHVDVPRRWKHUGHOLYHU\RISRZHUWRWKHHQGORDG7KHUHDUHWZR FRPPRQO\XVHGFRQQHFWLRQVIRUWKUHHSKDVHSRZHUDZ\HFRQQHFWLRQRUDGHOWD FRQQHFWLRQ(DFKFRQQHFWLRQKDVVHYHUDOGLIIHUHQWPDQLIHVWDWLRQVLQDFWXDOXVH :KHQDWWHPSWLQJWRGHWHUPLQHWKHW\SHRIFRQQHFWLRQLQXVHLWLVDJRRGSUDFWLFHWR IROORZWKHFLUFXLWEDFNWRWKHWUDQVIRUPHUWKDWLVVHUYLQJWKHFLUFXLW,WLVRIWHQQRW SRVVLEOHWRFRQFOXVLYHO\GHWHUPLQHWKHFRUUHFWFLUFXLWFRQQHFWLRQVLPSO\E\FRXQWLQJ WKHZLUHVLQWKHVHUYLFHRUFKHFNLQJYROWDJHV&KHFNLQJWKHWUDQVIRUPHUFRQQHFWLRQ ZLOOSURYLGHFRQFOXVLYHHYLGHQFHRIWKHFLUFXLWFRQQHFWLRQDQGWKHUHODWLRQVKLSV EHWZHHQWKHSKDVHYROWDJHVDQGJURXQG 1.1.1: Wye Connection 7KHZ\HFRQQHFWLRQLVVRFDOOHGEHFDXVHZKHQ\RXORRNDWWKHSKDVHUHODWLRQVKLSVDQG WKHZLQGLQJUHODWLRQVKLSVEHWZHHQWKHSKDVHVLWORRNVOLNHD<)LJXUHGHSLFWVWKH ZLQGLQJUHODWLRQVKLSVIRUDZ\HFRQQHFWHGVHUYLFH,QDZ\HVHUYLFHWKHQHXWUDORU FHQWHUSRLQWRIWKHZ\HLVW\SLFDOO\JURXQGHG7KLVOHDGVWRFRPPRQYROWDJHVRI DQGZKHUHWKHILUVWQXPEHUUHSUHVHQWVWKHSKDVHWRSKDVHYROWDJHDQG WKHVHFRQGQXPEHUUHSUHVHQWVWKHSKDVHWRJURXQGYROWDJH Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7KUHH3KDVH3RZHU0HDVXUHPHQW VC Phase 2 N Phase 1 Phase 3 VB VA )LJXUH7KUHHSKDVH:\H:LQGLQJ 7KHWKUHHYROWDJHVDUHVHSDUDWHGE\RHOHFWULFDOO\8QGHUEDODQFHGORDGFRQGLWLRQV WKHFXUUHQWVDUHDOVRVHSDUDWHGE\R+RZHYHUXQEDODQFHGORDGVDQGRWKHU FRQGLWLRQVFDQFDXVHWKHFXUUHQWVWRGHSDUWIURPWKHLGHDORVHSDUDWLRQ7KUHH SKDVHYROWDJHVDQGFXUUHQWVDUHXVXDOO\UHSUHVHQWHGZLWKDSKDVRUGLDJUDP$SKDVRU GLDJUDPIRUWKHW\SLFDOFRQQHFWHGYROWDJHVDQGFXUUHQWVLVVKRZQLQ)LJXUH VC IC N IA VB IB VA )LJXUH3KDVRU'LDJUDP6KRZLQJ7KUHHSKDVH9ROWDJHVDQG&XUUHQWV Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7KUHH3KDVH3RZHU0HDVXUHPHQW 7KHSKDVRUGLDJUDPVKRZVWKHRDQJXODUVHSDUDWLRQEHWZHHQWKHSKDVHYROWDJHV 7KHSKDVHWRSKDVHYROWDJHLQDEDODQFHGWKUHHSKDVHZ\HV\VWHPLVWLPHVWKH SKDVHWRQHXWUDOYROWDJH7KHFHQWHUSRLQWRIWKHZ\HLVWLHGWRJHWKHUDQGLVW\SLFDOO\ JURXQGHG7DEOHVKRZVWKHFRPPRQYROWDJHVXVHGLQWKH8QLWHG6WDWHVIRUZ\H FRQQHFWHGV\VWHPV Phase to Ground Voltage Phase to Phase Voltage YROWV YROWV YROWV YROWV YROWV YROWV YROWV YROWV YROWV YROWV 7DEOH&RPPRQ3KDVH9ROWDJHVRQ:\H6HUYLFHV 8VXDOO\DZ\HFRQQHFWHGVHUYLFHZLOOKDYHIRXUZLUHVWKUHHZLUHVIRUWKHSKDVHVDQG RQHIRUWKHQHXWUDO7KHWKUHHSKDVHZLUHVFRQQHFWWRWKHWKUHHSKDVHVDVVKRZQLQ )LJXUH7KHQHXWUDOZLUHLVW\SLFDOO\WLHGWRWKHJURXQGRUFHQWHUSRLQWRIWKHZ\H ,QPDQ\LQGXVWULDODSSOLFDWLRQVWKHIDFLOLW\ZLOOEHIHGZLWKDIRXUZLUHZ\HVHUYLFHEXW RQO\WKUHHZLUHVZLOOEHUXQWRLQGLYLGXDOORDGV7KHORDGLVWKHQRIWHQUHIHUUHGWRDVD GHOWDFRQQHFWHGORDGEXWWKHVHUYLFHWRWKHIDFLOLW\LVVWLOODZ\HVHUYLFHLWFRQWDLQV IRXUZLUHVLI\RXWUDFHWKHFLUFXLWEDFNWRLWVVRXUFHXVXDOO\DWUDQVIRUPHU,QWKLV W\SHRIFRQQHFWLRQWKHSKDVHWRJURXQGYROWDJHZLOOEHWKHSKDVHWRJURXQGYROWDJH LQGLFDWHGLQ7DEOHHYHQWKRXJKDQHXWUDORUJURXQGZLUHLVQRWSK\VLFDOO\SUHVHQWDW WKHORDG7KHWUDQVIRUPHULVWKHEHVWSODFHWRGHWHUPLQHWKHFLUFXLWFRQQHFWLRQW\SH EHFDXVHWKLVLVDORFDWLRQZKHUHWKHYROWDJHUHIHUHQFHWRJURXQGFDQEHFRQFOXVLYHO\ LGHQWLILHG Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7KUHH3KDVH3RZHU0HDVXUHPHQW 1.1.2: Delta Connection 'HOWDFRQQHFWHGVHUYLFHVPD\EHIHGZLWKHLWKHUWKUHHZLUHVRUIRXUZLUHV,QDWKUHH SKDVHGHOWDVHUYLFHWKHORDGZLQGLQJVDUHFRQQHFWHGIURPSKDVHWRSKDVHUDWKHUWKDQ IURPSKDVHWRJURXQG)LJXUHVKRZVWKHSK\VLFDOORDGFRQQHFWLRQVIRUDGHOWD VHUYLFH VC Phase 3 VB Phase 2 Phase 1 VA )LJXUH7KUHHSKDVH'HOWD:LQGLQJ5HODWLRQVKLS ,QWKLVH[DPSOHRIDGHOWDVHUYLFHWKUHHZLUHVZLOOWUDQVPLWWKHSRZHUWRWKHORDG,QD WUXHGHOWDVHUYLFHWKHSKDVHWRJURXQGYROWDJHZLOOXVXDOO\QRWEHEDODQFHGEHFDXVH WKHJURXQGLVQRWDWWKHFHQWHURIWKHGHOWD )LJXUHVKRZVWKHSKDVRUUHODWLRQVKLSVEHWZHHQYROWDJHDQGFXUUHQWRQDWKUHH SKDVHGHOWDFLUFXLW ,QPDQ\GHOWDVHUYLFHVRQHFRUQHURIWKHGHOWDLVJURXQGHG7KLVPHDQVWKHSKDVHWR JURXQGYROWDJHZLOOEH]HURIRURQHSKDVHDQGZLOOEHIXOOSKDVHWRSKDVHYROWDJHIRU WKHRWKHUWZRSKDVHV7KLVLVGRQHIRUSURWHFWLYHSXUSRVHV Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7KUHH3KDVH3RZHU0HDVXUHPHQW VBC VCA IC IA IB VAB )LJXUH3KDVRU'LDJUDP7KUHH3KDVH9ROWDJHVDQG&XUUHQWV'HOWD&RQQHFWHG $QRWKHUFRPPRQGHOWDFRQQHFWLRQLVWKHIRXUZLUHJURXQGHGGHOWDXVHGIRUOLJKWLQJ ORDGV,QWKLVFRQQHFWLRQWKHFHQWHUSRLQWRIRQHZLQGLQJLVJURXQGHG2QD YROWIRXUZLUHJURXQGHGGHOWDVHUYLFHWKHSKDVHWRJURXQGYROWDJHZRXOGEH YROWVRQWZRSKDVHVDQGYROWVRQWKHWKLUGSKDVH)LJXUHVKRZVWKHSKDVRU GLDJUDPIRUWKHYROWDJHVLQDWKUHHSKDVHIRXUZLUHGHOWDV\VWHP VC VCA VBC N VA VAB VB )LJXUH3KDVRU'LDJUDP6KRZLQJ7KUHHSKDVH)RXU:LUH'HOWD&RQQHFWHG6\VWHP Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7KUHH3KDVH3RZHU0HDVXUHPHQW 1.1.3: Blondell’s Theorem and Three Phase Measurement ,QDQHQJLQHHUDQGPDWKHPDWLFLDQQDPHG$QGUH(%ORQGHOOVHWIRUWKWKHILUVW VFLHQWLILFEDVLVIRUSRO\SKDVHPHWHULQJ+LVWKHRUHPVWDWHV ,IHQHUJ\LVVXSSOLHGWRDQ\V\VWHPRIFRQGXFWRUVWKURXJK1ZLUHVWKHWRWDOSRZHULQ WKHV\VWHPLVJLYHQE\WKHDOJHEUDLFVXPRIWKHUHDGLQJVRI1ZDWWPHWHUVVRDUUDQJHG WKDWHDFKRIWKH1ZLUHVFRQWDLQVRQHFXUUHQWFRLOWKHFRUUHVSRQGLQJSRWHQWLDOFRLO EHLQJFRQQHFWHGEHWZHHQWKDWZLUHDQGVRPHFRPPRQSRLQW,IWKLVFRPPRQSRLQWLV RQRQHRIWKH1ZLUHVWKHPHDVXUHPHQWPD\EHPDGHE\WKHXVHRI1:DWWPHWHUV 7KHWKHRUHPPD\EHVWDWHGPRUHVLPSO\LQPRGHUQODQJXDJH ,QDV\VWHPRI1FRQGXFWRUV1PHWHUHOHPHQWVZLOOPHDVXUHWKHSRZHURUHQHUJ\ WDNHQSURYLGHGWKDWDOOWKHSRWHQWLDOFRLOVKDYHDFRPPRQWLHWRWKHFRQGXFWRULQ ZKLFKWKHUHLVQRFXUUHQWFRLO 7KUHHSKDVHSRZHUPHDVXUHPHQWLVDFFRPSOLVKHGE\PHDVXULQJWKHWKUHHLQGLYLGXDO SKDVHVDQGDGGLQJWKHPWRJHWKHUWRREWDLQWKHWRWDOWKUHHSKDVHYDOXH,QROGHUDQD ORJPHWHUVWKLVPHDVXUHPHQWZDVDFFRPSOLVKHGXVLQJXSWRWKUHHVHSDUDWHHOHPHQWV (DFKHOHPHQWFRPELQHGWKHVLQJOHSKDVHYROWDJHDQGFXUUHQWWRSURGXFHDWRUTXHRQ WKHPHWHUGLVN$OOWKUHHHOHPHQWVZHUHDUUDQJHGDURXQGWKHGLVNVRWKDWWKHGLVNZDV VXEMHFWHGWRWKHFRPELQHGWRUTXHRIWKHWKUHHHOHPHQWV$VDUHVXOWWKHGLVNZRXOG WXUQDWDKLJKHUVSHHGDQGUHJLVWHUSRZHUVXSSOLHGE\HDFKRIWKHWKUHHZLUHV $FFRUGLQJWR%ORQGHOO V7KHRUHPLWZDVSRVVLEOHWRUHGXFHWKHQXPEHURIHOHPHQWV XQGHUFHUWDLQFRQGLWLRQV)RUH[DPSOHDWKUHHSKDVHWKUHHZLUHGHOWDV\VWHPFRXOG EHFRUUHFWO\PHDVXUHGZLWKWZRHOHPHQWVWZRSRWHQWLDOFRLOVDQGWZRFXUUHQWFRLOVLI WKHSRWHQWLDOFRLOVZHUHFRQQHFWHGEHWZHHQWKHWKUHHSKDVHVZLWKRQHSKDVHLQ FRPPRQ ,QDWKUHHSKDVHIRXUZLUHZ\HV\VWHPLWLVQHFHVVDU\WRXVHWKUHHHOHPHQWV7KUHH YROWDJHFRLOVDUHFRQQHFWHGEHWZHHQWKHWKUHHSKDVHVDQGWKHFRPPRQQHXWUDOFRQ GXFWRU$FXUUHQWFRLOLVUHTXLUHGLQHDFKRIWKHWKUHHSKDVHV ,QPRGHUQGLJLWDOPHWHUV%ORQGHOO V7KHRUHPLVVWLOODSSOLHGWRREWDLQSURSHU PHWHULQJ7KHGLIIHUHQFHLQPRGHUQPHWHUVLVWKDWWKHGLJLWDOPHWHUPHDVXUHVHDFK SKDVHYROWDJHDQGFXUUHQWDQGFDOFXODWHVWKHVLQJOHSKDVHSRZHUIRUHDFKSKDVH7KH PHWHUWKHQVXPVWKHWKUHHSKDVHSRZHUVWRDVLQJOHWKUHHSKDVHUHDGLQJ Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7KUHH3KDVH3RZHU0HDVXUHPHQW 6RPHGLJLWDOPHWHUVFDOFXODWHWKHLQGLYLGXDOSKDVHSRZHUYDOXHVRQHSKDVHDWDWLPH 7KLVPHDQVWKHPHWHUVDPSOHVWKHYROWDJHDQGFXUUHQWRQRQHSKDVHDQGFDOFXODWHVD SRZHUYDOXH7KHQLWVDPSOHVWKHVHFRQGSKDVHDQGFDOFXODWHVWKHSRZHUIRUWKH VHFRQGSKDVH)LQDOO\LWVDPSOHVWKHWKLUGSKDVHDQGFDOFXODWHVWKDWSKDVHSRZHU $IWHUVDPSOLQJDOOWKUHHSKDVHVWKHPHWHUFRPELQHVWKHWKUHHUHDGLQJVWRFUHDWHWKH HTXLYDOHQWWKUHHSKDVHSRZHUYDOXH8VLQJPDWKHPDWLFDODYHUDJLQJWHFKQLTXHVWKLV PHWKRGFDQGHULYHDTXLWHDFFXUDWHPHDVXUHPHQWRIWKUHHSKDVHSRZHU 0RUHDGYDQFHGPHWHUVDFWXDOO\VDPSOHDOOWKUHHSKDVHVRIYROWDJHDQGFXUUHQW VLPXOWDQHRXVO\DQGFDOFXODWHWKHLQGLYLGXDOSKDVHDQGWKUHHSKDVHSRZHUYDOXHV7KH DGYDQWDJHRIVLPXOWDQHRXVVDPSOLQJLVWKHUHGXFWLRQRIHUURULQWURGXFHGGXHWRWKH GLIIHUHQFHLQWLPHZKHQWKHVDPSOHVZHUHWDNHQ C B Phase B Phase C Node "n" Phase A A N )LJXUH7KUHH3KDVH:\H/RDG,OOXVWUDWLQJ.LUFKKRII¶V/DZDQG%ORQGHOO¶V7KHRUHP %ORQGHOO V7KHRUHPLVDGHULYDWLRQWKDWUHVXOWVIURP.LUFKKRII V/DZ.LUFKKRII V/DZ VWDWHVWKDWWKHVXPRIWKHFXUUHQWVLQWRDQRGHLV]HUR$QRWKHUZD\RIVWDWLQJWKH VDPHWKLQJLVWKDWWKHFXUUHQWLQWRDQRGHFRQQHFWLRQSRLQWPXVWHTXDOWKHFXUUHQW RXWRIWKHQRGH7KHODZFDQEHDSSOLHGWRPHDVXULQJWKUHHSKDVHORDGV)LJXUH VKRZVDW\SLFDOFRQQHFWLRQRIDWKUHHSKDVHORDGDSSOLHGWRDWKUHHSKDVHIRXUZLUH VHUYLFH.irFKKRII V/DZKROGVWKDWWKHVXPRIFXUUHQWV$%&DQG1PXVWHTXDO]HUR RUWKDWWKHVXPRIFXUUHQWVLQWR1RGHQPXVWHTXDO]HUR ,IZHPHDVXUHWKHFXUUHQWVLQZLUHV$%DQG&ZHWKHQNQRZWKHFXUUHQWLQZLUH1E\ .LUFKKRII V/DZDQGLWLVQRWQHFHVVDU\WRPHDVXUHLW7KLVIDFWOHDGVXVWRWKH FRQFOXVLRQRI%ORQGHOO V7KHRUHPWKDWZHRQO\QHHGWRPHDVXUHWKHSRZHULQWKUHHRI Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7KUHH3KDVH3RZHU0HDVXUHPHQW WKHIRXUZLUHVLIWKH\DUHFRQQHFWHGE\DFRPPRQQRGH,QWKHFLUFXLWRI)LJXUHZH PXVWPHDVXUHWKHSRZHUIORZLQWKUHHZLUHV7KLVZLOOUHTXLUHWKUHHYROWDJHFRLOVDQG WKUHHFXUUHQWFRLOVDWKUHHHOHPHQWPHWHU6LPLODUILJXUHVDQGFRQFOXVLRQVFRXOGEH UHDFKHGIRURWKHUFLUFXLWFRQILJXUDWLRQVLQYROYLQJ'HOWDFRQQHFWHGORDGV 1.2: Power, Energy and Demand ,WLVTXLWHFRPPRQWRH[FKDQJHSRZHUHQHUJ\DQGGHPDQGZLWKRXWGLIIHUHQWLDWLQJ EHWZHHQWKHWKUHH%HFDXVHWKLVSUDFWLFHFDQOHDGWRFRQIXVLRQWKHGLIIHUHQFHV EHWZHHQWKHVHWKUHHPHDVXUHPHQWVZLOOEHGLVFXVVHG 3RZHULVDQLQVWDQWDQHRXVUHDGLQJ7KHSRZHUUHDGLQJSURYLGHGE\DPHWHULVWKH SUHVHQWIORZRIZDWWV3RZHULVPHDVXUHGLPPHGLDWHO\MXVWOLNHFXUUHQW,QPDQ\ GLJLWDOPHWHUVWKHSRZHUYDOXHLVDFWXDOO\PHDVXUHGDQGFDOFXODWHGRYHUDRQHVHFRQG LQWHUYDOEHFDXVHLWWDNHVVRPHDPRXQWRIWLPHWRFDOFXODWHWKH506YDOXHVRIYROWDJH DQGFXUUHQW%XWWKLVWLPHLQWHUYDOLVNHSWVPDOOWRSUHVHUYHWKHLQVWDQWDQHRXVQDWXUH RISRZHU (QHUJ\LVDOZD\VEDVHGRQVRPHWLPHLQFUHPHQWLWLVWKHLQWHJUDWLRQRISRZHURYHUD GHILQHGWLPHLQFUHPHQW(QHUJ\LVDQLPSRUWDQWYDOXHEHFDXVHDOPRVWDOOHOHFWULFELOOV DUHEDVHGLQSDUWRQWKHDPRXQWRIHQHUJ\XVHG 7\SLFDOO\HOHFWULFDOHQHUJ\LVPHDVXUHGLQXQLWVRINLORZDWWKRXUVN:K$NLORZDWW KRXUUHSUHVHQWVDFRQVWDQWORDGRIRQHWKRXVDQGZDWWVRQHNLORZDWWIRURQHKRXU 6WDWHGDQRWKHUZD\LIWKHSRZHUGHOLYHUHGLQVWDQWDQHRXVZDWWVLVPHDVXUHGDV ZDWWVDQGWKHORDGZDVVHUYHGIRUDRQHKRXUWLPHLQWHUYDOWKHQWKHORDGZRXOG KDYHDEVRUEHGRQHNLORZDWWKRXURIHQHUJ\$GLIIHUHQWORDGPD\KDYHDFRQVWDQW SRZHUUHTXLUHPHQWRIZDWWV,IWKHORDGZHUHVHUYHGIRURQHKRXULWZRXOG DEVRUEIRXUN:K,IWKHORDGZHUHVHUYHGIRUPLQXWHVLWZRXOGDEVRUEóRIWKDW WRWDORURQHN:K )LJXUHVKRZVDJUDSKRISRZHUDQGWKHUHVXOWLQJHQHUJ\WKDWZRXOGEHWUDQVPLWWHG DVDUHVXOWRIWKHLOOXVWUDWHGSRZHUYDOXHV)RUWKLVLOOXVWUDWLRQLWLVDVVXPHGWKDWWKH SRZHUOHYHOLVKHOGFRQVWDQWIRUHDFKPLQXWHZKHQDPHDVXUHPHQWLVWDNHQ(DFKEDU LQWKHJUDSKZLOOUHSUHVHQWWKHSRZHUORDGIRUWKHRQHPLQXWHLQFUHPHQWRIWLPH,Q UHDOOLIHWKHSRZHUYDOXHPRYHVDOPRVWFRQVWDQWO\ 7KHGDWDIURP)LJXUHLVUHSURGXFHGLQ7DEOHWRLOOXVWUDWHWKHFDOFXODWLRQRI HQHUJ\6LQFHWKHWLPHLQFUHPHQWRIWKHPHDVXUHPHQWLVRQHPLQXWHDQGVLQFHZH Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7KUHH3KDVH3RZHU0HDVXUHPHQW VSHFLILHGWKDWWKHORDGLVFRQVWDQWRYHUWKDWPLQXWHZHFDQFRQYHUWWKHSRZHUUHDGLQJ WRDQHTXLYDOHQWFRQVXPHGHQHUJ\UHDGLQJE\PXOWLSO\LQJWKHSRZHUUHDGLQJWLPHV FRQYHUWLQJWKHWLPHEDVHIURPPLQXWHVWRKRXUV 80 70 kilowat t s 60 50 40 30 20 10 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 Time (minutes) )LJXUH3RZHU8VHRYHU7LPH Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7KUHH3KDVH3RZHU0HDVXUHPHQW Time Interval (minute) Power (kW) Energy (kWh) Accumulated Energy (kWh) 7DEOH3RZHUDQG(QHUJ\5HODWLRQVKLSRYHU7LPH $VLQ7DEOHWKHDFFXPXODWHGHQHUJ\IRUWKHSRZHUORDGSURILOHRI)LJXUHLV N:K 'HPDQGLVDOVRDWLPHEDVHGYDOXH7KHGHPDQGLVWKHDYHUDJHUDWHRIHQHUJ\XVH RYHUWLPH7KHDFWXDOODEHOIRUGHPDQGLVNLORZDWWKRXUVKRXUEXWWKLVLVQRUPDOO\ UHGXFHGWRNLORZDWWV7KLVPDNHVLWHDV\WRFRQIXVHGHPDQGZLWKSRZHUEXWGHPDQG LVQRWDQLQVWDQWDQHRXVYDOXH7RFDOFXODWHGHPDQGLWLVQHFHVVDU\WRDFFXPXODWHWKH HQHUJ\UHDGLQJVDVLOOXVWUDWHGLQ)LJXUHDQGDGMXVWWKHHQHUJ\UHDGLQJWRDQ KRXUO\YDOXHWKDWFRQVWLWXWHVWKHGHPDQG ,QWKHH[DPSOHWKHDFFXPXODWHGHQHUJ\LVN:K%XWWKLVPHDVXUHPHQWZDV PDGHRYHUDPLQXWHLQWHUYDO7RFRQYHUWWKHUHDGLQJWRDGHPDQGYDOXHLWPXVWEH QRUPDOL]HGWRDPLQXWHLQWHUYDO,IWKHSDWWHUQZHUHUHSHDWHGIRUDQDGGLWLRQDO WKUHHPLQXWHLQWHUYDOVWKHWRWDOHQHUJ\ZRXOGEHIRXUWLPHVWKHPHDVXUHGYDOXHRU Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7KUHH3KDVH3RZHU0HDVXUHPHQW N:K7KHVDPHSURFHVVLVDSSOLHGWRFDOFXODWHWKHPLQXWHGHPDQGYDOXH 7KHGHPDQGYDOXHDVVRFLDWHGZLWKWKHH[DPSOHORDGLVN:KKURUN:G 1RWHWKDWWKHSHDNLQVWDQWDQHRXVYDOXHRISRZHULVN:VLJQLILFDQWO\PRUHWKDQWKH GHPDQGYDOXH )LJXUHVKRZVDQRWKHUH[DPSOHRIHQHUJ\DQGGHPDQG,QWKLVFDVHHDFKEDU UHSUHVHQWVWKHHQHUJ\FRQVXPHGLQDPLQXWHLQWHUYDO7KHHQHUJ\XVHLQHDFK LQWHUYDOW\SLFDOO\IDOOVEHWZHHQDQGN:K+RZHYHUGXULQJWZRLQWHUYDOVWKH HQHUJ\ULVHVVKDUSO\DQGSHDNVDWN:KLQLQWHUYDOQXPEHU7KLVSHDNRIXVDJH ZLOOUHVXOWLQVHWWLQJDKLJKGHPDQGUHDGLQJ)RUHDFKLQWHUYDOVKRZQWKHGHPDQG YDOXHZRXOGEHIRXUWLPHVWKHLQGLFDWHGHQHUJ\UHDGLQJ6RLQWHUYDOZRXOGKDYHDQ DVVRFLDWHGGHPDQGRIN:KKU,QWHUYDOZLOOKDYHDGHPDQGYDOXHRIN:K KU,QWKHGDWDVKRZQWKLVLVWKHSHDNGHPDQGYDOXHDQGZRXOGEHWKHQXPEHUWKDW ZRXOGVHWWKHGHPDQGFKDUJHRQWKHXWLOLW\ELOO 100 kilowat t-hours 80 60 40 20 0 1 2 3 4 5 6 Intervals (15 mins.) 7 8 )LJXUH(QHUJ\8VHDQG'HPDQG $VFDQEHVHHQIURPWKLVH[DPSOHLWLVLPSRUWDQWWRUHFRJQL]HWKHUHODWLRQVKLSV EHWZHHQSRZHUHQHUJ\DQGGHPDQGLQRUGHUWRFRQWUROORDGVHIIHFWLYHO\RUWRPRQLWRU XVHFRUUHFWO\ Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7KUHH3KDVH3RZHU0HDVXUHPHQW 1.3: Reactive Energy and Power Factor 7KHUHDOSRZHUDQGHQHUJ\PHDVXUHPHQWVGLVFXVVHGLQWKHSUHYLRXVVHFWLRQUHODWHWR WKHTXDQWLWLHVWKDWDUHPRVWXVHGLQHOHFWULFDOV\VWHPV%XWLWLVRIWHQQRWVXIILFLHQWWR RQO\PHDVXUHUHDOSRZHUDQGHQHUJ\5HDFWLYHSRZHULVDFULWLFDOFRPSRQHQWRIWKH WRWDOSRZHUSLFWXUHEHFDXVHDOPRVWDOOUHDOOLIHDSSOLFDWLRQVKDYHDQLPSDFWRQ UHDFWLYHSRZHU5HDFWLYHSRZHUDQGSRZHUIDFWRUFRQFHSWVUHODWHWRERWKORDGDQG JHQHUDWLRQDSSOLFDWLRQV+RZHYHUWKLVGLVFXVVLRQZLOOEHOLPLWHGWRDQDO\VLVRIUHDFWLYH SRZHUDQGSRZHUIDFWRUDVWKH\UHODWHWRORDGV7RVLPSOLI\WKHGLVFXVVLRQJHQHUDWLRQ ZLOOQRWEHFRQVLGHUHG 5HDOSRZHUDQGHQHUJ\LVWKHFRPSRQHQWRISRZHUWKDWLVWKHFRPELQDWLRQRIWKH YROWDJHDQGWKHYDOXHRIFRUUHVSRQGLQJFXUUHQWWKDWLVGLUHFWO\LQSKDVHZLWKWKH YROWDJH+RZHYHULQDFWXDOSUDFWLFHWKHWRWDOFXUUHQWLVDOPRVWQHYHULQSKDVHZLWKWKH YROWDJH6LQFHWKHFXUUHQWLVQRWLQSKDVHZLWKWKHYROWDJHLWLVQHFHVVDU\WRFRQVLGHU ERWKWKHLQSKDVHFRPSRQHQWDQGWKHFRPSRQHQWWKDWLVDWTXDGUDWXUHDQJXODUO\ URWDWHGRRUSHUSHQGLFXODUWRWKHYROWDJH)LJXUHVKRZVDVLQJOHSKDVHYROWDJH DQGFXUUHQWDQGEUHDNVWKHFXUUHQWLQWRLWVLQSKDVHDQGTXDGUDWXUHFRPSRQHQWV IR V 0 IX I )LJXUH9ROWDJHDQG&RPSOH[&XUUHQW 7KHYROWDJH9DQGWKHWRWDOFXUUHQW,FDQEHFRPELQHGWRFDOFXODWHWKHDSSDUHQW SRZHURU9$7KHYROWDJHDQGWKHLQSKDVHFXUUHQW,5DUHFRPELQHGWRSURGXFHWKH UHDOSRZHURUZDWWV7KHYROWDJHDQGWKHTXDGUDWXUHFXUUHQW,;DUHFRPELQHGWR FDOFXODWHWKHUHDFWLYHSRZHU 7KHTXDGUDWXUHFXUUHQWPD\EHODJJLQJWKHYROWDJHDVVKRZQLQ)LJXUHRULWPD\ OHDGWKHYROWDJH:KHQWKHTXDGUDWXUHFXUUHQWODJVWKHYROWDJHWKHORDGLVUHTXLULQJ ERWKUHDOSRZHUZDWWVDQGUHDFWLYHSRZHU9$5V:KHQWKHTXDGUDWXUHFXUUHQW Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7KUHH3KDVH3RZHU0HDVXUHPHQW OHDGVWKHYROWDJHWKHORDGLVUHTXLULQJUHDOSRZHUZDWWVEXWLVGHOLYHULQJUHDFWLYH SRZHU9$5VEDFNLQWRWKHV\VWHPWKDWLV9$5VDUHIORZLQJLQWKHRSSRVLWHGLUHFWLRQ RIWKHUHDOSRZHUIORZ 5HDFWLYHSRZHU9$5VLVUHTXLUHGLQDOOSRZHUV\VWHPV$Q\HTXLSPHQWWKDWXVHV PDJQHWL]DWLRQWRRSHUDWHUHTXLUHV9$5V8VXDOO\WKHPDJQLWXGHRI9$5VLVUHODWLYHO\ ORZFRPSDUHGWRWKHUHDOSRZHUTXDQWLWLHV8WLOLWLHVKDYHDQLQWHUHVWLQPDLQWDLQLQJ 9$5UHTXLUHPHQWVDWWKHFXVWRPHUWRDORZYDOXHLQRUGHUWRPD[LPL]HWKHUHWXUQRQ SODQWLQYHVWHGWRGHOLYHUHQHUJ\:KHQOLQHVDUHFDUU\LQJ9$5VWKH\FDQQRWFDUU\DV PDQ\ZDWWV6RNHHSLQJWKH9$5FRQWHQWORZDOORZVDOLQHWRFDUU\LWVIXOOFDSDFLW\RI ZDWWV,QRUGHUWRHQFRXUDJHFXVWRPHUVWRNHHS9$5UHTXLUHPHQWVORZVRPHXWLOLWLHV LPSRVHDSHQDOW\LIWKH9$5FRQWHQWRIWKHORDGULVHVDERYHDVSHFLILHGYDOXH $FRPPRQPHWKRGRIPHDVXULQJUHDFWLYHSRZHUUHTXLUHPHQWVLVSRZHUIDFWRU3RZHU IDFWRUFDQEHGHILQHGLQWZRGLIIHUHQWZD\V7KHPRUHFRPPRQPHWKRGRIFDOFXODWLQJ SRZHUIDFWRULVWKHUDWLRRIWKHUHDOSRZHUWRWKHDSSDUHQWSRZHU7KLVUHODWLRQVKLSLV H[SUHVVHGLQWKHIROORZLQJIRUPXOD 7RWDO3) UHDOSRZHUDSSDUHQWSRZHU ZDWWV9$ 7KLVIRUPXODFDOFXODWHVDSRZHUIDFWRUTXDQWLW\NQRZQDV7RWDO3RZHU)DFWRU,WLV FDOOHG7RWDO3)EHFDXVHLWLVEDVHGRQWKHUDWLRVRIWKHSRZHUGHOLYHUHG7KHGHOLYHUHG SRZHUTXDQWLWLHVZLOOLQFOXGHWKHLPSDFWVRIDQ\H[LVWLQJKDUPRQLFFRQWHQW,IWKHYROW DJHRUFXUUHQWLQFOXGHVKLJKOHYHOVRIKDUPRQLFGLVWRUWLRQWKHSRZHUYDOXHVZLOOEH DIIHFWHG%\FDOFXODWLQJSRZHUIDFWRUIURPWKHSRZHUYDOXHVWKHSRZHUIDFWRUZLOO LQFOXGHWKHLPSDFWRIKDUPRQLFGLVWRUWLRQ,QPDQ\FDVHVWKLVLVWKHSUHIHUUHGPHWKRG RIFDOFXODWLRQEHFDXVHWKHHQWLUHLPSDFWRIWKHDFWXDOYROWDJHDQGFXUUHQWDUH LQFOXGHG $VHFRQGW\SHRISRZHUIDFWRULV'LVSODFHPHQW3RZHU)DFWRU'LVSODFHPHQW3)LVEDVHG RQWKHDQJXODUUHODWLRQVKLSEHWZHHQWKHYROWDJHDQGFXUUHQW'LVSODFHPHQWSRZHUIDF WRUGRHVQRWFRQVLGHUWKHPDJQLWXGHVRIYROWDJHFXUUHQWRUSRZHU,WLVVROHO\EDVHG RQWKHSKDVHDQJOHGLIIHUHQFHV$VDUHVXOWLWGRHVQRWLQFOXGHWKHLPSDFWRIKDUPRQLF GLVWRUWLRQ'LVSODFHPHQWSRZHUIDFWRULVFDOFXODWHGXVLQJWKHIROORZLQJHTXDWLRQ 'LVSODFHPHQW 3) Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions 'RF# FRV T ( 7KUHH3KDVH3RZHU0HDVXUHPHQW ZKHUHTLVWKHDQJOHEHWZHHQWKHYROWDJHDQGWKHFXUUHQWVHH)LJ ,QDSSOLFDWLRQVZKHUHWKHYROWDJHDQGFXUUHQWDUHQRWGLVWRUWHGWKH7RWDO3RZHU)DFWRU ZLOOHTXDOWKH'LVSODFHPHQW3RZHU)DFWRU%XWLIKDUPRQLFGLVWRUWLRQLVSUHVHQWWKH WZRSRZHUIDFWRUVZLOOQRWEHHTXDO 1.4: Harmonic Distortion +DUPRQLFGLVWRUWLRQLVSULPDULO\WKHUHVXOWRIKLJKFRQFHQWUDWLRQVRIQRQOLQHDUORDGV 'HYLFHVVXFKDVFRPSXWHUSRZHUVXSSOLHVYDULDEOHVSHHGGULYHVDQGIOXRUHVFHQWOLJKW EDOODVWVPDNHFXUUHQWGHPDQGVWKDWGRQRWPDWFKWKHVLQXVRLGDOZDYHIRUPRI$& HOHFWULFLW\$VDUHVXOWWKHFXUUHQWZDYHIRUPIHHGLQJWKHVHORDGVLVSHULRGLFEXWQRW VLQXVRLGDO)LJXUHVKRZVDQRUPDOVLQXVRLGDOFXUUHQWZDYHIRUP7KLVH[DPSOH KDVQRGLVWRUWLRQ 1000 0 Amps 500 Time – 500 – 1000 )LJXUH1RQGLVWRUWHG&XUUHQW:DYHIRUP )LJXUHVKRZVDFXUUHQWZDYHIRUPZLWKDVOLJKWDPRXQWRIKDUPRQLFGLVWRUWLRQ 7KHZDYHIRUPLVVWLOOSHULRGLFDQGLVIOXFWXDWLQJDWWKHQRUPDO+]IUHTXHQF\ +RZHYHUWKHZDYHIRUPLVQRWDVPRRWKVLQXVRLGDOIRUPDVVHHQLQ)LJXUH Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7KUHH3KDVH3RZHU0HDVXUHPHQW 1500 Current (amps) 1000 500 t 0 a 2a –500 –1000 –1500 )LJXUH'LVWRUWHG&XUUHQW:DYHIRUP 7KHGLVWRUWLRQREVHUYHGLQ)LJXUHFDQEHPRGHOHGDVWKHVXPRIVHYHUDOVLQXVRL GDOZDYHIRUPVRIIUHTXHQFLHVWKDWDUHPXOWLSOHVRIWKHIXQGDPHQWDO+]IUHTXHQF\ 7KLVPRGHOLQJLVSHUIRUPHGE\PDWKHPDWLFDOO\GLVDVVHPEOLQJWKHGLVWRUWHGZDYHIRUP LQWRDFROOHFWLRQRIKLJKHUIUHTXHQF\ZDYHIRUPV 7KHVHKLJKHUIUHTXHQF\ZDYHIRUPVDUHUHIHUUHGWRDVKDUPRQLFV)LJXUHVKRZV WKHFRQWHQWRIWKHKDUPRQLFIUHTXHQFLHVWKDWPDNHXSWKHGLVWRUWLRQSRUWLRQRIWKH ZDYHIRUPLQ)LJXUH 1000 0 Amps 500 Time 3rd harmonic 5th harmonic – 500 7th harmonic Total fundamental )LJXUH:DYHIRUPVRIWKH+DUPRQLFV Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7KUHH3KDVH3RZHU0HDVXUHPHQW 7KHZDYHIRUPVVKRZQLQ)LJXUHDUHQRWVPRRWKHGEXWGRSURYLGHDQLQGLFDWLRQRI WKHLPSDFWRIFRPELQLQJPXOWLSOHKDUPRQLFIUHTXHQFLHVWRJHWKHU :KHQKDUPRQLFVDUHSUHVHQWLWLVLPSRUWDQWWRUHPHPEHUWKDWWKHVHTXDQWLWLHVDUH RSHUDWLQJDWKLJKHUIUHTXHQFLHV7KHUHIRUHWKH\GRQRWDOZD\VUHVSRQGLQWKHVDPH PDQQHUDV+]YDOXHV ,QGXFWLYHDQGFDSDFLWLYHLPSHGDQFHDUHSUHVHQWLQDOOSRZHUV\VWHPV:HDUHDFFXV WRPHGWRWKLQNLQJDERXWWKHVHLPSHGDQFHVDVWKH\SHUIRUPDW+]+RZHYHUWKHVH LPSHGDQFHVDUHVXEMHFWWRIUHTXHQF\YDULDWLRQ ;/ MZ/DQG ;& MZ& $W+]Z EXWDW+]WKKDUPRQLFZ $VIUHTXHQF\FKDQJHV LPSHGDQFHFKDQJHVDQGV\VWHPLPSHGDQFHFKDUDFWHULVWLFVWKDWDUHQRUPDODW+] PD\EHKDYHHQWLUHO\GLIIHUHQWO\LQWKHSUHVHQFHRIKLJKHURUGHUKDUPRQLFZDYHIRUPV 7UDGLWLRQDOO\WKHPRVWFRPPRQKDUPRQLFVKDYHEHHQWKHORZRUGHURGGIUHTXHQFLHV VXFKDVWKHUGWKWKDQGWK+RZHYHUQHZHUQHZOLQHDUORDGVDUHLQWURGXFLQJ VLJQLILFDQWTXDQWLWLHVRIKLJKHURUGHUKDUPRQLFV 6LQFHPXFKYROWDJHPRQLWRULQJDQGDOPRVWDOOFXUUHQWPRQLWRULQJLVSHUIRUPHGXVLQJ LQVWUXPHQWWUDQVIRUPHUVWKHKLJKHURUGHUKDUPRQLFVDUHRIWHQQRWYLVLEOH,QVWUXPHQW WUDQVIRUPHUVDUHGHVLJQHGWRSDVV+]TXDQWLWLHVZLWKKLJKDFFXUDF\7KHVHGHYLFHV ZKHQGHVLJQHGIRUDFFXUDF\DWORZIUHTXHQF\GRQRWSDVVKLJKIUHTXHQFLHVZLWKKLJK DFFXUDF\DWIUHTXHQFLHVDERYHDERXW+]WKH\SDVVDOPRVWQRLQIRUPDWLRQ6R ZKHQLQVWUXPHQWWUDQVIRUPHUVDUHXVHGWKH\HIIHFWLYHO\ILOWHURXWKLJKHUIUHTXHQF\ KDUPRQLFGLVWRUWLRQPDNLQJLWLPSRVVLEOHWRVHH +RZHYHUZKHQPRQLWRUVFDQEHFRQQHFWHGGLUHFWO\WRWKHPHDVXUHGFLUFXLWVXFKDV GLUHFWFRQQHFWLRQWRDYROWEXVWKHXVHUPD\RIWHQVHHKLJKHURUGHUKDUPRQLF GLVWRUWLRQ$QLPSRUWDQWUXOHLQDQ\KDUPRQLFVVWXG\LVWRHYDOXDWHWKHW\SHRIHTXLS PHQWDQGFRQQHFWLRQVEHIRUHGUDZLQJDFRQFOXVLRQ1RWEHLQJDEOHWRVHHKDUPRQLF GLVWRUWLRQLVQRWWKHVDPHDVQRWKDYLQJKDUPRQLFGLVWRUWLRQ ,WLVFRPPRQLQDGYDQFHGPHWHUVWRSHUIRUPDIXQFWLRQFRPPRQO\UHIHUUHGWRDV ZDYHIRUPFDSWXUH:DYHIRUPFDSWXUHLVWKHDELOLW\RIDPHWHUWRFDSWXUHDSUHVHQW Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7KUHH3KDVH3RZHU0HDVXUHPHQW SLFWXUHRIWKHYROWDJHRUFXUUHQWZDYHIRUPIRUYLHZLQJDQGKDUPRQLFDQDO\VLV7\SL FDOO\DZDYHIRUPFDSWXUHZLOOEHRQHRUWZRF\FOHVLQGXUDWLRQDQGFDQEHYLHZHGDV WKHDFWXDOZDYHIRUPDVDVSHFWUDOYLHZRIWKHKDUPRQLFFRQWHQWRUDWDEXODUYLHZ VKRZLQJWKHPDJQLWXGHDQGSKDVHVKLIWRIHDFKKDUPRQLFYDOXH'DWDFROOHFWHGZLWK ZDYHIRUPFDSWXUHLVW\SLFDOO\QRWVDYHGWRPHPRU\:DYHIRUPFDSWXUHLVDUHDOWLPH GDWDFROOHFWLRQHYHQW :DYHIRUPFDSWXUHVKRXOGQRWEHFRQIXVHGZLWKZDYHIRUPUHFRUGLQJWKDWLVXVHGWR UHFRUGPXOWLSOHF\FOHVRIDOOYROWDJHDQGFXUUHQWZDYHIRUPVLQUHVSRQVHWRDWUDQVLHQW FRQGLWLRQ 1.5: Power Quality 3RZHUTXDOLW\FDQPHDQVHYHUDOGLIIHUHQWWKLQJV7KHWHUPVSRZHUTXDOLW\DQG SRZHUTXDOLW\SUREOHPKDYHEHHQDSSOLHGWRDOOW\SHVRIFRQGLWLRQV$VLPSOHGHILQL WLRQRISRZHUTXDOLW\SUREOHPLVDQ\YROWDJHFXUUHQWRUIUHTXHQF\GHYLDWLRQWKDW UHVXOWVLQPLVRSHUDWLRQRUIDLOXUHRIFXVWRPHUHTXLSPHQWRUV\VWHPV7KHFDXVHVRI SRZHUTXDOLW\SUREOHPVYDU\ZLGHO\DQGPD\RULJLQDWHLQWKHFXVWRPHUHTXLSPHQWLQ DQDGMDFHQWFXVWRPHUIDFLOLW\RUZLWKWKHXWLOLW\ Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7KUHH3KDVH3RZHU0HDVXUHPHQW ,QKLVERRN3RZHU4XDOLW\3ULPHU%DUU\.HQQHG\SURYLGHGLQIRUPDWLRQRQGLIIHUHQW W\SHVRISRZHUTXDOLW\SUREOHPV6RPHRIWKDWLQIRUPDWLRQLVVXPPDUL]HGLQ7DEOH Cause Disturbance Type Source ,PSXOVHWUDQVLHQW 7UDQVLHQWYROWDJHGLVWXUEDQFH VXEF\FOHGXUDWLRQ /LJKWQLQJ (OHFWURVWDWLFGLVFKDUJH /RDGVZLWFKLQJ &DSDFLWRUVZLWFKLQJ 2VFLOODWRU\ WUDQVLHQWZLWKGHFD\ 7UDQVLHQWYROWDJHVXEF\FOH GXUDWLRQ /LQHFDEOHVZLWFKLQJ &DSDFLWRUVZLWFKLQJ /RDGVZLWFKLQJ 6DJVZHOO 506YROWDJHPXOWLSOHF\FOH GXUDWLRQ 5HPRWHV\VWHPIDXOWV ,QWHUUXSWLRQV 506YROWDJHPXOWLSOH VHFRQGVRUORQJHUGXUDWLRQ 6\VWHPSURWHFWLRQ &LUFXLWEUHDNHUV )XVHV 0DLQWHQDQFH 8QGHUYROWDJHRYHUYROWDJH 506YROWDJHVWHDG\VWDWH PXOWLSOHVHFRQGVRUORQJHU GXUDWLRQ 0RWRUVWDUWLQJ /RDGYDULDWLRQV /RDGGURSSLQJ 9ROWDJHIOLFNHU 506YROWDJHVWHDG\VWDWH UHSHWLWLYHFRQGLWLRQ ,QWHUPLWWHQWORDGV 0RWRUVWDUWLQJ $UFIXUQDFHV +DUPRQLFGLVWRUWLRQ 6WHDG\VWDWHFXUUHQWRUYROW DJHORQJWHUPGXUDWLRQ 1RQOLQHDUORDGV 6\VWHPUHVRQDQFH 7DEOH7\SLFDO3RZHU4XDOLW\3UREOHPVDQG6RXUFHV ,WLVRIWHQDVVXPHGWKDWSRZHUTXDOLW\SUREOHPVRULJLQDWHZLWKWKHXWLOLW\:KLOHLWLV WUXHWKDWPDn\SRZHUTXDOLW\SUREOHPVFDQRULJLQDWHZLWKWKHXWLOLW\V\VWHPPDQ\ SUREOHPVRULJLQDWHZLWKFXVWRPHUHTXLSPHQW&XVWRPHUFDXVHGSUREOHPVPD\ PDQLIHVWWKHPVHOYHVLQVLGHWKHFXVWRPHUORFDWLRQRUWKH\PD\EHWUDQVSRUWHGE\WKH XWLOLW\V\VWHPWRDQRWKHUDGMDFHQWFXVWRPHU2IWHQHTXLSPHQWWKDWLVVHQVLWLYHWR SRZHUTXDOLW\SUREOHPVPD\LQIDFWDOVREHWKHFDXVHRIWKHSUREOHP ,IDSRZHUTXDOLW\SUREOHPLVVXVSHFWHGLWLVJHQHUDOO\ZLVHWRFRQVXOWDSRZHUTXDOLW\ SURIHVVLRQDOIRUDVVLVWDQFHLQGHILQLQJWKHFDXVHDQGSRVVLEOHVROXWLRQVWRWKH SUREOHP Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2: Meter Overview 2: Meter Overview 2.1: The Nexus® 1262/1272 Multi-parameter Revenue Meter The Nexus® 1262/1272 transformer-rated, polyphase revenue meter is a unique collection of metering technologies designed to fulfill advanced metering requirements. It provides high-accuracy power and energy measurements of Voltage, current and all power values, data logging and power quality recording. The unit makes the data available through the display, connected systems and historic logs. 2.2: Accu-MeasureTM Technology - Theory of Operation The advanced metering capability of the Nexus® 1262/1272 device is a result of EIG’s Accu-MeasureTM Digital Sensing Technology. Accu-MeasureTM technology is a combination of high-speed sampling, high-resolution measurement and high-speed calculation. All Voltage and current waveforms are sampled and RMS values calculated continuously every cycle. Values of Voltage, current and power are produced every three cycles and every second. Figure 2.1 illustrates the key processes operating within the Nexus® 1262/1272 meter. The meter allows for four types of inputs and can provide outputs to an integrated display, pulse outputs and several communication ports. Nexus® 1262/1272 Meter Processing Voltage and current signals enter the meter and are sampled at up to 256 samples per cycle. Each sample is resolved to a digital value using 16-bit analog-to-digital converters. The Nexus® 1272 meter has two 16-bit A/D converters and the Nexus® 1262 meter has one. The first converter, which both meters have, is for the real-time measurements. The second converter, unique to the 1272, is for the waveform recorder. The use of two A/D converters ensures that both signals have maximum resolution, accuracy and integrity. The second converter also isolates energy sampling and calculations from the waveform fault recording requirements. This provides both advanced energy and advanced waveform analysis. Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 2- 1 2: Meter Overview 4IME 3YNCHRONIZING ,#$$ISPLAY 6OLTAGE)NPUT #IRCUITRY 3AMPLING -ULTIPLEXING AND3IGNAL #ONDITIONING #URRENT)NPUT #IRCUITRY #HANNEL 3TATUS)NPUTS 2EAL4IME -EASUREMENTS 0ROCESSING )20ORT ,%$4EST 0ULSE +9:/UTPUT #HANNEL -EMORY 7AVEFORM 2ECORDING 0ROCESSING %THERNETAND OR-ODEM 230ORT 230ORT Figure 2.1: How the Nexus® 1262/1272 Meter Processes Inputs The digitized signals are then passed to the appropriate processor. Real-time measurements are calculated in one processor and made available for meter readings and historical logs. A separate processor performs waveform recording. Calculated data and logs are stored in memory for delivery to displays, external systems and download processes. The meter includes a time synchronizing input port that accepts an industry standard IRIG-B signal to synchronize meter time to standard universal time. If there is no IRIG-B signal, the meter uses an internal 20 ppm crystal or the primary power line frequency to keep meter time. The Line Frequency Clock Synchronization feature may be enabled or disabled. If it is not enabled, the internal clock crystal provides time synchronization. All readings and logs are time stamped to the nearest millisecond. Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 2- 2 2: Meter Overview Eight status channels provide input of status or pulse signals. Status inputs are date/ time stamped to the nearest millisecond and placed in the event log. Pulse inputs are multiplied by a user-supplied factor and accumulated in reading registers. These accumulated values can also be totalized. This feature makes the Nexus® 1262/1272 meter a good fit in universal metering applications. Additionally, any one input channel can be selected to accept an End of Interval pulse from another meter. Meter set-up parameters and all historical log data are stored in nonvolatile RAM. The user has multiple log functionality. Data is made available through the onboard display. Display screens are described in Chapter 3. Several additional communication channels operate simultaneously, including the optional Ethernet/Modem Combo Card. External systems can be connected to either of the RS485 ports or the Ethernet/Modem port. Stored data can be downloaded through the RS485 ports, the Ethernet/Modem port or the Optical port. Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 2- 3 2: Meter Overview 2.3: Advanced Measurement Functionality 2.3.1: Advanced Revenue Billing Capability The Nexus® 1262/1272 device is a full four-quadrant power and energy meter with accuracy of within 0.06% of reading at full load unity PF. Energy measurements include: kWh Delivered & Received, kVARh Delivered & Received, kVAh, kVARh, kWh in each quadrant and Total kVAh. The meter measures instantaneous power and provides multiple, simultaneous demand measurements, including time-stamped maximum and minimum readings. Time of Use The Nexus® meter’s Time of Use functionality offers the following standard capabilities: • 8 TOU schedules • Bidirectional consumption and Demand • 4 seasons/year • 20-year calendar • Prior month and prior season readings for each schedule • Present month and present season readings for each schedule • Prior season may also be adjusted for a programmable freeze period • Total-to-date readings for each month • Total-to-date readings for each season • Cumulative and continuous cumulative Demand Load Aggregation/Universal Metering Using standard pulse inputs, the Nexus® 1262/1272 meter can count pulses from external meters and accumulate usage. The pulse inputs can be used to totalize electrical usage and utility values, such as water or gas use data. Readings include: • 8 pulse inputs Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 2- 4 2: Meter Overview • Individual accumulating registers • 4 totalizing registers • Totalization with Nexus® meter kWh readings Multiple Demand Windows The Nexus® 1262/1272 meter simultaneously monitors four demand structures. The unit offers: • Block Window Demand • Rolling Window Demand • Thermal Demand • Predictive Demand • Interval length from 1 second to over one hour • Up to 15 sub-intervals • End of Interval Pulse Output (with optional 4IPO Internal KYZ capability) • End of Interval Pulse Input Time-Stamped Max/Min Demands The unit gathers Time-stamped Max/Min Demands for all power values. Each of the following values is date/time stamped: • kW Demand, Delivered & Received, Max/Min • kVAR Demand, Delivered & Received, Max/Min • kVAR Coincident with kW Demand • kVA Demand, Max/Min • Amps Demand, Max/Min • Voltage Demand Max/Min Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 2- 5 2: Meter Overview Transformer Loss Compensation Transformer Loss Compensation adjusts for both copper and iron losses with a simple user setup. 2.3.2: Communications and I/O Capabilities The Nexus® 1262/1272 meter features advanced communication which utilizes multiple Com ports using open protocols. The meter’s multi-port design allows multiple communication connections simultaneously. The Nexus® 1262/1272 system provides a direct digital link, allowing selected data to be gathered without affecting the meter or your data. All of the advanced features of the 1262/1272 are made available through industry-standard Modbus and DNP 3.0 protocols. No proprietary or closed protocols are used. Standard Communications • ANSI Type 2 Optical port • 2 RS485 serial ports • Modbus RTU/ASCII protocol • DNP 3.0 Level 2 + protocol • Speeds up to 115200 bps Optional Communications The Nexus® 1262/1272 meter allows you to select an additional port for one of the following uses: • INP2: Internal 56k Modem with telephone line noise rejection • INP200: Internal Ethernet TCP/IP (10/100BaseT) with multiple sockets and Modbus TCP and DNP TCP • INP202: Combination 56k Modem and Internal Ethernet TCP/IP (10/100BaseT) Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 2- 6 2: Meter Overview Standard Internal I/O Extensive I/O capability is available in conjunction with all metering functions: • IRIG-B Time Synchronizing to GPS to 1 millisecond resolution • 8 High-Speed Status Inputs for status detect or of load aggregation/universal metering inputs • Four KYZ pulse outputs which can be programmed to pulse for any accumulated reading. One of the pulse outputs can also be set for an End-of-Interval Sync Pulse. Upgradable External I/O The user can select from the following to connect multiple external I/O Modules for enhanced I/O capability: • Analog Outputs • Analog Inputs • Additional Status Inputs • KYZ Outputs • Relay/ Alarm Outputs Control Options ElectroLogicTM Relay Control provides user-definable control outputs: • Action and/or alarm on abnormal condition • Action on Boolean logic combinations of Inputs or electrical conditions Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 2- 7 2: Meter Overview 2.3.3: Display Screens The Nexus® 1262/1272 meter features a built-in graphical back-lit FSTN LCD display with extended temperature Voltage compensation. This allows you to view energy data and to gather circuit diagnostic data such as Voltage, current, harmonics and phasor information. The display is easily programmable. See Chapter 3 for details on the Programmable Display. 2.3.4: Additional Switches The Nexus® 1262/1272 meter has additional switches & signals that help in using the unit (see Section 3.2 for more information): • The Infrared Test Pulse can be set to pulse for +Watt-hour, -Watt-hour, +VAR-hour, -VAR-hour and VA-hour. The pulse uses time modulation, which allows the pulse to be accurate during short duration pulse tests. The pulse integration uses industryaccepted reference standards. • The Mode Switch (magnetic reed switch) uses a magnet to switch operating modes. • The Test button is used to access Test Mode. • The Reset button is used to reset Demand. 2.3.5: Nexus® External I/O Modules A variety of optional analog or digital I/O modules mount externally to the Nexus® 1262/1272 Socket meter. The Nexus® 1262/1272 unit does not supply power to I/O modules. Use a power supply, such as EIG’s PSIO, to power optional I/O modules. See Chapter 10 for details on installation and use of the Nexus® External I/O modules. 2.3.6: Optional P40N/P40N+, P41N+ and P43N+ LED Remote Displays The Nexus® 1262/1272 Socket meter features a back-lit LCD display built into the face of the meter. In addition, Electro Industries offers optional external LED displays, powered by a power supply (such as the PSIO). The P40N+ (and legacy P40N), P41N+ and P43N+ displays provide easy access to information stored in the meter if an additional display is required for remote access. See Chapter 9 for further details. Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 2- 8 2: Meter Overview 2.4: Nexus® 1262/1272 Meter Forms The Nexus® 1262/1272 Socket meter offers three supported S-Based meter forms based on the rated Voltage and hookup required by the user. Below are the form specifications. Form 9S can be ordered in an A-Base (Order Form 9A). See Chapter 11 for corresponding Wiring diagrams and Appendix B for Blade configurations. The Switchboard Meter offers two supported Z-Based forms, 9Z and 36Z (see Chapter 12). NOTE: Form 45S replaces Form 5S and may also be used in 4-wire Delta circuits. Table 1: Nexus® 1262/1272 Meter Forms Form Hookup 9S 3E Wye or Delta 36S 2 1/2E Wye 45S 2E or 4W Delta NOTE: See Section 2.6 for Rated Voltages. Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 2- 9 2: Meter Overview 2.5: Nexus® 1262/1272 Meter Accuracy Table 2: Nexus® 1262/1272 Meter Accuracy Value Accuracy Voltage 0.02% Current 0.05% Frequency 0.001Hz W 0.06% [email protected] 0.06% [email protected] 0.10% VAR 0.10% VA 0.10% PF 0.10% 2.6: Nexus® 1262/1272 Meter Specifications Overview Sense Inputs Current (AC) • Transformer (CT) rated • Two or three current inputs depending on Form (Ia, Ib, Ic) • Class 2 - 1A nominal, burden [email protected] • Class 10, 20 - 5A nominal, burden 0.0125VA@25A • 0.1% of nominal pick-up current • 120% over-range of Meter Class • Current surge withstand (at 23o C): 100 Amps for 10 seconds, 300 Amps for 3 seconds, 500 Amps for 1 second • The current inputs are only to be connected to external current transformers. Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 2- 10 2: Meter Overview Voltage (AC) • Blade powered unit, standard Voltage (Option S): 480V max Phase to Reference (Va, Vb, Vc, to VRef), burden total 12V max (including power supply); 600V max Phase to Phase (Va to Vb, Vb to Vc, Vc to Va) • Blade powered unit, low Voltage (Option LV): 69V max Phase to Reference (Va, Vb, Vc, to VRef), burden total 12V max (including power supply); 120V between Va, Vb, Vc inputs • Externally powered units (Options SE, DE): 480V max Phase to Reference (Va, Vb, Vc, to VRef), burden 0.33VA@576V; 600V max between Va, Vb, Vc inputs • Input Impedance: 1Mohm/phase • 20% over range of rated Voltage • 2V pickup Voltage External Power Supply Options • Standard external (Option SE): (102 to 270) Vac @50/60Hz, 12VAmax • Low Voltage external (Option DE): (18 to 60)Vdc, Burden 9W max • Separate power cord • Switchboard meter is always separately powered (option SE or DE) Isolation • All inputs and outputs isolated to 2500 Volts • Com Ports isolated from each other to 1000 Volts Sensing • Accu-MeasureTM Technology • 16-bit A/D Inputs • True RMS Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 2- 11 2: Meter Overview • 8-Channel Sample and Hold Memory • All meter setup parameters, measurements and logs contained in nonvolatile RAM Standard Communications • LCD display • ANSI Type 2 Optical port • Two RS485 serial ports • Modbus® RTU, Modbus ASCII and DNP 3.0 protocols • Data Speeds of up to 115200 bps • Eight High-Speed Input channels Optional Communications • INP2: 56k Modem with dial-out capabilities • INP200: Internal 10/100BaseT Ethernet with Total Web Solutions • INP202: Ethernet (INP200) / Modem (INP2) Combo card • Modbus TCP and DNP LAN/WAN Internal 8-Channel Digital Inputs • Type: Self-excited, for dry contacts only • Wetting Voltage: 12Vdc typical Internal 4-Channel KYZ Outputs • Type: Form C contacts, pulse or transition based counts • On Resistance: 23-35: • Peak Voltage: 350Vdc Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 2- 12 2: Meter Overview • Continuous Load Current: 120mA • Peak Load Current: 350mA (10ms) • Off-State Leakage Current @350Vdc: 1:PA • Opto Isolation: 3750V rms (60 Hz, 1 min) Clock Timing • IRIG-B input for synchronizing to external GPS clock signal - accuracy better than 1msec per month • Line Frequency Clock Synchronization - accuracy better than 1 second per month • Internal Clock Crystal - accuracy better than 2 minutes per month Environmental (Temperature Specifications to Indirect Light) • Operating Temperature: (-40 to +85)°C • Display Operating Temperature: (-20 to +60)°C • Humidity: 95% non-condensing • Storage Temperature: (-40 to +85)°C • Raintight Lexan Cover (Socket meter) NOTE: At temperatures above 60° C the display may turn black. The display should return to normal once the temperature has cooled. If the meter is exhibiting a heating issue that causes the display to turn black, try shielding the meter from direct sunlight or otherwise provide some cooling effect to the meter. Security • A hardware lock secures meter settings. • Two 10-character passwords are configurable: one password controls access to read meter digitally; a separate password controls access to meter programming. • An additional 8 level password sequence is available by user configuration. Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 2- 13 2: Meter Overview Internal Battery • Panasonic BR3032 3V Lithium Battery (or equivalent) maintains NVRAM and time during outages. Modem Battery • 3V Lithium Battery with custom leads and velcro mounting maintains Dial-Back feature during outages. Call factory for replacement battery - the part # is BAT1. IRIG-B Port Impedance • 1.8mA @ 5V Compliance • ANSI C12.20 Class 0.2 (0.2% Accuracy) • ANSI C37.90.1 (Surge Withstand) • ANSI C62.41 (Surge Immunity) • ANSI C12.18 (Optical Port) • IEC/CISPR 14-1 (Continuous EM Disturbance) • IEC801-2 (Electrostatic Discharge) • IEC801-3 (Radiated EM Immunity) • IEC801-4 (EFT) • IEC687 (Voltage Dips and Interruptions) • IEC60687 (Class 0.2% Accuracy) • IEC 62053-22 (0.2% Accuracy) • IEC62052-11 (General Requirements; Mechanical Properties; Climactic Influences) Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 2- 14 2: Meter Overview 2.7: Nexus® 1262/1272 Meter Logging Specifications Table 3: Model Memory Historical Log 1* Historical Log 2* CBEMA / ITIC** Event Log ** Waveform Log*** Flicker Log** Input Log ** Output Log** System Events** 1272 Standard 85 Days 133 Days 512 1024 63 1536 256 1024 1024 1272 Advanced 555 Days 133 Days 512 1024 95 5120 256 1024 1024 1262 Standard 69 Days 32 Days N/A 512 N/A N/A 512 1024 1024 1262 Advanced 480 Days 133 Days N/A 512 N/A N/A 512 1024 1024 *Assumes logs store 4 scaled energy readings every 15 minutes. **Number of events recorded (assumes 14 parameters monitored). ***Number of waveform records. Each record may be from 8 to 64 cycles in duration, depending upon meter setup. 2.8: DNP V3.00 Level 2 Nexus® 1262 and 1272 meters support DNP V3.00 Level 2 DNP Level 2 Features • Up to 136 measurements (64 Binary Inputs, 32 Binary Counters, 64 Analog Inputs) can be mapped to DNP Static Points (over 3000) in the customizable DNP Point Map. • Up to 16 Relays and 8 Resets can be controlled through DNP Level 2. • Report-by-Exception Processing (DNP Events) Deadbands can be set on a per-point basis. • Available Freeze commands are Freeze, Freeze/No-Ack, Freeze with Time, and Freeze with Time/No-Ack. • Freeze with Time commands enable the Nexus® meter to have internal time-driven Frozen and Frozen Event data. When the meter receives the time and interval, the data is created. For complete details, download the appropriate DNP User Manual from our website at www.electroind.com. Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 2- 15 2: Meter Overview This page intentionally left blank. Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 2- 16 2SHUDWLQJ,QVWUXFWLRQV 3: Operating Instructions 3.1: Nameplate Information 7KH1H[XV6RFNHWPHWHUKDVLWVRSHUDWLQJLQIRUPDWLRQUHSUHVHQWHGRQ WKHQDPHSODWHZKLFKLVORFDWHGRQWKHIDFHRIWKHPHWHUVHHILJXUHEHORZ6HULDO DQG0RGHOQXPEHUVDUHRQWKH2SWLRQVODEHOVHHQH[WSDJH *UDSKLFDO/&' 8VHU'HILQHG$UHD )RUP )DFWRU 'LDJUDP 0RGH 6ZLWFK )LJXUH0HWHU6KRZLQJ)DFHSODWH(OHPHQWV 7KHQXPEHUVLQWKHILJXUHUHSUHVHQW 0XOWLSO\E\&RQVWDQW 9ROWDJH7UDQVIRUPHU5DWLR375DWLR &XUUHQW7UDQVIRUPHU5DWLRVHH*ORVVDU\ 3ULPDU\:DWWKRXUFRQVWDQW &XUUHQWFODVV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV :DWWKRXUWHVWFRQVWDQW $16,&)RUP1XPEHU $16,&$FFXUDF\&ODVV 7HVW$PSHUHV Model: NEXUS 1272-S-SWB2-20-60-SE-INP202 Serial#: 114-0074880532 Memory: 2 Meg Class: 20 Freq.: 60 Hz KYZ Out: Yes Opt. Comm: Ethernet/Modem Combo Power Supply: Std. Ext 102-275V AC/DC )LJXUH0HWHU2SWLRQV/DEHO 7KH2SWLRQV/DEHOLVORFDWHGRQWKHRXWVLGHRIWKHLQWHUQDOVKURXG,WLVSULQWHG VSHFLILFDOO\IRUHDFKPHWHUDQGVKRZVWKHRUGHUHGRSWLRQVWKDWDUHLQFOXGHGLQWKH PHWHU$QH[DPSOHRIDW\SLFDOODEHOLVVKRZQDERYH%HORZLVDOLVWRIRSWLRQV DYDLODEOHIRUWKHPHWHU Memory (1272): Memory (1262): 66WDQGDUG0RI5$0 66WDQGDUG.RI5$0 $$GYDQFHG0RI5$0 $$GYDQFHG0RI5$0 Communication Options: ,13'LDO2XW2SWLRQ ,13(WKHUQHW%DVH7 ,13(WKHUQHW0RGHP&RPELQDWLRQ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV Case Style: 6:%6ZLWFKERDUG 6666RFNHWPHWHU)RUPV $6RFNHWPHWHULQ$%DVH Power Supply: 6(6WG([W9$&'& 66WG%ODGH3RZHUHG '('&([W9'& /99$&%ODGH3RZHUHG EIG Number - Model Number plus Option Numbers ([DPSOHEHORZ 0RGHO0HPRU\)RUP)UHT3RZHU6XSSO\,2&RPPXQLFDWLRQ $6+]632,13 Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV 3.2: Basic Operation ,QIUDUHG 7HVW 3XOVH 0RGH0DJQHWLF5HHG 6ZLWFK $FWLYDWH0RGH 6ZLWFKE\VZLSLQJ DPDJQHWRQ PHWHUVLGH 7HVW %XWWRQ XQGHUWKHFRYHU 5HVHW 6ZLWFK 2SWLFDO 3RUW )LJXUH0HWHU6KRZLQJ6ZLWFKHVDQG,QGLFDWRUV Switches and Indicators 7KHUHDUHWZRVZLWFKHVDFFHVVLEOHIURPRXWVLGHWKHPHWHUFRYHU 7KHMode6ZLWFKDOVRFDOOHGD0DJQHWLF5HHG6ZLWFKLVXVHGWRVZLWFKIURP 1RUPDO0RGHWR&LUFXLW'LDJQRVWLF0RGHRU7LPHRI8VH0RGH 7KHReset6ZLWFKLVXVHGWRUHVHW'HPDQG $WKLUGVZLWFKWKHTest%XWWRQLVDFFHVVLEOHRQO\ZKHQWKHFRYHUKDVEHHQ UHPRYHG7KH7HVW%XWWRQVZLWFKHVWKHPHWHUIURPRQHRIWKHRSHUDWLRQDOPRGHVWR 7HVW0RGHDQGEDFNWR1RUPDO0RGH7KH7HVW%XWWRQLVDOVRXVHGWRDFFHVV'LVSOD\ $GMXVWPHQWV0RGHGXULQJ3RZHUXS0RGH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV Optical Port 7KH2SWLFDOSRUWLVORFDWHGRQWKHORZHUOHIWVLGHRIWKHPHWHUIDFH:LWKWKH2SWLFDO SRUW\RXFDQSURJUDPWKHPHWHUZLWK&RPPXQLFDWRU(;7VRIWZDUHXVLQJDQ$=RU $8&RPPXQLFDWLRQ,QWHUIDFHRURWKHU$16,&7\SH,,PDJQHWLFRSWLFDO FRPPXQLFDWLRQVFRXSOHUDQGDQ56FDEOH$=RUD86%FDEOH$8WRD3& Test Pulse $QLQIUDUHG7HVWSXOVHLVORFDWHGRQWKHXSSHUOHIWVLGHRIWKHIDFH(QHUJ\SXOVLQJ DSSOLFDWLRQVFDQEHFRQILJXUHGXVLQJ&RPPXQLFDWRU(;7VRIWZDUH Phase Indicator $3KDVHLQGLFDWRULVORFDWHGRQWKHORZHUULJKWVLGHRIWKHIDFH³$%&´VWD\V LOOXPLQDWHGLIDOOWKUHHSKDVHVRI9ROWDJHDQGFXUUHQWDUHSUHVHQW³$&%´LQGLFDWHV UHYHUVHGSKDVHVHTXHQFH7KHLQGLFDWRUEOLQNV$%RU&LIRQHSKDVHLVQRWSUHVHQW,I QRSKDVHVDUHSUHVHQWWKHPHWHUWXUQVRIIXQOHVV\RXKDYHDQ$X[SLJWDLOFRQQHFWHG WRDSRZHUVRXUFH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV 3.3: LCD Display Information 7KH1H[XVPHWHUKDVDJUDSKLFDOEDFNOLW)671/&'SURJUDPPDEOH GLVSOD\ZLWKH[WHQGHGWHPSHUDWXUH9ROWDJHFRPSHQVDWLRQ7KHGLVSOD\OHWV\RXYLHZ (QHUJ\GDWDDQGJDWKHUFLUFXLWGLDJQRVWLFGDWDVXFKDV9ROWDJHFXUUHQWKDUPRQLFV DQGSKDVRULQIRUPDWLRQ <RXXVH&RPPXQLFDWRU(;7VRIWZDUHWRSURJUDPWKHGLVSOD\7KHGLVSOD\KDVWKUHH 9LHZPRGHVWRZKLFK\RXDVVLJQVFUHHQV7KLVOHWV\RXGHWHUPLQHZKDWGDWDLV GLVSOD\HGDQGLQZKDWRUGHU9LHZPRGHLVWKHSULPDU\PRGHWKHRWKHUPRGHV DXWRPDWLFDOO\UHWXUQWR9LHZPRGHDIWHUDXVHUVHWDPRXQWRILQDFWLYLW\6HWWKH WLPHWKURXJK&RPPXQLFDWRU(;7VHH6HFWLRQLQVWUXFWLRQVIRUWKH0LVFHOODQHRXV WDE7KHUHLVDOVRD7HVWPRGHDQGD6HOHFW&RPSHQVDWLRQVFUHHQ Mode Details $FFHVV9LHZPRGHDQG9LHZPRGHE\VZLSLQJWKH0RGH6ZLWFKZLWKDPDJQHW VHH)LJXUH$FFHVV7HVWPRGHE\UHPRYLQJWKHFRYHU32:(50867%(2)) SRZHULQJXSWKHPHWHUDQGSXVKLQJWKH7HVW%XWWRQDWDQ\WLPH6HHWKH1DYLJDWLRQ PDSLQ6HFWLRQIRUGLVSOD\PRGHGHWDLOV 7HVWPRGHDXWRPDWLFDOO\UHWXUQVWR9LHZPRGHDIWHUDQDPRXQWRIWLPHVLQFHWKH ODVWXVHUDFWLRQZLWKQRHQHUJ\DFFXPXODWLRQRUDQDPRXQWRIWLPHVLQFHWKHODVW XVHUDFWLRQSOXVWKH'HPDQGLQWHUYDOZLWKHQHUJ\DFFXPXODWLRQ7KHYDOXHVIRUWKH DPRXQWRIWLPHVLQFHWKHODVWXVHUDFWLRQDUHVHWWKURXJK&RPPXQLFDWRU(;7VHH 6HFWLRQLQVWUXFWLRQVIRUWKH0LVFHOODQHRXVWDE Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV Display Configurator $1H[XVPHWHUZLWKWKHDSSURSULDWHILUPZDUH8VHU3URJUDPPDEOH/&''LVSOD\5XQ 7LPH)LUPZDUHYHUVLRQ/&''LVSOD\%RRWYHUVLRQ%DVHPHWHU V&205XQ 7LPHRUKLJKHUSRVW1RYHPEHUJLYHV\RXWKH'LVSOD\&RQILJXUDWRU ZKLFKOHWV\RXDVVLJQXSWR/&'GLVSOD\VFUHHQVDFURVVWKHWKUHH9LHZPRGHV 7KHVHVFUHHQVFDQEHPDGHRIDQ\FRPELQDWLRQRISUHGHILQHGVFUHHQVVHH6HFWLRQ SUHGHILQHGVFUHHQVZLWKVRPHFXVWRPL]DWLRQDQGIXOO\FXVWRPL]HGVFUHHQV ZLWKDQ\RIWKHPHWHU VPHDVXUHGUHDGLQJVDQGQXPHULFFDOFXODWLRQVVXFKDVVFDOLQJ 7KH'LVSOD\&RQILJXUDWRU¶VIOH[LELOLW\OHWV\RXPDWFKWKHGLVSOD\VFUHHQVWRDQ\ DSSOLFDWLRQQHHGV\RXKDYH5HIHUWR6HFWLRQIRUSURJUDPPLQJGHWDLOV Base Programmable Display 1H[XVPHWHUVZLWKDQ/&''LVSOD\5XQ7LPH)LUPZDUHYHUVLRQRIOHVVWKDQ SUH1RYHPEHUGRQRWKDYHWKH'LVSOD\&RQILJXUDWRU)RUWKHVHPHWHUV\RXFDQ DVVLJQXSWRSUHGHILQHGVFUHHQVSHU9LHZPRGH5HIHUWR6HFWLRQIRUSURJUDP PLQJGHWDLOV NOTE: 6HH6HFWLRQIRULQVWUXFWLRQVRQILQGLQJ\RXUGLVSOD\¶VILUPZDUHYHUVLRQ Low Battery /R%DWW195DP,QWHUQDO%DWWHU\RU/R%DWW0RGHP0RGHP%DWWHU\IODVKHVRQ WKHVFUHHQHYHU\VHFRQGVZKHQWKH,QWHUQDORU0RGHP%DWWHU\LVUXQQLQJORZ RUZKHQLWLVQRW³FOLFNHG´LQWRSODFHSURSHUO\6HHLQVWDOODWLRQLQVWUXFWLRQVLQ6HFWLRQ Test Mode :K7HVW6DPHDVN:KVFUHHQH[FHSWLQ:KLQVWHDGRIN:K 9$5K7HVW6DPHDVN9$5VFUHHQH[FHSWLQ9$5K4XDGUDQWV 9$K7HVW6DPHDVN9$KVFUHHQH[FHSWLQ9$K4XDGUDQWV :DWW5ROOLQJ'HPDQG7HVW'HOLYHUHGDQG5HFHLYHG :DWW%ORFN'HPDQG7HVW'HOLYHUHGDQG5HFHLYHG Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV Initial Display Screens 7KH1H[XVPHWHUVKLSVZLWKLQLWLDOGLVSOD\VFUHHQVZKLFKVFUROORQWKH GLVSOD\DVVRRQDV\RXSRZHUXSWKHPHWHU7KHLQLWLDOGLVSOD\VFUHHQVDUHDVDPSOLQJ RIWKHSUHGHILQHGVFUHHQV7\SLFDOLQLWLDOGLVSOD\VFUHHQVLQFOXGH 0HWHU'DWDLQFOXGLQJ%RRW5XQ'63%RRW'635XQ6HULDO1XPEHU3URWHFW (QDEOHG%DXG :K'HOLYHUHG :K5HFHLYHG N9$5KSHU4XDGUDQW N9$KSHU4XDGUDQW 5ROOLQJ:'HPDQG'HOLYHUHG 5ROOLQJ:'HPDQG5HFHLYHG %ORFN:'HPDQG'HOLYHUHG %ORFN:'HPDQG5HFHLYHG :'HPDQG/DVW5HVHW &XPXODWLYH:'HPDQG Backlight 7KH%DFNOLJKWFDQQRWEHVHWWRVWD\RQLQGHILQLWHO\,WWXUQVRIIDIWHUDSURJUDPPHG LQWHUYDORQHKRXULVWKHPD[LPXPVHWWLQJ,IWKHEDFNOLJKWWLPHVRXWDQGLVRIIVZLSH WKH0RGH6ZLWFKRQFHWRWXUQWKHEDFNOLJKWRQDQGUHGLUHFWWKHVFUHHQ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV 3.3.1: Finding Your Display’s Firmware Versions 7RILQG\RXU/&'GLVSOD\¶VILUPZDUHYHUVLRQVIROORZWKHVHVWHSV &RQQHFWWRWKHPHWHUWKRXJK&RPPXQLFDWRU(;7VRIWZDUH &OLFNWKHProfileLFRQLQWKH7LWOHEDU &OLFNRevenue and Energy Settings>Display ConfigurationWRRSHQWKH'HYLFH 'LVSOD\3URJUDPDEOH6HWWLQJVVFUHHQVKRZQEHORZ 7KH/&'GLVSOD\¶VILUPZDUHYHUVLRQVDUHVKRZQLQWKHERWWRPOHIWSRUWLRQRIWKH VFUHHQ,IWKH%RRWYHUVLRQLVRUKLJKHUDQGWKH5XQYHUVLRQLVRUKLJKHU IROORZWKHLQVWUXFWLRQVLQ6HFWLRQ,IWKH%RRWDQG5XQYHUVLRQVDUHOHVVWKDQ IROORZWKHLQVWUXFWLRQVLQ6HFWLRQ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV 3.4: Nexus 1262/1272 Programmable Display Navigation Map 5NLESS3CROLLINGIS 3TOPPEDALLSCREENS ASSIGNEDTOTHEMODE SCROLLEVERYSECONDS -/$% 3WIPE-AGNET OVER-ODE3WITCH /NCEFOR-ODE 4WICEFOR-ODE 0RESS4EST"UTTON FROMANY-ODE 3WIPE-AGNET OVER-ODE3WITCH /NCEFOR-ODE 4WICEFOR-ODE -/$% 0RESS4EST"UTTON FROMANY-ODE -/$% 3WIPE-AGNET OVER-ODE3WITCH /NCEFOR-ODE 4WICEFOR-ODE 0RESS4EST"UTTON FROMANY-ODE -ODESANDRETURN TO-ODEAFTERAUSER SETAMOUNTOFTIME 0/7%250 -/$% 3TARTUP3CREEN AND3CROLLING $EVICE3TATUS )NFORMATION 3%,%#4#/-0%.3!4)/. 3ELECT4RANSFORMER,OSSAND#404 #OMPENSATION 0RESS4EST"UTTONTOVIEWOPTIONS INORDER 4RANSFOMER,OSS/NLY"OTH#404 AND4RANSFORMER,OSS.O #OMPENSATION#404/NLY %XIT$O.OT%NTER4EST-ODE 0RESSAND(/,$4ESTBUTTONON THEOPTIONYOUWANT 4%34-/$% 0RESS4EST"UTTON TOSCROLLTHROUGH 4ESTSCREENS 0RESSAND(/,$4EST "UTTONTOEXIT4EST MODEANDRETURNTO -ODE Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# 4EST-ODERETURNS TO-ODEAFTERAUSER SETAMOUNTOFTIME ( 2SHUDWLQJ,QVWUXFWLRQV 3.5: Using the Display Configurator 7KH1H[XVPHWHUZLWKDSSURSULDWHILUPZDUH8VHU3URJUDPPDEOH/&' 'LVSOD\5XQ7LPH)LUPZDUHYHUVLRQ/&''LVSOD\%RRWYHUVLRQ%DVHPHWHU V &205XQ7LPHRUKLJKHUJLYHV\RXWKH'LVSOD\&RQILJXUDWRU7KLVIHDWXUHOHWV \RXFXVWRPL]HWKHPHWHU V/&'VFUHHQVWRGLVSOD\DQ\PHDVXUHGUHDGLQJV7KH 'LVSOD\&RQILJXUDWRUIHDWXUHVWKUHH9LHZPRGHVVHH6HFWLRQDQGKDVPHPRU\ IRUXSWRVFUHHQVGLVWULEXWHGKRZHYHU\RXZDQWDPRQJWKHWKUHH9LHZPRGHV 7KHIOH[LELOLW\RIWKH'LVSOD\&RQILJXUDWRUDOORZV\RXWRFXVWRPL]HWKH/&'GLVSOD\IRU DQ\DSSOLFDWLRQ$GGLWLRQDOIHDWXUHVRIWKH'LVSOD\&RQILJXUDWRUDUHDVIROORZV <RXFDQDGGVFUHHQQXPEHUVDQGRUODEHOVWLWOHV <RXFDQDGGVFDOLQJDQGPXOWLSOLHUIDFWRUVWRWKHVFUHHQGDWD <RXFDQXVHWKHVFUHHQVWRYLHZGDWDIURPSXOVHLQSXWVVXFKDVZDWHUJDVVWHDP HWF <RXFDQXVHDFRPELQDWLRQRISUHGHILQHGDQGFXVWRPL]HGGLVSOD\V6HH6HFWLRQ IRUDOLVWRIWKHSUHGHILQHGGLVSOD\V IMPORTANT!<RXXVHWKH1H[XVPHWHU V0RGEXVPDSWRLGHQWLI\WKH GDWD\RXZDQWWRGLVSOD\LQDFXVWRPL]HGGLVSOD\VFUHHQ7KH0RGEXVPDSIRUWKH 1H[XVPHWHULVFRQWDLQHGLQWKHModus Protocol and Register Map for Nexus® 1252/1262/1272 Meters7KHPDQXDOFDQEHGRZQORDGHGIURP(,* V ZHEVLWHZZZHOHFWURLQGFRPSGIPRGEXVSGI To access the Display Configurator's programming screens &RQQHFWWRWKHPHWHUWKURXJK&RPPXQLFDWRU(;7 &OLFNWKHProfileLFRQWRRSHQWKH'HYLFH3URILOHVFUHHQ &OLFNWKHSOXVVLJQQH[WWR5HYHQXHDQG(QHUJ\6HWWLQJV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV 'RXEOHFOLFNDisplay Configuration<RXZLOOVHHWKHVFUHHQVKRZEHORZ7KHILUVW WDELV0HWHU'LVSOD\0RGH1DPHVZKLFKOHWV\RXDVVLJQODEHOVDQGGHVFULSWLRQVWR WKHWKUHH9LHZPRGHV D(QWHUDWKUHHOHWWHUODEHOIRUHDFKRIWKHWKUHH9LHZPRGHV E(QWHUDGHVFULSWLRQIRUHDFKPRGHXVLQJWKH/LQHDQG/LQH'HVFULSWLRQILHOGV &OLFNWKH6FUHHQ$VVLJQPHQWVWDE<RXZLOOVHHWKHVFUHHQVKRZQRQWKHQH[WSDJH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV Display screens available for assignment to View modes Right-click on a screen to assign it to View mode or to copy it Buttons that let you: Create custom display screens, Edit display screens, or Remove display screens from the available screens list View Mode Columns Buttons that let you: Change the order of display screens in a View mode, or Remove display screens from a View mode 8VLQJWKHEXWWRQVRQWKHERWWRPRIWKHVFUHHQ\RXFDQ 5HWULHYHGLVSOD\VHWWLQJVIURPWKHFRQQHFWHGPHWHUE\FOLFNLQJRetrieve from Display. 8SGDWHWKHFRQQHFWHGPHWHU VGLVSOD\VHWWLQJVE\FOLFNLQJUpdate Display7KH PHWHUUHERRWVDQG\RXVHHDPHVVDJHRQWKH3&VFUHHQ'HYLFH/&''LVSOD\ 3URJUDPPDEOH6HWWLQJV8SGDWHG 6DYHDQ\FKDQJHV\RXKDYHPDGHWRGLVSOD\VHWWLQJVE\FOLFNLQJSave /RDGDSUHYLRXVO\VDYHG/&'GLVSOD\ILOHE\FOLFNLQJLoadDQGVHOHFWWKHILOH\RX ZDQWWRORDGLQWRWKLVVFUHHQLWLVDQGVILOH 5HWXUQWRWKHSUHYLRXVVFUHHQZLWKRXWVDYLQJDQ\FKDQJHVE\FOLFNLQJCancel 9LHZRQOLQHLQVWUXFWLRQVIRUXVLQJWKLVVFUHHQE\FOLFNLQJHelp 7KHOHIWPRVWFROXPQOLVWVDOORIWKH$YDLODEOHGLVSOD\VFUHHQV%HIRUH\RX YHXVHGWKH 'LVSOD\&RQILJXUDWRU\RXZLOORQO\VHHWKHSUHGHILQHGGLVSOD\VFUHHQVLQWKHOLVW 2QFH\RXKDYHFUHDWHGFXVWRPL]HGVFUHHQV\RXZLOOVHHWKRVHLQWKHOLVWDVZHOO Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV 7KHRWKHUWKUHHFROXPQVOLVWWKHGLVSOD\VFUHHQVWKDWDUHDVVLJQHGWRHDFKRIWKH WKUHH9LHZPRGHV8VHWKHVFUROOEDUVWRGLVSOD\DOORIWKHLWHPVLQWKHFROXPQV D7RDVVLJQRQHRIWKHVFUHHQVWRD9LHZPRGHRUWRFUHDWHDQHZVFUHHQ EDVHGRQLWFOLFNRQWKHVFUHHQLQWKHOLVWDQGULJKWFOLFN<RXZLOOVHHWKH SRSXSPHQXVKRZQEHORZ 7RDGGWKHVFUHHQWRRQHRIWKHPRGHVRUWRDOOPRGHVFOLFNRQWKDW LWHPLQWKHPHQX 7RFUHDWHDQHZVFUHHQEDVHGRQWKHVFUHHQFOLFNRQWKHODVWLWHPLQ WKHPHQXVHH6WHSH E7RFKDQJHWKHSRVLWLRQRIVFUHHQVLQRQHRIWKH9LHZPRGHVRUWRUHPRYH WKHVFUHHQIURPWKHPRGHFOLFNRQWKHVFUHHQLQWKH9LHZPRGHFROXPQ DQGWKHQHLWKHU &OLFNMove UpRUMove DownWRFKDQJHWKHSRVLWLRQRIWKHVFUHHQ ZLWKLQWKDW9LHZPRGH7KHSRVLWLRQRIWKHVFUHHQVGHWHUPLQHVWKHLU VFUROOLQJRUGHU &OLFNRemoveWRUHPRYHWKHVFUHHQIURPWKDW9LHZPRGH F7RFUHDWHDFXVWRPGLVSOD\VFUHHQFOLFNCreateLQWKH$YDLODEOH6FUHHQV FROXPQ&RQWLQXHWR³Creating a Custom Display Screen´RQWKHQH[W SDJH NOTEWR(GLWDFXVWRPVFUHHQFOLFNRQWKHVFUHHQLQWKH$YDLODEOH6FUHHQV OLVWDQGWKHQFOLFNEdit7KHQXVHWKHLQVWUXFWLRQVLQ³Creating a Custom Display Screen´RQWKHQH[WSDJHWRPRGLI\WKHVFUHHQ G7RHGLWDSUHGHILQHGVFUHHQFOLFNRQWKHVFUHHQLQWKH$YDLODEOH6FUHHQV FROXPQOLVWDQGWKHQFOLFNEdit&RQWLQXHWR³Editing a Pre-defined Display Screen´RQSDJH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV H7RFUHDWHDQHZVFUHHQEDVHGRQDQH[LVWLQJVFUHHQKLJKOLJKWWKHVFUHHQLQ WKH$YDLODEOH6FUHHQVFROXPQOLVWULJKWFOLFNDQGVHOHFWCreate New Screen Based on Selected Screen,I\RXDUHPDNLQJDFXVWRPVFUHHQ IROORZWKHLQVWUXFWLRQVEHORZ,I\RXDUHMXVWFKDQJLQJWKHVFUHHQQXPEHU RUODEHOIROORZWKHLQVWUXFWLRQVLQ³Editing a Pre-defined Display Screen´RQSDJH I7RUHPRYHDVFUHHQIURPWKHOLVWRIDYDLODEOHVFUHHQVFOLFNRQWKHVFUHHQLQ WKH$YDLODEOH6FUHHQVFROXPQOLVWDQGWKHQFOLFNRemove7KHVFUHHQLVQR ORQJHUGLVSOD\HGLQWKHOLVWRIDYDLODEOHVFUHHQVDQGFDQQRWEHDVVLJQHGWR DQ\9LHZPRGH,WLVDOVRUHPRYHGIURPDQ\9LHZPRGHVLWKDVDOUHDG\ EHHQDVVLJQHGWR &UHDWLQJD&XVWRP'LVSOD\6FUHHQ $IWHU\RXFOLFNWKHCreateEXWWRQLQWKH$YDLODEOHVFUHHQVOLVW\RXZLOOVHHWKH/&' 6FUHHQ6HOHFWLRQVFUHHQVKRZQEHORZ Click to create custom screen Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV &OLFNWKHUser definedEXWWRQLQWKH6FUHHQ7\SHER[7KHVFUHHQFKDQJHVWRDOORZ \RXWRVHWXSWKHQHZ'LVSOD\VFUHHQ You can change this number Select number of screen items OR 1 Demand,1 Timestamp The fields in Screen Layout are determined by the number of items you select These fields are for Modbus Information These fields are for multiplier setup These fields are for scaling setup <RXFDQFKDQJHWKHQXPEHUVKRZQLQWKH8VHU6FUHHQ1XPEHUILHOG7KLVILHOG DFFHSWVDQ\QXPEHUXSWRWKUHHGLJLWVLQOHQJWK8VHQXPEHUVEHWZHHQDQGLI \RXZDQWWKHQXPEHUWRGLVSOD\RQWKH/&'GLVSOD\VFUHHQXVHQXPEHUVEHWZHHQ DQGLI\RXGRQ WZDQWWKHQXPEHUWRGLVSOD\NOTE:7KH+DUPRQLFV 3KDVRUVDQG/LQH6HJPHQWVFUHHQVQHYHUGLVSOD\WKHLUQXPEHURQWKH/&'GLVSOD\ VFUHHQ 8VHWKH/D\RXW$UUDQJHPHQWILHOGWRFKRRVHZKDWILHOGV\RXZDQWWKH/&'VFUHHQWR GLVSOD\&KRRVHHLWKHU D7KHQXPEHURILWHPV\RXZDQWWKH/&'VFUHHQWRGLVSOD\FOLFNRQHRIWKHItem EXWWRQV E'LVSOD\'HPDQGDQG7LPHVWDPSILHOGVFOLFNWKH1 Demand, 1 Timestamp EXWWRQ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV $IWHU\RXPDNH\RXUVHOHFWLRQWKHOHIWVLGHRIWKHVFUHHQFKDQJHVWRGLVSOD\HQWU\ ILHOGVIRUWKH,WHPVRU'HPDQGDQG7LPH6WDPSLQIRUPDWLRQ6HHWKHH[DPSOH VFUHHQVEHORZ Custom Screen with 3 Item Fields The information for these fields comes from the meter’s Modbus Register Map Display screen label fields Item entry fields click here to enter the Modbus Register containing the item This is where you can specify a multiplier for your data These fields let you specify Scaling and data display Custom Screen with 1 Demand, 1 Timestamp Fields See screen above for explanation of the fields on the right side of the screen Display screen label fields Demand field Timestamp Status field (does not display on the LCD screen) Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV 7KHWRSILHOGLQWKH6FUHHQ/D\RXWVHFWLRQLVIRUWKHGLVSOD\VFUHHQODEHO7LWOH 'HSHQGLQJRQWKHQXPEHURILWHPV\RXVHOHFW\RXZLOOKDYHEHWZHHQWROLQHVIRU DVFUHHQODEHO ,I\RXVHOHFWHGLWHPVRU'HPDQG7LPHVWDPS\RXZLOOKDYH WZRHQWU\OLQHV ,I\RXVHOHFWHGLWHPV\RXZLOOKDYHRQHHQWU\OLQH ,I\RXVHOHFWHGLWHPV\RXZLOOQRWKDYHDQ\HQWU\ILHOGVIRUDGLV SOD\VFUHHQODEHOWKHUHZRQ WEHURRPRQWKHVFUHHQIRUDODEHO 7KH,WHPHQWU\ILHOGVDOORZ\RXWRVSHFLI\WKHGDWD\RXZDQWWRGLVSOD\RQWKH/&' VFUHHQ<RXFDQDOVRHQWHUDSUHIL[RSWLRQDOIRUHDFKOLQHLWHPDQGDVXIIL[ RSWLRQDOIRUDOORIWKHLWHPVRQWKHGLVSOD\VFUHHQ Example$VFUHHQFRQWDLQLQJSKDVHWRSKDVH9ROWDJHVPLJKWKDYHDVLQJOHWLWOH 9ROWV33OLQHVRIGDWDZLWKSUHIL[HV9DE9EF9FDDQGWKHVDPHVXIIL[09 RQDOOOLQHV 7KH'HPDQG7LPHVWDPSHQWU\ILHOGVDOORZ\RXWRVSHFLI\WKH'HPDQGWKH WLPHVWDPSDQGDQRSWLRQDOVWDWXVUHJLVWHU7KHVWDWXVUHJLVWHULVQRWGLVSOD\HGRQ WKH/&'VFUHHQ 7RHQWHUDQLWHP D&OLFNRQWKH,WHPODEHOER[)LHOGVWKDWRSHQXQGHUQHDWKWKHLWHPDOORZ\RX WRHQWHUWKHVWDUWLQJYDOXHRIWKH0RGEXV5HJLVWHUFRQWDLQLQJWKHGDWDIRU WKHLWHP8VHWKH'HFLPDOYDOXHRIWKHUHJLVWHU6HHWKHVFUHHQEHORZ 5HIHUWRWKHNexus 1252/1262/1272 Meter Modbus ManualIRUWKH PHWHU V0RGEXV5HJLVWHU0DS7KHPDQXDOFDQEHGRZQORDGHGIURP (,* VZHEVLWHZZZHOHFWURLQGFRPSGIPRGEXVSGI Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV IMPORTANT! All of the data items you select must be the same Modbus typeIRUH[DPSOH)7KH0RGEXVW\SHLVOLVWHGLQWKH0RGEXVPDS6HHWKH ([DPSOHEHORZ Example: 7RVHOHFW&\FOH3KDVH$19ROWDJHILQGWKHVWDUWLQJUHJLVWHUIRUWKHILHOGLQWKH 0RGEXVPDQXDO6HHWKHILJXUHEHORZ 1 Cycle Block 00090-00093 9 00094-00095 10 0 50 1 cycle Block Time Stamp 12/31/9999 23:59:59:99 1 cycle Phase A-N Voltage +65536 V1 / D V 2 $ECIMAL3TARTINGREGISTER)TEMYOUARESELECTING IS 10 msec 1/65536 V 2 sec F3 R F5 R -ODBUS4YPEIS& E&OLFNUpdateWRVDYHWKHLWHP VVWDUWLQJUHJLVWHUDGGUHVV F(QWHUDQ\DGGLWLRQDOLWHPVLQWKHVDPHZD\ G:KHQ\RXILQLVKHQWHULQJLWHPVXVHWKHHQWU\ILHOGVLQWKHULJKWSRUWLRQRI WKHVFUHHQWRHQWHUGHWDLOVIRUWKHLWHPV 0RGEXVW\SHDQGWRHQWHUVFDOLQJ PXOWLSOLHUDQGGDWDGLVSOD\VHWWLQJV7KH0RGEXVW\SHLQIRUPDWLRQLVIRXQG LQ&KDSWHURIWKHNexus® 1252/1262/1272 Meter Modbus Manual6HH WKHIROORZLQJH[DPSOH Example: 7KHLWHPLQWKHH[DPSOHDERYHZDV0RGEXVW\SH)$Q\DGGLWLRQDOLWHPVPXVWEHWKH VDPH0RGEXVW\SH7\SHLVGHVFULEHGLQ&KDSWHUSDJHRIWKH 0HWHU V0RGEXVPDQXDODVVKRZQLQWKHH[FHUSWWKDWIROORZV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV 8VHWKH0RGEXVW\SHLQIRUPDWLRQDVVKRZQEHORZ 3.5: Type F5 Secondary 1 Cycle RMS Voltage or Current Length: 2 Registers (4 bytes) Range: +1,048,576 V2 / 0 V2 or +65536 I2 / 0 I2(1262 or 1272) Unit: 1/4906 V2 secondary or 1/65536 A2 secondary (1262 or 1272) These registers together are a four-byte unsigned integer. Conversion into secondary voltage or current involves multiplying by the appropriate scale and taking the square root of that value. Depending on the unit and hardware, the range and unit of voltage reading differs. For a Nexus® 1262/72 meter, the range goes to +1,048,576 V2 with a unit of 1/4096 V2. ,QWKHH[DPSOHDERYH\RXZRXOGILQGWKHQXPEHURIUHJLVWHUVSHULWHPWKHIDFWWKDW WKHGDWDLVXQVLJQHGDQGVFDOLQJLQIRUPDWLRQIURPWKH0RGEXVW\SHLQIRUPDWLRQ 7KHILHOGVRQWKHOHIWXQGHUQHDWKWKH0XOWLSO\E\ILHOGVOHW\RXVHWXSKRZWKHGDWD ZLOOEHGLVSOD\HGIRUH[DPSOHVSHFLI\LQJLIWKHGDWDLVDQXPEHURUVRPHRWKHUYDOXH ZKHWKHU\RXZDQWWKHVLJQWRGLVSOD\IRUVLJQHGGDWDZKHWKHU\RXZDQWWKHGDWD VFDOHGWKHQXPEHURIGLJLWVDQGGHFLPDOSODFHVLQWKHILHOG&OLFNWKHSXOOGRZQ PHQXVWRVHHDOWHUQDWHFKRLFHVIRUWKHILHOGV7KHHQWULHV\RXPDNHDIIHFWDOORIWKH LWHPVRQWKHVFUHHQ7KHWDEOHWKDWIROORZVVKRZVWKHILHOGVDQGWKHYDOLGHQWULHVIRU WKHP Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV Table 1: Entry fields Possible entries 5HJLVWHUVSHULWHP 5HJLVWHUFRQWHQWV %LQDU\%&'7H[W6FDOHG(QHUJ\ 'DWD 6LJQHG8QVLJQHG 'LYLGHFRQWHQWVE\ 0XOWLSO\E\ 8VHUPXOWLSOLHUHQWHULQEODQNILHOG37 5DWLR&75DWLR 'DWDIRUPDW 1XPEHU7H[W3RZHUIDFWRU7LPH'DWH 7LPH'DWH6WDWXVLQGLFDWRU 1XPHULFDOVLJQ $XWR)RUFHGQHJDWLYH)RUFHGSRVLWLYH 6KRZVLJQ 1R<HV 6FDOH $XWR1RQHNLORN0HJD0*LJD* 7RWDOGLJLWV 'LJLWVWRWKHULJKWRIWKHGHFLPDOSODFH 2QFH\RXILQLVKPDNLQJ\RXUHQWULHVFOLFNOKWRUHWXUQWRWKH6FUHHQ$VVLJQPHQWV WDE7KHQHZVFUHHQLVQRZOLVWHGLQWKHOHIWPRVWFROXPQ&OLFNRQLWDQGWKHQ ULJKWFOLFNWRDVVLJQLWWRRQHRUDOORIWKH9LHZPRGHV :KHQ\RXILQLVKSURJUDPPLQJWKH/&'GLVSOD\FOLFN SaveWRVDYHWKH/&'3URJUDPPDEOH6HWWLQJVWRDQGVILOH UploadWRXSORDGWKH/&'3URJUDPPDEOH6HWWLQJVWRWKHFRQQHFWHG PHWHU CancelWRH[LWWKHVFUHHQwithout saving any changes Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV (GLWLQJD3UHGHILQHG'LVSOD\6FUHHQ <RXKDYHWKHIROORZLQJRSWLRQVIRUHGLWLQJSUHGHILQHGVFUHHQV <RXFDQHGLWWKHVFUHHQQXPEHU <RXFDQHGLWWKHVFUHHQODEHOWLWOH <RXFDQFUHDWHDQHZVFUHHQEDVHGRQWKHSUHGHILQHGVFUHHQEXW\RXZLOOVWLOORQO\ EHDEOHWRFKDQJHWKHVFUHHQQXPEHUDQGRUODEHO NOTE:6RPHRIWKHSUHGHILQHGVFUHHQVFDQQRWEHFXVWRPL]HGDVGHVFULEHGDERYH 7KHWDEOHEHORZOLVWVWKHVHSUHGHILQHGVFUHHQVDQGWHOOVZKDWFDQEHFKDQJHGLQ WKHP Table 2: Pre-defined LCD Screen Number (Default Value) Description Editing Options 3KDVRUV 1RQH 9$53))UHTXHQF\ 7LWOH +DUPRQLFV 7LWOH 6HJPHQWFKHFN 1RQH 2SWLFDO3RUW6HWWLQJV 7LWOH &RPP3RUWV 7LWOH 1H[XV6WDWXV 7LWOH )LUPZDUH9HUVLRQV 7LWOH 1H[XV,QIR 7LWOH 5ROOLQJ%ORFN'HPDQG 7LWOH 728(QHUJ\ 7LWOH 728'HPDQG 7LWOH 7289$5K 7LWOH :KHQ\RXFOLFNEditDIWHUVHOHFWLQJDSUHGHILQHGVFUHHQLQWKH$YDLODEOHVFUHHQV OLVWRUULJKWFOLFNWRVHOHFWCreate a new screen based on selected screen\RX VHHWKH/&'6FUHHQ6HOHFWLRQVFUHHQ6HHWKHH[DPSOHVFUHHQWKDWIROORZV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV 7KHEXWWRQDWWKHWRSRIWKHVFUHHQUHIOHFWVWKHW\SHRIVFUHHQ\RXDUHHGLWLQJRU FRS\LQJHLWKHU3UHGHILQHGRU3UHGHILQHGZLWKFXVWRPODEHOLQJ <RXFDQRQO\FKDQJHWKHVFUHHQQXPEHUIRUDSUHGHILQHGVFUHHQVHHH[DPSOH VFUHHQRQWKHSUHYLRXVSDJHEXWLI\RXDUHFUHDWLQJDQHZVFUHHQEDVHGRQD SUHGHILQHGVFUHHQ\RXFDQVHOHFWWKHSUHGHILQHGZLWKFXVWRPODEHOLQJEXWWRQ WRFKDQJHWKHWLWOHDVZHOODVWKHQXPEHURIWKHVFUHHQ5HIHUWRWKHWDEOHRQWKH SUHYLRXVSDJHIRUHGLWLQJOLPLWDWLRQV )RUDSUHGHILQHGVFUHHQZLWKFXVWRPODEHOLQJ\RXFDQFKDQJHWKHVFUHHQQXP EHUDQGDOVRWKHVFUHHQODEHO6HHWKHH[DPSOHVFUHHQWKDWIROORZV5HIHUWRWKH WDEOHRQWKHSUHYLRXVSDJHIRUHGLWLQJOLPLWDWLRQV NOTES: 7KH6FUHHQQXPEHUILHOGLVDWKUHHGLJLWQXPHULFILHOG8VHQXPEHUV EHWZHHQDQGWRGLVSOD\WKHQXPEHURQWKH/&'GLVSOD\VFUHHQ XVHQXPEHUVEHWZHHQDQGWRQRWGLVSOD\WKHQXPEHURQ WKH/&'GLVSOD\VFUHHQ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV 7KH+DUPRQLFV3KDVRUVDQG/LQH6HJPHQWVFUHHQVQHYHUGLVSOD\ WKHLUQXPEHURQWKH/&'GLVSOD\VFUHHQ 'HSHQGLQJRQWKHSUHGHILQHGVFUHHQ\RXKDYHEHWZHHQOLQHV IRUVFUHHQODEHOHQWU\6FUHHQODEHOVFDQEHXSWRFKDUDFWHUVSHU OLQH %HORZLVDQH[DPSOHRID3UHGHILQHGZLWKFXVWRPODEHOLQJVFUHHQ You can change the screen number You can enter a screen label $IWHU\RXPDNH\RXUHQWULHVFOLFNOK<RXWKHQUHWXUQWRWKHSUHYLRXVVFUHHQ 6FUHHQ$VVLJQPHQWVWDE :KHQ\RXILQLVKSURJUDPPLQJWKH/&'GLVSOD\FOLFN SaveWRVDYHWKH/&'3URJUDPPDEOH6HWWLQJVWRDQGVILOH UploadWRXSORDGWKH/&'3URJUDPPDEOH6HWWLQJVWRWKHFRQQHFWHGPHWHU CancelWRH[LWWKHVFUHHQwithout saving any changes Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV Power and Energy Display Tab &OLFNWKH3RZHUDQG(QHUJ\'LVSOD\WDE<RXZLOOVHHWKHVFUHHQVKRZQEHORZ (QWHUVHWWLQJVIRU3RZHUDQG(QHUJ\ 1XPEHURI'LJLWV3ULPDU\3RZHU 'HFLPDO3RLQW/RFDWLRQ3ULPDU\3RZHU 'LVSOD\/HDGLQJ=HURHVFKHFNLIGHVLUHG (QHUJ\'LVSOD\ D6HOHFWWKH0XOWLSO\E\&RQVWDQWYDOXH E&OLFNWKHFKHFNER[QH[WWR³$SSO\WRWKH'HPDQG5HJLVWHUVDVZHOO´LI DSSOLFDEOH $SUHYLHZDSSHDUVDWWKHERWWRPRIWKHVFUHHQ NOTES: 6HWWLQJVRQWKLVVFUHHQFRQWUROWKHGLVSOD\RI(QHUJ\UHODWHGQXPEHUV%HFDUHIXO WRPDWFKWKHYDOXHVRQWKHGLVSOD\ZLWKWKRVHLQWKHKLVWRULFDOORJV7KHVH VHWWLQJVDSSO\WR9$KRXUV:DWWKRXUV9$5KRXUVDQG9$5KRXUV HDFKTXDGUDQWLQWKHPHWHU Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV 7KH1XPEHURI'LJLWVVHWWLQJFRQWUROVWKHGLVSOD\DQGVWRUDJHRIDOOGLJLWV GLVSOD\HGRQWKHVFUHHQDQGLWVHWVWKH5HJLVWHU5ROORYHUIRUDOO(QHUJ\W\SH UHJLVWHUV Miscellaneous Tab &OLFNWKH0LVFHOODQHRXVWDE<RXZLOOVHHWKHVFUHHQVKRZQEHORZ (QWHUVHWWLQJVLQWKH0LVFHOODQHRXVVFUHHQ D6FUHHQ6HWWLQJV %DFN/LJKW/HYHO2IIWR%ULJKWHVW %DFN/LJKW7LPH%DFN/LJKWVKXWVRIIPLQVHFPLQVHF &RQWUDVW+LJKHVWWR/RZHVW 6FUROO6WRS(QDEOHGRU'LVDEOHG 3KDVRU5RWDWLRQ&ORFNZLVHRU&RXQWHUFORFNZLVH 'HPDQG6KRZQ&XPXODWLYHRU&RQWLQXRXV&XPXODWLYH 7LPHRI8VH'HPDQG%ORFN5ROOLQJRU&XPXODWLYH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV 'DWH)RUPDW0RQWK'D\<HDURU'D\0RQWK<HDU E2SWLFDO3RUWVHWWLQJV %DXG5DWHRU 2SWLFDO5HFHLYH1RQ,QYHUWHGRU,QYHUWHG F8VHU,QDFWLYLW\7LPH2XWVQXPEHURIPLQXWHVVLQFHODVWXVHUDFWLRQZKHQ 0RGHUHYHUWVWR9LHZ0RGH6HWWLQJVDUHWRPLQXWHVZLWKPLQXWH LQWHUYDOV /HDYH7HVW0RGH$IWHUB0LQXWHV /HDYH9LHZ0RGH$IWHUB0LQXWHV /HDYH9LHZ0RGH$IWHUB0LQXWHV When you have finished programming the Device Display Programmable Settings Screen 8VH%XWWRQVDVGHVFULEHGEHORZ Update Display&OLFNWRVHQGWKHQHZVHWWLQJVWRWKHGLVSOD\$IWHUVHWWLQJV KDYHEHHQXSGDWHG9LHZ0RGHLVGLVSOD\HG Retrieve from Display&OLFNWRUHWULHYHH[LVWLQJVHWWLQJV Cancel&OLFNWRUHWXUQWRWKH&RPPXQLFDWRU(;70DLQVFUHHQZLWKRXWXSGDWLQJ RUVDYLQJQHZVHWWLQJV Save&OLFNWRVDYHQHZVHWWLQJVWRDILOH :KHQ\RXILQLVKPDNLQJDQ\FKDQJHVFOLFNUpdate DisplayWRVHQGWKHQHZ VHWWLQJVWRWKHGLVSOD\3RSXSZLQGRZVWHOO\RXWKDWWKHFKDQJHVKDYHEHHQPDGH DQGWKHQ\RXUHWXUQWRWKH&RPPXQLFDWRU(;70DLQVFUHHQ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV 3.6: Using the Base Programmable Display 7KH%DVH3URJUDPPDEOH'LVSOD\SUH1RYHPEHUKDVWKHVDPHWKUHHFRQILJX UDEOH9LHZPRGHVDVWKH'LVSOD\&RQILJXUDWRUDQGWKHWKUHHPRGHVDUHGLVSOD\HGLQ DXWRVHTXHQFHLQWKHVDPHZD\8VLQJ&RPPXQLFDWRU(;7\RXFDQDVVLJQXSWRRI WKHSUHGHILQHGGLVSOD\VFUHHQVWRHDFKPRGHDQ\RIWKHDYDLODEOHVFUHHQVFDQEH XVHGLQDQ\PRGH6HH6HFWLRQIRUDOLVWRIWKHSUHGHILQHGVFUHHQV<RXFDQDOVR DVVLJQDWKUHHGLJLWODEHODQGGHVFULSWLRQWRWKH9LHZPRGHVDQGFRQILJXUHWKHSRZHU DQG(QHUJ\GLVSOD\DQGVFUHHQWLPHRXWVWKHVDPHZD\DVIRUWKH'LVSOD\&RQILJXUD WRU Programming the Base Programmable Display &RQQHFWWRWKHPHWHUWKURXJK&RPPXQLFDWRU(;7 &OLFNWKHProfileLFRQWRRSHQWKH'HYLFH3URILOHVFUHHQ &OLFNWKHSOXVVLJQQH[WWR5HYHQXHDQG(QHUJ\6HWWLQJV 'RXEOHFOLFNDisplay Configuration<RXZLOOVHHWKH0HWHU'LVSOD\0RGH1DPHV VFUHHQ)RUWKLVVFUHHQDQGDOORIWKHVFUHHQVLQWKH'HYLFH'LVSOD\3URJUDPPDEOH 6HWWLQJVexcept forWKH6FUHHQ$VVLJQPHQWVVFUHHQIROORZWKHGLUHFWLRQVJLYHQLQ 6HFWLRQ)RUWKH6FUHHQ$VVLJQPHQWVVFUHHQIROORZWKHGLUHFWLRQVJLYHQKHUH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV &OLFNWKH6FUHHQ$VVLJQPHQWVWDE<RXZLOOVHHWKHVFUHHQVKRZQEHORZ <RXU/DEHOIRUHDFKPRGHDSSHDUVDWWKHWRSRIHDFKFROXPQ(QWHUXSWR VFUHHQVIRUHDFK9LHZPRGHLQWKH IROORZLQJZD\ D'RXEOHFOLFNRQRQHRIWKHVHW WLQJVRQWKHVFUHHQ<RXZLOOVHHWKH VFUHHQVKRZQRQWKHULJKW E6HOHFW*URXSDQG,WHPIURPWKH SXOOGRZQPHQXVDQGFOLFNOKWR UHWXUQWRWKH6FUHHQ$VVLJQPHQWV VFUHHQ NOTE:,I\RXVHOHFW7LPHRI8VHDV WKH*URXSWKHVFUHHQFKDQJHVWR DOORZDQ,WHPVHOHFWLRQDQGDGGL WLRQDOVHOHFWLRQVIRU7283HULRG DQG7285HJLVWHU6HHWKHVFUHHQ RQWKHULJKW Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV 3.6.1: Pre-Defined Display Screens 7KH1H[XVSUHGHILQHGGLVSOD\VFUHHQVKDYHIHDWXUHVWKDWPDNHWKHPYHU\XVHU IULHQGO\ 0DQ\RIWKHVFUHHQVKDYHODUJHGLJLWV´ 7KHUHDUHPDQ\VFUHHQVWRFKRRVHIURP 7KH3ROOLQJ,QGLFDWRULQWKHULJKWFRUQHURIWKH6WDWXV/LQHSURYLGHVWZRIXQFWLRQV $EOLQNLQJLQGLFDWRUVKRZVWKDWWKHGLVSOD\LVUHFHLYLQJGDWDIURPWKHPHWHU 3RZHU)ORZLVGLVSOD\HGE\GLIIHUHQWVKDSHGLFRQV D:KHQQRSRZHULVIORZLQJDVROLGEORFNLVGLVSOD\HG E$QDQLPDWHGDUURZSRLQWLQJ5,*+7LQGLFDWHVSRVLWLYHSRZHUIORZ F$QDQLPDWHGDUURZSRLQWLQJ/()7LQGLFDWHVQHJDWLYHSRZHUIORZ %HORZLVDOLVWRIDYDLODEOHVFUHHQVZLWKVRPHH[DPSOHILJXUHV Screen Number Screen Name :K'HOLYHUHG :K5HFHLYHG 9$5K 9$5K 9$K 5ROOLQJ:'HPDQG'HO 5ROOLQJ:'HPDQG5HF %ORFN:'HPDQG'HO %ORFN:'HPDQG5HF :'HPDQG/DVW5HVHW 3KDVHWR1HXWUDO9ROWDJH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions kWh DEL 43089263 REC 71323159 06/16/2011 3:50:44 Norm ABC 'RF# ROLLING W DEMAND DEL 502.3 3:07:2003 2:07:09 06/16/2011 3:50:44 Norm ABC ( 2SHUDWLQJ,QVWUXFWLRQV 3KDVH&XUUHQW 3KDVRUV 9$53))UHTXHQF\ 9D9DE+DUPRQLFV 9E9EF+DUPRQLFV 9F9FD+DUPRQLFV ,D+DUPRQLFV ,E+DUPRQLFV ,F+DUPRQLFV 7RWDOL]HU 7RWDOL]HU 7RWDOL]HU 7RWDOL]HU 7RWDOL]HU'HPDQG 7RWDOL]HU'HPDQG 7RWDOL]HU'HPDQG 7RWDOL]HU'HPDQG &XPXODWLYH'HPDQG'HO5HF 3KDVHWR3KDVH9ROWDJH : 9$5 3) 9$ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions la HARMONICS THD 003.67 06/18/2011 12:22:44 CDM ABC VC IC IB 'RF# A VA B ( C VB IA 30.02 LG 16.03 LG 17.01 LG ABC 2SHUDWLQJ,QVWUXFWLRQV )UHTXHQF\ 6HJPHQW&KHFN 4 0HWHU1DPH 2SWLFDO3RUW &RP3RUW6HWWLQJV 1H[XV6WDWXV )LUPZDUH9HUVLRQV 1H[XV,QIR $YHUDJH3)5HFHLYHG $YHUDJH3)'HOLYHUHG 9$5KSHU4XDGUDQW 9$KSHU4XDGUDQW :KSHU4XDGUDQW 4K &XPXODWLYH'HPDQG 5ROOLQJ:LQGRZ'HPDQG %ORFN:LQGRZ'HPDQG 3RZHU)DFWRUSHU3KDVH 3RZHU)DFWRUSHU4XDGUDQW 728:K5HF 7289$K4 7289$5K4 Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV 7289$K4 7289$5K4 728:K'HO 7289$K4 7289$5K4 7289$K4 7289$5K4 728:'HPDQG5HF 728:'HPDQG'HO 7289$5'HPDQG 7289$5'HPDQG Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 2SHUDWLQJ,QVWUXFWLRQV 7KLVSDJHLQWHQWLRQDOO\OHIWEODQN Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 4: Performing Meter Testing 4: Performing Meter Testing The information contained within this chapter is intended to be an aid to qualified metering personnel. It is not intended to replace the extensive training necessary to install or remove meters from service. Any work on or near energized meters, meter sockets or other metering equipment presents the danger of electrical shock, personal injury or death. All work on these products must be performed by qualified industrial electricians and metering specialists ONLY. All work must be done in accordance with local utility safety practices and/or the procedures outlined in the current edition of the Handbook for Electricity Metering. The handbook is available from the Edison Electric Institute, 701 Pennsylvania Avenue N.W., Washington D.C. 20004-2696. Les informations contenues dans ce chapitre sont destinées à assister au personnel de relevé qualifié. Il n'est pas destiné à remplacer la formation approfondie nécessaire pour installer ou retirer les compteurs de leur fonction. Toute intervention sur ou à proximité de compteurs sous tension, socles de compteur ou autres équipements de mesure présente un risque de choc électrique, de blessures ou la mort. Toute intervention avec ces produits doit être effectuée UNIQUEMENT par des électriciens industriels qualifiés et des spécialistes de relevé. Toute intervention doit être faite en conformité avec les pratiques de sécurité des services publics locaux et/ou les procédures décrites dans la présente édition du Manuel de relevé d'électricité. Le manuel est disponible à partir de la Edison Electric Institute, 701 Pennsylvania Avenue NW, Washington DC 20004-2696. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 4-1 4: Performing Meter Testing 4.1: Testing Tools The Nexus® 1262 and 1272 meters are equipped with a light-emitting diode (LED) for calibration and a liquid crystal display with test screens. These two standard features provide user interface and equipment interface points for meter testing. Infrared Test Pulse Test Button Under Cover Figure 4.1: Meter Test Pulse and Test Button Location 4.1.1: Test Pulse LED The Test Pulse LED is located in the upper left-hand portion of the meter face as shown in Figure 4.1. The Test Pulse LED continuously emits calibration pulses (infrared light). This LED can be used for a variety of pulses including individual quadrants for Watt-hour, VA-hour, VAR-hour and Watt Demand pulses. Each calibration pulse is equal to the value assigned to Kt (Watt-hours per pulse) in the meter’s Device Profile. The millisecond duration of each output pulse is also programmable in the meter’s Device Profile. To program the Test Pulse LED: 1. From the Device Profile menu in Communicator EXT, click Revenue and Energy Settings>Internal KYZ to configure the following settings: Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 4-2 4: Performing Meter Testing a. Assigned Channel - choose from settings. b. Watt-hour per Pulse - enter the value in the secondary. c. Pulse Width - set from 5ms to 635ms. d. Mode - select to enable or disable. e. Form - select between Form A and Form C. 2. Click OK and then click Update Device to send the new settings to the meter. NOTE: The unit for the calibration pulses is Watt-hours. The initial value of each pulse (Kt) is 1.800 secondary Watt-hours per pulse. 4.1.2: LCD Display In Test Mode, the LCD display provides user access to accumulated real, reactive and apparent energy as well as Block Demand for real power. There are eight screens in Test Mode: Wh - Del, Wh - Rec, VARh - Q1 & Q2, VARh - Q3 & Q4, VAh - Q1 & Q4, VAh - Q2 & Q3, Watt Demand Test Rolling and Watt Demand Test Block. See Section 4.2.2 for more detail. The LCD display also includes three phase Voltage indicators. These indicators are labeled A, B and C to represent the presence of Voltage on the labeled phase. If Voltage is not present on one phase, its indicator is not displayed. These indicators also show whether current is flowing on the phase. If no current is flowing on a phase, the indicator blinks; when current is flowing, the indicator shows a continuously illuminated digit. The indicator also shows phase sequence. 4.2: Test Mode Test Mode allows the meter to be tested without disturbing billing data or setting a new maximum Demand. Test Mode performs the same function as setting the pointers back on an electromechanical meter after testing. While operating in Test Mode, the meter uses the same measurement and calculation processes that are used in Normal Mode. The only difference is that the billing numbers stored in the meter are not updated with the real-time reading. This preserves the billing numbers while testing is performed. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 4-3 4: Performing Meter Testing 4.2.1: Entering Test Mode To enter Test Mode, you must bypass the meter’s security system. In most instances, this requires you to remove power from the meter, break the meter seal and remove the Lexan cover, and then repower the meter. 4.2.2: Using Test Mode The same selected measurement profile quantities (data accumulations) that are calculated during normal operation are calculated in Test Mode. Display quantities (Watt-hour, VAR-hour, Volt-Ampere-hour and Block Demand quantities) are displayed in units rather than kilo-units; i.e. the data is displayed as Wh, VARh, VAh and Watts rather than kWh, kVARh, kVAh and kW. The same Demand values calculated during normal operation are also calculated in Test Mode. The display formats in Test Mode are changed to provide greater resolution during test operations. The display does not scroll while in Test Mode. Each item remains displayed until the Test Button is pressed, which causes the next Test Mode screen to display. The following table shows the display screens available in Test Mode, the data displayed on each screen and the pulse source for each screen. Table 1: Test Mode Displayed Data and Pulse Source Test Mode Displayed Data Pulse Source Wh - Del Delivered Wh Energy kWh, Del Wh - Rec Received Wh Energy kWh, Rec VARh - Q1 and Q2 VARh in Quadrant1 VARh in Quadrant 2 kVARhr, Del VARh - Q 3 and Q4 VARh in Quadrant 3 VARh in Quadrant 4 kVARhr, Rec VAh - Q1 and Q4 VAh in Quadrant 1 VAh in Quadrant 4 kVAhr, Q1 VAh - Q2 and Q3 VAh in Quadrant 2 VAh in Quadrant 3 kVAhr, Q3 Watt Demand Rolling Watt Rolling Demand Delivered kWH, Del Watt Demand Watt Block Demand Delivered kWh, Del Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 4-4 4: Performing Meter Testing Test Mode Details The Reset Button (R) is next to the Test Button (T). Initiate a Test Mode Reset by pressing and releasing the Reset Button while in Test Mode. A Test Mode Reset causes all test quantities to be reset to zero and a new block interval to be started. The item displayed when the reset occurred remains in the display but the value is initialized. While in Test Mode, the Test Pulse LED pulses at the rate programmed for the meter. The value of the pulse is set in the meter’s Device Profile (see Section 4.1.1). The meter quantity assigned to the Test Pulse LED changes as the user moves from one test screen to another. The assigned values are defined in the Pulse Source column of the table above. Individual quadrant tests for VAR-hours can be completed by proper test design. To test strictly VAR-hours, limit the test parameters to one quadrant during testing. In the event of a power outage, data for Test Mode Energy, Demand and Power Factor is not saved. Upon power up, the meter returns to Normal Mode. The test data is lost and all registers are restored to their pretest values. While in Test Mode, the IR Port and Communications Port 1 are available for communication with the meter. In Test Mode, you can preset the values of the energy readings that will be restored to the meter when Test Mode is exited, using Communicator EXT (see following section 4.2.3). 4.2.3: Test Mode Preset Accumulators There are two reasons to use the Preset Accumulators screens: 1. A monitor in Test Mode is out of service and is therefore not monitoring accumulations. The New Value field can be used to adjust for the values not monitored while in Test Mode. 2. When replacing an old meter that has accumulations with a new meter that has no accumulations, the New Value field can be set to the value of the existing accumulations. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 4-5 4: Performing Meter Testing Setting Test Mode Preset Accumulators 1. From Communicator EXT’s Main screen, select Tools>Test Mode>Preset Accumulators. You will see the screen shown below. 2. Click Tabs at the top of the screens to access the individual screens. • Each screen has a Current Value, New Value and Preset Box for each accumulator. • A new meter has zeros for Current Values. 3. Settings can be preset for the following sets of values: • Primary Energy • Secondary Energy • Primary Energy (Quadrants) • Secondary Energy (Quadrants) • Internal Input Accumulators • KYZ Output Accumulators Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 4-6 4: Performing Meter Testing • Q Hours • I & V Squared T Accumulators • Cumulative Demand (Secondary) • Uncompensated Energy Examples of some of the screens are shown below. 4. Click the Preset Boxes for the values you want to set. 5. Click Set to save your entries or Cancel to exit the screen without saving any changes. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 4-7 4: Performing Meter Testing 4.2.4: Exiting Test Mode Exit Test Mode in one of the following three ways: • Press and hold the Test Button for more than 3 seconds. • Use the Test Mode Time-out Timer, if no load is present. • Use the Extended Test Mode Time-out Timer, if load is present. These options are explained further in the following sections. Exiting Test Mode Details: Test Mode Button Pressing the Test Mode Button for more than three seconds ends Test Mode and returns the meter to Normal Mode. Test Mode Time-out Timer The Test Mode Time-out Timer has two modes of operation, depending on whether the meter sees measurable load. If the meter does not recognize measurable load: The meter watches for user interaction by monitoring activity on the Test Button and the Reset Button. If neither button is pushed within the programmed Exit Delay time, the meter exits Test Mode and returns to Normal Mode. Each time the Test or Reset Button is pressed, the meter starts the Exit Delay Timer again. The Exit Delay time is programmed in the meter’s Device Profile in the Device Display Programmable Settings screen, Miscellaneous tab (see Section 3.6). If the Meter recognizes measurable load: The meter watches the Test and Reset Buttons for activity, using an extended time limit consisting of the Exit Delay time plus the programmed Block Interval Time. This insures that the meter completes a full block Demand test without interruption. After exiting Test Mode: All Test Mode data is lost when you exit Test Mode. Upon exiting Test Mode, a new (possibly partial) Demand interval and subinterval begin. The past subinterval as well Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 4-8 4: Performing Meter Testing as the current subinterval are zeroed. Upon returning to Normal operating mode, a TOU meter or Demand meter with load profiling completes the time remaining in the current partial subinterval so that subsequent subintervals are synchronized with the hourly boundary. Maximum Demand values for each Demand integration type are not modified while in Test Mode. The previously recorded maximums are restored when you exit Test Mode. If you choose to reset Demand data during testing operations, you can complete this action when you exit Test Mode by pressing the Reset Button after the meter returns to Normal Mode. NOTE: Normal billing and historical log data accumulation is suspended during Test Mode operation. Upon exiting Test Mode, accumulation of billing and historical log quantities does either of the following: • Resumes from the values in place when Test Mode was entered • Continues from the Test Mode Preset values (see Section 4.2.4) Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 4-9 4: Performing Meter Testing This page intentionally left blank. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 4 - 10 6HULDO&RPPXQLFDWLRQ:LULQJ 5: Serial Communication Wiring 5.1: Communication Overview 7KHILJXUHEHORZVKRZVVHULDOFRPPXQLFDWLRQRSWLRQV Optical Port to RS232 Communication Interface (e.g., A7Z) -ETER Optical Port RS232 50 Feet -ETER RS485 RS232 4000 Feet 50 Feet RS485/232 Converter (Unicom 2500) -ETER RS485 RS232 4000 Feet 50 Feet 4ELEPHONE,INE &IBER/PTIC,INKOR 2ADIO,INK RS485/232 Converter (Modem Manager) )LJXUH6HULDO&RPPXQLFDWLRQ 56FRPPXQLFDWLRQLVXVHGWRFRQQHFWDVLQJOH1H[XVPHWHUZLWK DQRWKHUGHYLFHVXFKDVDFRPSXWHU578RU3/&7KHOLQNLVYLDEOHIRUXSWRIHHW PDQGLVDYDLODEOHRQO\WKURXJKWKHPHWHU¶V2SWLFDOSRUWZLWKDFRPPXQLFDWLRQ LQWHUIDFH2SWLFDOSRUWWR56FRQYHUWHUVHHILJXUHVDQG 56FRPPXQLFDWLRQDOORZVPXOWLSOHPHWHUVWRFRPPXQLFDWHZLWKDQRWKHUGHYLFHDW DORFDORUUHPRWHVLWH7KH,2PRGXOHVDQGH[WHUQDOGLVSOD\VXVH56WRFRPPXQL FDWHZLWKWKHPHWHU$OO56OLQNVDUHYLDEOHIRUXSWRIHHWP7KH 1H[XV6RFNHWPHWHU¶V3RUWVDQGDUHWZRZLUH56FRQQHFWLRQVXSWR EDXG2SWLRQDO&RPPXQLFDWLRQ&RQQHFWLRQVIRU,13,QWHUQDO0RGHPZLWK'LDO,Q 'LDO2XW,13%DVH7FRQQHFWLRQRU,13&RPELQDWLRQ0RGHPDQG (WKHUQHWDUHFDEOHVZLWKDSSURSULDWHFRQQHFWRUVVHH&KDSWHUDQG)LJXUH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ Optical Port )LJXUH2SWLFDO3RUW/RFDWLRQ 5.2: Communicating to the Meter through the ANSI Type II Optical Port 7KH2SWLFDOSRUWDOORZVWKH1H[XVPHWHUWRFRPPXQLFDWHZLWKRQHRWKHU GHYLFHHJD3&/RFDWHGRQWKHOHIWVLGHRIWKHPHWHU VIDFHLWSURYLGHVFRPPXQLFD WLRQZLWKWKHPHWHUWKURXJKDQ$16,&7\SH,,0DJQHWLF2SWLFDO&RPPXQL FDWLRQV&RXSOHUVXFKDVHLWKHU $Q$=&RPPXQLFDWLRQ,QWHUIDFHFRQQHFWHGWRWKH56SRUWRIWKH3& $Q$8&RPPXQLFDWLRQ,QWHUIDFHFRQQHFWHGWRWKH86%SRUWRIWKH3& <RXFDQRUGHUWKH$=RU$8IURP(,*¶VZHEVWRUHZZZHOHFWURLQGFRPVWRUH6HOHFW WKH&RPPXQLFDWLRQV3URGXFWVFDWHJRU\IURPWKHOHIWVLGHRIWKHZHESDJH 6HH)LJXUH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ )LJXUH$=7RSDQG$8%RWWRP&RPPXQLFDWLRQ,QWHUIDFHV A7Z Instructions: 2QHHQGRIWKHPDJQHWLFLQWHUIDFHVLPSO\VQDSVRQWRWKHRSWLFDOSRUWWKHPDJQHW NHHSVLWLQSODFH7KHRWKHUHQGLVDQ56FRQQHFWLRQ,QVHUWWKDWHQGLQWRDSLQ VHULDOSRUWRQDFRPSXWHURURWKHUGHYLFH7KH$=UHTXLUHVQRSRZHUVXSSO\$OO SRZHULVUHFHLYHGIURPWKHKRVWFRPSXWHUVHULDOSRUWXVLQJWUDQVPLWWHUDQGUHFHLYHU Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ FLUFXLWVZLWKLQWKHSUREH7KH56VWDQGDUGOLPLWVWKHFDEOHOHQJWKWRIHHW P A9U Instructions: <RXQHHGWRGRZQORDGDQGLQVWDOOWKHGULYHUIRUWKH$8IURP(,*¶VZHEVLWH ZZZHOHFWURLQGFRP$=B$8KWPO2QFHWKHGULYHULVLQVWDOOHGDWWDFKWKH$8¶V PDJQHWLFLQWHUIDFHRQWRWKHPHWHU¶V2SWLFDOSRUWDQGDWWDFKWKH$8¶V86%FRQQHFWLRQ LQWR\RXU3& Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ 5.3: RS485 Serial Communication 56FRPPXQLFDWLRQDOORZVPXOWLSOHGHYLFHVWRFRPPXQLFDWHRQDEXV7KHPHWHU¶V 3RUWDQG3RUWDUH56WHUPLQDOVYLDEOHIRUDGLVWDQFHRIXSWRIHHW PHWHUV 5.3.1: RS485 Wiring Fundamentals - (Port 1 and Port 4) %HORZLVDGHWDLOHGYLHZRIDZLUH56FRQQHFWLRQ From other RS485 device Connect : • (−) to (−) • (+) to (+) • Shield(SH) to Shield(SH) - - + SH + SH Nexus 1262/1272 RS485 Port )LJXUH56&RQQHFWLRQ'HWDLO S6KLHOG7KLVLVQRWDQHDUWKJURXQGFRQQHFWLRQ<RXPXVWDOVRFRQQHFWWKH VKLHOGWRHDUWKJURXQGDWRQHSRLQW'RQRWFRQQHFWWKHVKLHOGWRJURXQGDWPXOWLSOH SRLQWVLWZLOOLQWHUIHUHZLWKFRPPXQLFDWLRQ +/- 7ZRZLUH56FRPPXQLFDWLRQWHUPLQDOV&RQQHFWWKHWHUPLQDORIWKH PHWHUSRUWWRWKHWHUPLQDORIWKHGHYLFH&RQQHFWWKHWHUPLQDORIWKHPHWHUSRUW WRWKHWHUPLQDORIWKHGHYLFH NOTES on RS485 Connections: 8VHDVKLHOGHGWZLVWHGSDLUFDEOH$:*PPRUODUJHUJURXQGLQJWKH VKLHOGDWRQHHQGRQO\ (VWDEOLVKSRLQWWRSRLQWFRQILJXUDWLRQVIRUHDFKGHYLFHRQD56EXV&RQQHFW WHUPLQDOVWRWHUPLQDOVFRQQHFWWHUPLQDOVWRWHUPLQDOV 3URWHFWFDEOHVIURPVRXUFHVRIHOHFWULFDOQRLVH $YRLGERWK³VWDU´DQG³WHH´FRQQHFWLRQVVHH)LJXUH 1RPRUHWKDQWZRFDEOHVVKRXOGEHFRQQHFWHGDWDQ\RQHSRLQWRQDQ56 QHWZRUNZKHWKHUWKHFRQQHFWLRQVDUHIRUGHYLFHVFRQYHUWHUVRUWHUPLQDOVWULSV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ ,QFOXGHDOOVHJPHQWVZKHQFDOFXODWLQJWKHWRWDOFDEOHOHQJWKRIDQHWZRUN,I\RXDUH QRWXVLQJDQ56UHSHDWHUWKHPD[LPXPOHQJWKIRUFDEOHFRQQHFWLQJDOOGHYLFHV LVIHHWPHWHUV )RUDQ56'DLV\&KDLQFRQQHFWLRQLQZKLFK\RXOLQNPXOWLSOHGHYLFHVLQDVHULHV FRQQHFWVKLHOGWR560DVWHUDQGLQGLYLGXDOGHYLFHVDVVKRZQLQ)LJXUH<RX PD\DOVRFRQQHFWWKHVKLHOGWRHDUWKJURXQGDWRQHSRLQW 7KH1H[XVPHWHUPD\EHVKLSSHGZLWKFRQQHFWRUVRQWKHHQGVRI FDEOHVRUWKH\PD\EHVKLSSHGDVSLJWDLOVQRFRQQHFWRUV,QWKLVFDVHDJHQHULF WHUPLQDOEORFNLVVKLSSHGZLWKWKHPHWHU7KHWHUPLQDOEORFNKDVXSWRFRQQHF WRUVDQGFDQEHFXWLQWRVPDOOHUVHFWLRQVZLWKDXWLOLW\NQLIH3OHDVHUHIHUWRWKH &DEOH&RORU.H\RQSDJHVWRLI\RXDUHXVLQJSLJWDLOVRULI\RXKDYHDQ\ TXHVWLRQDERXWZKLFKFRQQHFWRULVZKLFK 7HUPLQDWLRQ5HVLVWRUV57DUHJHQHUDOO\XVHGRQERWKHQGVRIORQJHUOHQJWKWUDQV PLVVLRQOLQHV7KHYDOXHRIWKH7HUPLQDWLRQ5HVLVWRUVLVGHWHUPLQHGE\WKHHOHFWULFDO SDUDPHWHUVRIWKHFDEOH7HUPLQDWLRQ5HVLVWRUVDUHRQO\QHHGHGZLWKUXQVW\SLFDOO\ PRUHWKDQIHHWDVWKHPHWHUKDVVRPHOHYHORIWHUPLQDWLRQLQWHUQDOO\DQGXVX DOO\UHVLVWRUVDUHQRWQHHGHG )RULQIRUPDWLRQRQFRQQHFWLQJWKHPHWHUWRDPRGHPVHH6HFWLRQ )LJXUHVKRZVDUHSUHVHQWDWLRQRIDQ56'DLV\&KDLQFRQQHFWLRQ<RXFDQ FRQQHFWXSWRVODYHVLQD'DLV\&KDLQ Master device Last Slave device N RT SH + RT - Slave device 1 Slave device 2 SH SH + - Twisted pair, shielded (SH) cable + - Twisted pair, shielded (SH) cable SH + - Twisted pair, shielded (SH) cable Earth Connection, preferably at single location )LJXUH56'DLV\&KDLQ&RQQHFWLRQ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ Slave device 1 SH + - Long stub results “T” connection that can cause interference problem! Master device Last Slave device N RT RT Slave device 2 SH + - SH Twisted pair, shielded (SH) cable + - SH Twisted pair, shielded (SH) cable + - Twisted pair, shielded (SH) cable Earth Connection, preferably at single location Twisted pair, shielded (SH) cable Twisted pair, shielded (SH) cable Slave device 1 Slave device 2 SH + - - Master device SH + SH + - + SH “STAR” connection can cause interference problem! - SH + - Slave device 3 Slave device 4 Twisted pair, shielded (SH) cable Twisted pair, shielded (SH) cable )LJXUH,QFRUUHFW³7¶DQG³6WDU´7RSRORJLHV 5.3.2: Using the Unicom 2500 7KH8QLFRPSURYLGHV5656FRQYHUVLRQ,QGRLQJVRLWDOORZVWKH 1H[XVPHWHUWRFRPPXQLFDWHZLWKD3&RURWKHUGHYLFH6HHWKHUnicom 2500 Installation and Operation ManualIRUDGGLWLRQDOLQIRUPDWLRQ<RXFDQRUGHUWKH 8QLFRPIURP(,*¶VZHEVWRUHZZZHOHFWURLQGFRPVWRUH6HOHFWWKH&RPPXQL FDWLRQV3URGXFWVFDWHJRU\IURPWKHOHIWVLGHRIWKHZHESDJH )LJXUHLOOXVWUDWHVWKH8QLFRPFRQQHFWLRQVIRU56 Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ RS232 Port PC UNICOM 2500 TX(-) RX(-) TX(+) RX(+) SH Jumpers: Short TX(-) to RX(-) becomes (-) signal Short TX(+) to RX(+) becomes (+) signal SH SH (+) (+) Meter’s RS485 Port (-) (-) )LJXUH0HWHU&RQQHFWHGWRD3&8VLQJ8QLFRP 7KH8QLFRPFDQEHFRQILJXUHGIRUHLWKHU ZLUHRUZLUH56FRQQHFWLRQV6LQFHWKH 1H[XVPHWHUXVHVDZLUHFRQQHFWLRQ\RX 6HWVZLWFK 6HWWKH WR'&( %DXGUDWH QHHGWRDGGMXPSHUZLUHVWRFRQYHUWWKH8QLFRP % $# WRWKHZLUHFRQILJXUDWLRQ $4 % K 5$ "! $VVKRZQLQ)LJXUH\RXFRQQHFWWKH5; V K ($ K &$ K DQG7;WHUPLQDOVZLWKDMXPSHUZLUHWRPDNH WKHWHUPLQDODQGFRQQHFWWKH5;DQG 7;WHUPLQDOVZLWKDMXPSHUZLUHWRPDNHWKH WHUPLQDO6HHWKHILJXUHRQWKHULJKWIRUWKH 6HWVZLWFK WR)' 8QLFRP¶VVHWWLQJV7KH8QLFRP¶V%DXGUDWH PXVWPDWFKWKH%DXGUDWHRIWKHPHWHU¶V56SRUW\RXVHWWKH%DXGUDWHE\WXUQ LQJWKHVFUHZWRSRLQWDWWKHUDWH\RXZDQW Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ 5.3.3: RJ11 (Telephone Line) Connection—Meter with INP2 (Internal Modem with Dial In/Dial Out) Option 8VH5-6WDQGDUG7HOHSKRQH/LQHWRFRQQHFWZLWKWKHPHWHU7KH5-OLQHLV FRQQHFWHGWR&DEOHIURPWKHEDFNRIDPHWHUZLWKWKH,QWHUQDO0RGHP2SWLRQ7KH 5-FRQQHFWRULVVXSSOLHGZLWKWKHPHWHU 7KHOHQJWKRIWKHFRQQHFWLRQXVLQJ5-LQWRWKHPHWHULVYLUWXDOO\XQOLPLWHG7R FRQQHFWZLWKRWKHUPHWHUVLQHLWKHUORFDORUUHPRWHORFDWLRQV\RX0867XVH&DEOH )RUPRUHLQIRUPDWLRQRQWKHPHWHUZLWKWKH,132SWLRQVHH6HFWLRQ 5.3.4: RJ45 Connection—Meter with INP200 (10/100BaseT) Option 7KH,132SWLRQFRQIRUPVWRWKH,(((%DVH7VSHFLILFDWLRQXVLQJ XQVKLHOGHGWZLVWHGSDLU873ZLULQJ7KLVDOORZV\RXWRXVHLQH[SHQVLYH5- FRQQHFWRUVDQG&$7RUEHWWHUFDEOLQJ7KH5-FRQQHFWRULVVXSSOLHGZLWKWKHPHWHU &DEOH 8VLQJWKLV/$1FRQQHFWLRQDOORZVPXOWLSOH3&¶VWRDFFHVVWKHPHWHUFRQFXUUHQWO\7KH 5-OLQHLVLQVHUWHGLQWRWKH5-FRQQHFWRURQ&DEOHFRPLQJIURPWKHERWWRPRID PHWHUZLWKWKH(WKHUQHW2SWLRQ7KHFRQQHFWLRQXVLQJ5-LQWRWKHPHWHUFRQQHFWV WKHPHWHUWRDQHWZRUNXVLQJ0RGEXV7&3SURWRFRORYHU(WKHUQHW )RUPRUHLQIRUPDWLRQRQDPHWHUZLWKWKH,132QERDUG(WKHUQHW%DVH7 VHH6HFWLRQ 5.3.5: Modem/Ethernet Connection—Meter with INP202 (Combo Card) Option 7KH,13LVDQH[WHQVLRQRI,13,WKDVDOOWKHIHDWXUHVRI,13SOXVDEXLOWLQ 0RGHP0RGHPDQG(WKHUQHWFDSDELOLWLHVFDQEHXVHGVLPXOWDQHRXVO\ 7KHFRPPXQLFDWLRQSURWRFROVXSSRUWHGE\WKHPRGHPLV0RGEXV$6&,,7KH &RPPXQLFDWLRQSURWRFROVXSSRUWHGE\WKH56(WKHUQHW0RGHP*DWHZD\LV0RGEXV 578,13FRQYHUWVDOOLQFRPLQJPRGHP0RGEXV$6&,,UHTXHVWVWR0RGEXV578IRU LQWHUQDODQGJDWHZD\FRPPXQLFDWLRQ,WWKHQFRQYHUWVDOOUHVSRQVH0RGEXV578 PHVVDJHVLQWR0RGEXV$6&,,SURWRFROEHIRUHLWVHQGVWKHUHVSRQVHVWRWKHPRGHP 6RPHRIWKHIL[HGSDUDPHWHUVIRUWKH(WKHUQHW0RGHP*DWHZD\DUH'DWD%LWV(YHQ 3DULW\6WRS%LW7KH(WKHUQHW0RGHP¶V*DWHZD\¶V%DXG5DWHDQG'HOD\7LPHDUH FRQILJXUDEOH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ )RUPRUHLQIRUPDWLRQRQDPHWHUZLWKWKH,130RGHP(WKHUQHW&RPER&DUGVHH 6HFWLRQ 5.3.6: RS485 Connection - Meter to the P40N/P40N+/P41N+/P43N+ LED Display &RQQHFWWKHFRPPXQLFDWLRQZLUHVRIWKHVXSSOLHG56FDEOHWRWKHPHWHU¶V3RUWRU 3RUW6HWWKHSRUW¶V%DXG5DWHWR$GGUHVVWR3URWRFROWR0RGEXV578DQG 0RGHWR6ODYHXVLQJWKHFRPPXQLFDWLRQVRIWZDUH,QVHUWWKHRWKHUHQGRIWKH FRPPXQLFDWLRQZLUHVLQWRWKHEDFNRIWKHILUVW/(''LVSOD\ 7KH1H[XVPHWHU¶VSRZHUVXSSO\GRHVQRWVXSSO\SRZHUWRH[WHUQDO GLVSOD\V<RXPXVWXVHDSRZHUVRXUFHVXFKDVWKH(,*3%96HH6HFWLRQ IRU36,2GHWDLOV 56FRPPXQLFDWLRQLVYLDEOHIRUXSWRIHHWPHWHUV%HVXUHWRGRWKH IROORZLQJ &RQQHFWWKHVKLHOGWRWKHVKLHOG6WHUPLQDORQWKH'LVSOD\SRUW7KH6WHUPLQDO RQWKHPHWHULVXVHGWRUHIHUHQFHWKHPHWHU¶VSRUWWRWKHVDPHSRWHQWLDODVWKH VRXUFH,WLVQRWDQHDUWKJURXQGFRQQHFWLRQ<RXPD\DOVRFRQQHFWWKHVKLHOGWR HDUWKJURXQGDWRQHSRLQW 3URYLGHWHUPLQDWLRQUHVLVWRUVDWHDFKHQGIRUORQJHUUXQVW\SLFDOO\¶RUPRUH FRQQHFWHGWRWKHDQGOLQHV57LVDSSUR[LPDWHO\2KPV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ NOTE:7KH31DQGOHJDF\31FRQQHFWWKHVDPHZD\WKURXJKWKHSRUWRQWKH EDFNRIWKHGLVSOD\7KHRQO\GLIIHUHQFHLVLQWKHSRUWODEHOLQJ + - S - V+ + V RS-485 - SH - + RT * + External Power Source PB1 or other P40N+ LED Display, Back View V+ V S B (-) A (+) RT * * See RT Note on page 5-5. ** P40N LED Display, Back View S + - **Please refer to Cable Color Key, page 6-4, and second bullet, page 5-5. 1262/1272 Port 4 )LJXUH31DQG/HJDF\31([WHUQDO'LVSOD\56&RQQHFWLRQ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ 5.3.7: Communication Ports on the I/O Modules Female RS485 Side Port I/O Port (Size and Pin Configuration Vary) Male RS485 Side Port )LJXUH,20RGXOH&RPPXQLFDWLRQ3RUWV Female RS485 Side PortXVHWRFRQQHFWWRDQRWKHUPRGXOH¶VPDOH56VLGHSRUW Male RS485 Side PortXVHWRFRQQHFWWRWKHPHWHU¶V3RUWVHHIROORZLQJVHFWLRQ RUWRFRQQHFWWRDQRWKHUPRGXOH¶VIHPDOH56VLGHSRUWVHH6HFWLRQ I/O PortXVHIRUIXQFWLRQVVSHFLILFWRWKHW\SHRIPRGXOHVL]HDQGSLQFRQILJXUDWLRQ YDULHVGHSHQGLQJRQW\SHRIPRGXOH)RUPRUHGHWDLOUHIHUWR&KDSWHU 5.3.8: RS485 Connection—Meter to I/O Modules $Q56FDEOHKDUQHVVLVVXSSOLHGZLWKWKHSXUFKDVHRI0%,2PRXQWLQJEUDFNHWV :LUHRQHHQGRIWKHFDEOHWRWKHPHWHU¶V3RUW ,QVHUWWKHRWKHUHQGRIWKHFDEOHLQWRWKHFRPPXQLFDWLRQSLQVRIWKH,2PRGXOH¶V PDOH56VLGHSRUWVHH)LJXUH6HH6HFWLRQIRUGHWDLOVRQXVLQJ PXOWLSOH,2PRGXOHV 7KH1H[XVPHWHU¶VSRZHUVXSSO\GRHVQRWVXSSO\SRZHUWRWKH,2 PRGXOHV<RXPXVWXVHDSRZHUVRXUFHVXFKDVWKH(,*36,2RU3%96HH 6HFWLRQIRU36,2GHWDLOV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ 56FRPPXQLFDWLRQLVYLDEOHIRUXSWRIHHWPHWHUV)ROORZWKHZLULQJ VKRZQLQ)LJXUHDQGEHVXUHWR &RQQHFWWKHDQGWHUPLQDOVRQWKHPHWHUWRWKHDQGWHUPLQDOVRIWKHIHPDOH 56SRUW&RQQHFWWKHVKLHOGWRWKHVKLHOG6WHUPLQDO7KH6WHUPLQDORQWKH PHWHULVXVHGWRUHIHUHQFHWKHPHWHU¶VSRUWWRWKHVDPHSRWHQWLDODVWKHVRXUFH,W LVQRWDQHDUWKJURXQGFRQQHFWLRQ<RXPD\DOVRFRQQHFWWKHVKLHOGWRHDUWKJURXQG DWRQHSRLQW 3URYLGHWHUPLQDWLRQUHVLVWRUVDWHDFKHQGIRUORQJHUUXQVW\SLFDOO\PRUHWKDQ ¶FRQQHFWHGWRWKHDQGOLQHV57LVDSSUR[LPDWHO\2KPV NOTES: 7KHPHWHUKDVVRPHOHYHORIWHUPLQDWLRQLQWHUQDOO\DQGXVXDOO\UHVLVWRUVDUHQRW QHHGHG 5HIHUWRWKH&DEOH&RORU.H\RQSDJHVWR Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ Male Side Port on I/O Module - - + + G RT= 120 Ohms RT= 120 Ohms Meter’s Port 4 S + - )LJXUH0HWHUDQG,20RGXOH&RQQHFWLRQV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ 5.3.9: Steps to Determine Power Needed 6LQFHWKH1H[XVPHWHU¶VSRZHUVXSSO\GRHVQRWVXSSO\SRZHUWRWKH,2 PRGXOHV\RXQHHGWRXVHDSRZHUVRXUFHVXFKDV(,*¶V36,2ZKLFKLVGHVLJQHGIRU XVHZLWKWKH,2PRGXOHV)ROORZWKHVHVWHSVWRGHWHUPLQHKRZPDQ\36,2XQLWV\RX QHHG $OO,2PRGXOHVDUHVKLSSHGSUHSURJUDPPHGZLWKDEDXGUDWHRIDQG LQGLYLGXDODGGUHVVHV5HIHUWRWKHIROORZLQJWDEOHWRGHWHUPLQHWKH9$5DWLQJVIRU WKH,2PRGXOHV I/O Module Factory Settings and VA Ratings Model# Module Address VA Rating P$21 P$$QDORJ 2XWSXWV 9$ P$21 P$$QDORJ 2XWSXWV 9$ P$21 P$$QDORJ 2XWSXWV 9$ P$21 P$$QDORJ 2XWSXWV 9$ $, P$$QDORJ ,QSXWV 9$ $, P$$QDORJ ,QSXWV 9$ $, 9'&$QDORJ ,QSXWV 9$ $, 9'&$QDORJ ,QSXWV 9$ 52 /DWFKLQJ5HOD\ 2XWSXWV 9$ 32 .<=3XOVH2XWSXWV 9$ ', 6WDWXV,QSXWV :HW'U\ 9$ $GGWRJHWKHUWKH9$5DWLQJVIRUWKH,2PRGXOHVLQXVHWRGHWHUPLQHWRWDOSRZHU QHHGHG (DFK36,2VXSSOLHV9$#9'&)RUGHWDLOVRQWKH36,2VHHVHFWLRQV DQG Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ NOTE:)RURU9'&DSSOLFDWLRQV(,*UHFRPPHQGVWKH3%SRZHUVXSSO\ Example order number3%'923% ,I\RXDUHXVLQJD36,2IRU9$&'&LQSXWRU3%\RXUPD[LPXP9$LV 5.3.10: Remote Communication Over Telephone Lines Using the RS485 Port 8VHPRGHPVGHGLFDWHGRUGLDOXSZKHQGHYLFHVDUHDWJUHDWGLVWDQFHV(,* UHFRPPHQGVXVLQJ56ZLULQJZLWKD0RGHP0DQDJHU PC at office Originate Modem Telephone Line Remote Modem Null Modem Adapter (Not required if Modem Manager is used) Nexus® 1262/1272 Meter RS232 to RS485 Converter (Modem Manager Recommended) )LJXUH5HPRWH56&RQQHFWLRQV 8VH3RUWRU3RUWIRU56FRPPXQLFDWLRQ7KHOLQNXVLQJ56LVYLDEOHIRUXSWR IHHWPHWHUV 8VH&RPPXQLFDWRU(;7VRIWZDUHWRVHWWKHSRUW¶VEDXGUDWHWRWKHDSSURSULDWHVSHHG IRU\RXUKDUGZDUHDQGRUQHWZRUNDQGHQDEOH0RGEXV$6&,,SURWRFRO6HHWKH Communicator EXT User ManualIRULQVWUXFWLRQV5HPHPEHU0RGEXV578ZLOOQRW IXQFWLRQSURSHUO\ZLWKPRGHPFRPPXQLFDWLRQ<RXmustFKDQJHWKHSURWRFROWR 0RGEXV$6&,, <RXPXVWXVHDQ56WR56FRQYHUWHUDQGD1XOO0RGHP(,*UHFRPPHQGV XVLQJLWV0RGHP0DQDJHU7KLVFRQYHUWHUKDVDEXLOWLQQXOOPRGHPDQGDOVRSURYLGHV OLQHGDWDEXIIHULQJPDNLQJWKHWHOHSKRQHOLQHFRPPXQLFDWLRQUHOLDEOHPRVWFRPPHU Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ FLDOPRGHPVGRQRW)RUWKLVUHDVRQ(,*UHFRPPHQGVWKH0RGHP0DQDJHUWR DOOHYLDWHDQ\FRPPXQLFDWLRQOLQHHUURUVWKDWPLJKWRFFXU8VLQJWKH0RGHP0DQDJHU DOVRHOLPLQDWHVWKHQHHGWRSURJUDPGHIDXOWVHWWLQJVLQWRWKHPRGHPZKLFKPDNHV LQVWDOODWLRQVLPSOHU 5.3.11: Programming Modems for Remote Communication <RXPXVWSURJUDPDPRGHPEHIRUHLWFDQFRPPXQLFDWHSURSHUO\ZLWKPRVW56RU 56EDVHGGHYLFHV7KLVWDVNLVRIWHQTXLWHFRPSOLFDWHGEHFDXVHPRGHPVFDQEH XQSUHGLFWDEOHZKHQFRPPXQLFDWLQJZLWKUHPRWHGHYLFHV ,I\RXDUHQRWXVLQJ(,*¶V0RGHP0DQDJHU\RXPXVWVHWWKHIROORZLQJVWULQJVWR FRPPXQLFDWHZLWKWKHUHPRWH1H[XVPHWHUV&RQVXOW\RXUPRGHP¶VPDQXDOIRU WKHSURSHUVWULQJVHWWLQJVRUVHH6HFWLRQIRUDOLVWRIVHOHFWHGPRGHPVWULQJV NOTE: 8VHD0RGHP0DQDJHU7KHSURGXFWZDVGHVLJQHGWRPDNHWKLVWDVN³SOXJDQG SOD\´:HKLJKO\UHFRPPHQGLWIRUDOOVHULDOPRGHPVROXWLRQV Modem Connected to a Computer (the Originate Modem) 5HVWRUHPRGHPWRIDFWRU\VHWWLQJV7KLVHUDVHVDOOSUHYLRXVO\SURJUDPPHGVHWWLQJV 6HWPRGHPWRGLVSOD\5HVXOW&RGHV7KHFRPSXWHUZLOOXVHWKHUHVXOWFRGHV 6HWPRGHPWR9HUEDO5HVXOW&RGHV7KHFRPSXWHUZLOOXVHWKHYHUEDOUHVXOWFRGHV 6HWPRGHPWRXVH'756LJQDO7KLVLVQHFHVVDU\IRUWKHFRPSXWHUWRHQVXUH FRQQHFWLRQZLWKWKHRULJLQDWHPRGHP 6HWPRGHPWRHQDEOH)ORZ&RQWURO7KLVLVQHFHVVDU\WRFRPPXQLFDWHZLWKWKH UHPRWHPRGHPFRQQHFWHGWRWKH1H[XVPHWHU ,QVWUXFWPRGHPWRZULWHWKHQHZVHWWLQJVWRDFWLYDWHSURILOH7KLVSODFHVWKHVH VHWWLQJVLQWRQRQYRODWLOHPHPRU\WKHVHWWLQJVZLOOWDNHHIIHFWDIWHUWKHPRGHP SRZHUVXS Modem Connected to the Nexus® Meter (the Remote Modem) 5HVWRUHPRGHPWRIDFWRU\VHWWLQJV7KLVHUDVHVDOOSUHYLRXVO\SURJUDPPHGVHWWLQJV 6HWPRGHPWRDXWRDQVZHURQnULQJV7KLVVHWVWKHUHPRWHPRGHPWRDQVZHUWKH FDOODIWHUnULQJV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ 6HWPRGHPWRLJQRUH'756LJQDO7KLVLVQHFHVVDU\IRUWKH1H[XVPHWHUWRLQVXUH FRQQHFWLRQZLWKWKHRULJLQDWHPRGHP 6HWPRGHPWRGLVDEOH)ORZ&RQWURO7KH1H[XVPHWHU¶V56FRPPXQLFDWLRQ GRHVQRWVXSSRUWWKLVIHDWXUH ,QVWUXFWPRGHPWRZULWHWKHQHZVHWWLQJVWRDFWLYDWHSURILOH7KLVSODFHVWKHVH VHWWLQJVLQWRQRQYRODWLOHPHPRU\WKHVHWWLQJZLOOWDNHHIIHFWDIWHUWKHPRGHP SRZHUVXS :KHQSURJUDPPLQJWKHUHPRWHPRGHPZLWKDWHUPLQDOSURJUDPPDNHVXUHWKH EDXGUDWHRIWKHWHUPLQDOSURJUDPPDWFKHVWKH1H[XVPHWHU¶VEDXGUDWH 5.3.12: Selected Modem Strings Table 1: Modem String/Setting &DUGLQDOPRGHP $7)().16 =RRP)D[PRGHP9); 9%,6. $7).6 :< =RRP)D[PRGHP.[ 'XDO0RGH $7).&6 : < 865RERWLFV6SRUWVWHU )D[PRGHP ',3VZLWFKVHWWLQJ $7)1:<IRU EDXG 8S8S'RZQ'RZQ8S8S 8S'RZQ 865RERWLFV6SRUWVWHU. )D[PRGHP ',3VZLWFKVHWWLQJ $7):< 8S8S'RZQ'RZQ8S8S 8S'RZQ 5.3.13: High Speed Inputs Connection 7KH1H[XVPHWHU¶VEXLOWLQ+LJK6SHHG,QSXWVFDQEHXVHGLQWZRZD\V $WWDFKLQJVWDWXVFRQWDFWVIURPUHOD\VEUHDNHUVRURWKHUGHYLFHVIRUVWDWXVRUZDYH IRUPLQLWLDWLRQ $WWDFKLQJWKH.<=SXOVHRXWSXWVIURPRWKHUPHWHUVIRUSXOVHFRXQWLQJDQGWRWDOL]LQJ (YHQWKRXJKWKHVHLQSXWVDUHFDSDEOHRIEHLQJXVHGDVKLJKVSHHGGLJLWDOIDXOWUHFRUG LQJLQSXWVWKH\VHUYHDGXDOSXUSRVHDV.<=FRXQWHUVDQGWRWDOL]HUV7KHIXQFWLRQLQ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ XVHLVSURJUDPPDEOHLQWKHPHWHUDQGLVFRQILJXUHGYLD&RPPXQLFDWRU(;75HIHUWR WKHCommunicator EXT User ManualIRULQVWUXFWLRQVRQSURJUDPPLQJWKHVHIHDWXUHV 7KH+LJK6SHHG,QSXWVFDQEHXVHGWRVHQVHGU\FRQWDFWFORVXUHVRQO\7KHPHWHU LQWHUQDOO\JHQHUDWHVWKHZHWWLQJ9ROWDJHIRUWKHFRQWDFWV7KHZHWWLQJ9ROWDJHLV9 '& )LJXUH+LJK6SHHG,QSXWV&RQQHFWLRQ 5.3.14: IRIG-B Connections ,5,*%LVDVWDQGDUGWLPHFRGHIRUPDWWKDWV\QFKURQL]HVHYHQWWLPHVWDPSLQJWR ZLWKLQPLOOLVHFRQG$Q,5,*%VLJQDOJHQHUDWLQJGHYLFHFRQQHFWHGWRWKH*36 VDWHOOLWHV\VWHPV\QFKURQL]HV1H[XVPHWHUVORFDWHGDWGLIIHUHQW JHRJUDSKLFORFDWLRQV1H[XVPHWHUVXVHDQXQPRGXODWHGVLJQDOIURPDVDWHOOLWH FRQWUROOHGFORFNVXFKDV$UELWHU%)RUGHWDLOVRQLQVWDOODWLRQUHIHUWRWKH8VHU¶V 0DQXDOIRUWKHVDWHOOLWHFRQWUROOHGFORFNLQXVH%HORZDUHLQVWDOODWLRQVWHSVDQGWLSV WKDWZLOOKHOS\RX Connection: &RQQHFWWKHWHUPLQDORIWKH1H[XVPHWHUWRWKHWHUPLQDORIWKHVLJQDO JHQHUDWLQJGHYLFHFRQQHFWWKHWHUPLQDORIWKH1H[XVPHWHUWRWKHWHUPLQDO RIWKHVLJQDOJHQHUDWLQJGHYLFH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ Installation 6HW7LPH6HWWLQJVIRUWKHPHWHUEHLQJLQVWDOOHG )URPWKH&RPPXQLFDWRU(;7'HYLFH3URILOHPHQX D&OLFNGeneral Settings>Time Settings>one of the Time Settings linesWRRSHQWKH7LPH6HWWLQJVVFUHHQ E6HWWKH7LPH=RQHDQG'D\OLJKW6DYLQJV6HOHFWAutoDSTRUEnableDQG VHWGDWHV F&OLFNUpdate Device ProfileWRVDYHWKHQHZVHWWLQJV6HH&KDSWHURI WKHCommunicator EXT User’s Manual IRUGHWDLOV %HIRUHFRQQHFWLRQFKHFNWKDWWKHGDWHRQWKHPHWHUFORFNLVFRUUHFWRU ZLWKLQ0RQWKVRIWKHDFWXDOGDWH7KLVSURYLGHVWKHULJKW\HDUIRUWKH FORFN*36GRHVQRWVXSSO\WKH\HDU &RQQHFWWKHWHUPLQDORIWKH1H[XVPHWHUWRWKHWHUPLQDORIWKH VLJQDOJHQHUDWLQJGHYLFHFRQQHFWWKHWHUPLQDORIWKH1H[XVPHWHUWR WKHWHUPLQDORIWKHVLJQDOJHQHUDWLQJGHYLFH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ Troubleshooting Tip 7KHPRVWFRPPRQVRXUFHRISUREOHPVLVDUHYHUVDORIWKHWZRZLUHV,I\RXKDYHD SUREOHPWU\UHYHUVLQJWKHZLUHV GP S Sa tel lite Co nn ec tio n IRIG-B Port + + - - IRIG-B Time Signal Generating Device )LJXUH,5,*%&RPPXQLFDWLRQ NOTE: 3OHDVHPDNHVXUHWKDWWKHVHOHFWHGFORFNFDQGULYHWKHDPRXQWRIZLUHGORDGV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ 5.3.15: Time Synchronization Alternatives 6HHWKHCommunicator EXT User ManualIRUGHWDLOV IRIG-B $OO1H[XVPHWHUVDUHHTXLSSHGWRXVH,5,*%IRUWLPHV\QFKURQL]D WLRQ ,I,5,*%LVFRQQHFWHGWKLVIRUPRIWLPHV\QFKURQL]DWLRQWDNHVSUHFHGHQFHRYHUWKH LQWHUQDOFORFN,IWKH*366LJQDOLVORVWWKHLQWHUQDOFORFNWDNHVRYHUWLPHNHHSLQJ DWWKHSUHFLVHPRPHQWWKHVLJQDOLVORVW Line Frequency Clock Synchronization $OO1H[XVPHWHUVDUHHTXLSSHGZLWK/LQH)UHTXHQF\&ORFN6\QFKURQL]DWLRQZKLFK PD\EHHQDEOHGRUGLVDEOHGIRUXVHLQVWHDGRI,5,*%,I/LQH)UHTXHQF\&ORFN 6\QFKURQL]DWLRQLVHQDEOHGDQGSRZHULVORVWWKHLQWHUQDOFORFNWDNHVRYHUDWWKH SUHFLVHPRPHQWSRZHULVORVW Internal Clock Crystal $OO1H[XVPHWHUVDUHHTXLSSHGZLWKLQWHUQDOFORFNVFU\VWDOVZKLFKDUHDFFXUDWHWR SSPDQGZKLFKFDQEHXVHGLI,5,*%LVQRWFRQQHFWHGDQGRU/LQH)UHTXHQF\ &ORFN6\QFKURQL]DWLRQLVQRWHQDEOHG DNP Time Synchronization 8VLQJ&RPPXQLFDWRU(;7\RXFDQVHWWKHPHWHUWRUHTXHVWWLPHV\QFKURQL]DWLRQ IURPWKH'130DVWHU5HTXHVWVFDQEHPDGHIURPRQFHSHUPLQXWHWRRQFHSHUGD\ 6HHWKHNexus® 1252/1262/1272/1500 DNP User Manual IRULQVWUXFWLRQV<RXFDQ GRZQORDGWKHPDQXDOIURP(,*¶VZHEVLWH ZZZHOHFWURLQGFRPSGI'13YB/HYHOSGI Other Time Setting Tools Tools>Set Device Time)RUPDQXDORU3&WLPHVHWWLQJ Script & Scheduler7LPHVWDPSVUHWULHYHGORJVDQGGDWD Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ MV90&DQV\QFKURQL]HWLPHRQUHWULHYDOVLQWKHIRUPRIDWLPHVWDPS5HIHUWRWKH Communicator EXT User Manual++)&RQYHUWHULQVWUXFWLRQVIRUPRUH09 GHWDLOV 5.4: INP2 Internal Modem with Dial-In/Dial-Out Option 7KH,13,QWHUQDO0RGHPRSWLRQJLYHVWKH1H[XVPHWHU5-FRQQHFWLRQ DVZHOODV'LDO,Q'LDO2XWUHPRWHFRPPXQLFDWLRQ 5.4.1: Hardware Overview 7KH,132SWLRQIRUWKH1H[XVPHWHUSURYLGHVDGLUHFWFRQQHFWLRQWRD VWDQGDUGWHOHSKRQHOLQH1RDGGLWLRQDOKDUGZDUHLVUHTXLUHGWRHVWDEOLVKDFRPPXQLFD WLRQFRQQHFWLRQEHWZHHQWKHPHWHUDQGDUHPRWHFRPSXWHU 7KHPRGHPRSHUDWHVDWXSWRNEDXG7KHLQWHUQDOFRQQHFWLRQEHWZHHQWKHPRGHP DQGWKHPHWHULQFOXGHVDPHPRU\EXIIHU7KLVHQDEOHVWKHPRGHPWRFRQQHFWWRWKH SKRQHOLQHDWDQ\VSHHGDQGWRFKDQJHVSHHGGXULQJWKHFRPPXQLFDWLRQFRQQHFWLRQWR WKHUHPRWH3&7KHEXIIHUEHWZHHQWKHPHWHUDQGWKHPRGHPDOORZVWKHPHWHUWR FRPPXQLFDWHLQWRWKHPRGHPDWDFRQVWDQWVSHHGZKLOHWKHPRGHPWHOHSKRQHOLQH VSHHGFDQYDU\7KLVHOLPLQDWHVWKHV\QFKURQL]LQJSUREOHPVWKDWDUHFRPPRQZLWK RWKHUGHYLFHV,WDOVRLQFUHDVHVWKHHIIHFWLYHWKURXJKSXWRIWKHFRPPXQLFDWLRQ FKDQQHO7KLVLQWXUQGHFUHDVHVFRQQHFWLRQWLPHDQGFRQQHFWLRQFRVWV 7KHPRGHPVXSSRUWVERWKLQFRPLQJFDOOVIURPDUHPRWHFRPSXWHUDQGDXWRPDWLF GLDORXWFDOOVZKHQDGHILQHGHYHQWPXVWEHDXWRPDWLFDOO\UHSRUWHG 5.4.2: Hardware Connection :KHQWKH,132SWLRQLVRUGHUHGWKHUHDUHWZR5-MDFNVWKDWSLJWDLOIURPWKHEDFN RIWKHPHWHU/LQHFRQQHFWLRQIRUWKHRXWVLGHOLQH3KRQHFRQQHFWLRQIRU\RXU SKRQH$VWDQGDUGWHOHSKRQH5-SOXJFRQQHFWVWKHPHWHUWRDVWDQGDUG3671 3XEOLF6ZLWFKHG7HOHSKRQH1HWZRUN7KHSKRQHMDFNLVWKHRYHUULGHRIWKHPRGHP IXQFWLRQZKHQWKHSKRQHLVLQXVH :LWKWKHGHYLFHFRQILJXUHGZLWKWKH,132SWLRQWKHPHWHUKDVGLDOLQFDSDELOLW\DQG SURYLGHVUHPRWHDFFHVVWRRWKHU0RGEXVEDVHGVHULDOGHYLFHVYLDWKHPHWHU¶V56 *DWHZD\RYHU\RXUSKRQHOLQH7KHPHWHUZLOOUHFRJQL]HDQGUHVSRQGWRD0RGEXV $GGUHVVRI:LWKDQ\RWKHUDGGUHVVWKHFRPPDQGSDVVHVWKURXJKWKHJDWHZD\DQG Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ EHFRPHVDYLUWXDOFRQQHFWLRQEHWZHHQWKH5HPRWH0RGEXV0DVWHUDQGDQ\0RGEXV 6ODYHFRQQHFWHGWRWKH56*DWHZD\ 5.4.3: Dial-In Function 7KHPRGHPFRQWLQXRXVO\PRQLWRUVWKHWHOHSKRQHOLQHWRGHWHFWDQLQFRPLQJFDOO :KHQDQLQFRPLQJFDOOLVGHWHFWHGWKHPRGHPZDLWVDXVHUVHWQXPEHURIULQJVDQG WKHQDQVZHUVWKHFDOO 7KHPRGHPFDQEHSURJUDPPHGWRFKHFNIRUDSDVVZRUGRQDQLQFRPLQJFDOO,IWKH FRUUHFWSDVVZRUGLVQRWSURYLGHGWKHPRGHPKDQJVXSRQWKHLQFRPLQJFDOO,IVHY HUDOXQVXFFHVVIXOLQFRPLQJFDOODWWHPSWVDUHUHFHLYHGLQDVHWWLPHSHULRGWKHPRGHP ORFNVRXWIXWXUHLQFRPLQJFDOOVIRUDXVHUVHWQXPEHURIKRXUV :KHQDQLQFRPLQJFDOOLVVXFFHVVIXOO\FRQQHFWHGWKHFRQWURORIFRPPXQLFDWLRQVLV SDVVHGWRWKHFDOOLQJVRIWZDUHSURJUDP7KHPRGHPUHVSRQGVWRFRPSXWHUFRPPDQGV WRGRZQORDGGDWDRURWKHUDFWLRQVDXWKRUL]HGE\WKHPHWHUSDVVZRUGV 5HIHUWRWKHCommunicator EXT User ManualIRULQVWUXFWLRQVRQSURJUDPPLQJWKH PRGHP 5.4.4: Dial-Out Function 7KH'LDO2XW)XQFWLRQ,13LVLQWHQGHGWRDOORZWKHPHWHUWRDXWRPDWLFDOO\UHSRUW FHUWDLQFRQGLWLRQVZLWKRXWXVHULQWHUYHQWLRQ7KHPRGHPLVQRUPDOO\SROOLQJWKHPHWHU WRGHWHUPLQHLIDQ\DEQRUPDORUUHSRUWDEOHFRQGLWLRQVH[LVW7KHPRGHPFKHFNVWKH IROORZLQJPHWHUFRQGLWLRQVDQGSURJUDPPHGHYHQWVVHWLQ&RPPXQLFDWRU(;7WR GHWHUPLQHLIDFDOOVKRXOGEHSODFHG $UHDQ\PHWHUVHWSRLQWOLPLWVH[FHHGHG" +DVWKHVWDWXVRIKLJKVSHHGLQSXWVFKDQJHG" +DVDZDYHIRUPEHHQUHFRUGHG" +DVDSRZHUTXDOLW\HYHQWEHHQUHFRUGHG" +DVDFRQWURORXWSXWFKDQJHG" +DVWKHPHWHUH[SHULHQFHGDORVVRIFRQWUROSRZHU" Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ ,VHLWKHUKLVWRU\ORJDSSURDFKLQJDIXOOFRQGLWLRQ" ,VWKHHYHQWORJDSSURDFKLQJDIXOOFRQGLWLRQ" ,VDQ\RWKHUORJDSSURDFKLQJDIXOOFRQGLWLRQ" +DVWKHPRGHPSDVVZRUGIDLOHG" +DVFRPPXQLFDWLRQZLWKWKHPHWHUIDLOHG" ,IDQ\RIWKHPRQLWRUHGHYHQWVH[LVWWKHPRGHPDXWRPDWLFDOO\LQLWLDWHVDFDOOWRD VSHFLILHGORFDWLRQWRPDNHDUHSRUWRUSHUIRUPVRPHRWKHUIXQFWLRQ)RUORJIXOO FRQGLWLRQVWKHPHWHUDXWRPDWLFDOO\GRZQORDGVWKHORJVWKDWDUHQHDULQJWKHIXOO VWDWH7KHPRGHPFDQEHSURJUDPPHGWRFDOOWZRGLIIHUHQWQXPEHUVWRPDNHWKH UHTXLUHGUHSRUWV3ULPDU\DQG%DFNXS 7KHPRGHPFDQEHSURJUDPPHGZLWKDQ$6&,,VWULQJIRULGHQWLILFDWLRQSXUSRVHV,I WKLVVWULQJLQSUHVHQWWKHPRGHPSOD\VWKHVWULQJWRWKHKRVWFRPSXWHUXSRQ FRQQHFWLRQWRLGHQWLI\WKHPHWHUWRWKHKRVWVRIWZDUH5HIHUWRWKHCommunicator EXT User ManualIRUSURJUDPPLQJGHWDLOV 7KHPRGHPLQFOXGHVDFRQQHFWLRQIRUDQH[WHUQDO9/LWKLXP%DWWHU\ZLWKFXVWRP OHDGVDQGYHOFURPRXQWLQJWRSRZHUWKHPRGHPLIWKHPHWHUORVHVFRQWUROSRZHU 8VLQJWKHEDWWHU\WKHPRGHPLVDEOHWRFRPSOHWHDUHSRUWLQJFDOOHYHQLISRZHUWRWKH PHWHUKDVEHHQGLVFRQQHFWHG7KLVIHDWXUHDOORZVWKHPHWHUWRUHSRUWSRZHURXWDJH FRQGLWLRQV8QGHUQRUPDOFRQGLWLRQVWKHEDWWHU\VKRXOGSURYLGHLQH[FHVVRI\HDUV RIVHUYLFHGXULQJVWRUDJHFRQGLWLRQVGLVFRQQHFWHGIURPWHUPLQDOVRUZKHQSURSHUO\ LQVWDOOHGLQDQHQHUJL]HGPHWHU7KHEDWWHU\VKRXOGSURYLGHPRUHWKDQRQH\HDURI VHUYLFHGXULQJRXWDJHFRQGLWLRQVRQEDWWHU\EDFNXS$/2:%$77(5<LQGLFDWRU DSSHDUVRQWKHGLVSOD\VFUHHQZKHQEDWWHU\SRZHULVORZ&DOOWKHIDFWRU\IRUD UHSODFHPHQWEDWWHU\ 5HSODFHPHQWRIWKHEDWWHU\LVVLPSOH:KHQRUGHUHGWKHEDWWHU\LVDWWDFKHGWRD FDEOHZKLFKSLJWDLOVIURPWKHEDFNRIWKHPHWHUZLWKDFRQQHFWRUVHHIROORZLQJ127( )LJXUHDQG7DEOH Installation steps: 5HPRYHWKHROGEDWWHU\E\GLVFRQQHFWLQJLWDWWKHFRQQHFWRU Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ ,QVWDOOWKHQHZEDWWHU\E\VQDSSLQJLWLQWRWKHFRQQHFWRU 3HHODQGVWLFNWKHYHOFURDGKHVLYHVRPHZKHUHRXWVLGHWKHPHWHURUXVHWKHROG DGKHVLYHWRIDVWHQWKHEDWWHU\LQSODFH NOTE&XVWRPOHDGVDQG9HOFURPRXQWLQJDUHQRWLQFOXGHGLQVRPHHDUOLHUYHUVLRQVRI WKH6ZLWFKERDUG0HWHU&DOOWKH(,*IDFWRU\IRULQVWDOODWLRQUHSODFHPHQWSDUW %$77 5.5: INP200 Onboard Ethernet 7KH%DVH7(WKHUQHWRSWLRQ,13LVDIXOO\FXVWRPL]DEOHZHEVHUYHUWKDW XVHV;0/WRSURYLGHDFFHVVWRUHDOWLPHGDWDYLDWKH,QWHUQHW(,*¶VQDPHIRUWKLV G\QDPLFV\VWHPLV7RWDO:HE6ROXWLRQV7KHV\VWHPLQFRUSRUDWHVDKLJKO\SURJUDPPD EOHQHWZRUNFDUGZLWKEXLOWLQPHPRU\WKDWLVLQVWDOOHGLQPHWHUVZLWKWKH,13 RSWLRQ(DFKFDUGFDQEHSURJUDPPHGWRSHUIRUPH[WHQVLYHPRQLWRULQJIXQFWLRQV7KH %DVH7RSWLRQLVPXFKIDVWHUWKDQWKH%DVH7RSWLRQZKLFKGRHVQRWRIIHU7RWDO :HE6ROXWLRQV 5.5.1: Hardware Overview $1H[XVPHWHUZLWKWKH%DVH7(WKHUQHW2SWLRQ,13KDVDOO WKHFRPSRQHQWVRIWKHVWDQGDUG1H[XVPHWHUSOXVWKHFDSDELOLW\RIFRQQHFWLRQWRD QHWZRUNWKURXJKDQ(WKHUQHW/$1RUWKURXJKWKH,QWHUQHWYLD0RGEXV7&3'13 :$1/$1+7736073)73DQGRU'+&3 7KH,QWHUQDO1HWZRUN2SWLRQRIWKH1H[XVPHWHULVDQH[WUHPHO\YHUVDWLOHFRPPXQL FDWLRQWRRO,W $GKHUHVWR,((((WKHUQHWVWDQGDUGXVLQJ7&3,3 8WLOL]HVVLPSOHDQGLQH[SHQVLYH%DVH7ZLULQJDQGFRQQHFWLRQV 3OXJVULJKWLQWR\RXUQHWZRUNXVLQJWKHEXLOWLQ5-MDFN ,VSURJUDPPDEOHWRDQ\,3DGGUHVVVXEQHWPDVNDQGJDWHZD\UHTXLUHPHQWV &RPPXQLFDWHVXVLQJWKHLQGXVWU\VWDQGDUG0RGEXV7&3SURWRFRORU'13:$1/$1 Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ 5.5.2: Hardware Connection 8VHVWDQGDUG5-%DVH7FDEOHWRFRQQHFWZLWKWKH1H[XVPHWHU7KH5- OLQHLVLQVHUWHGLQWRWKH5-SRUWFRPLQJIURPWKHEDFNRIWKHPHWHUZLWKWKH,13 (WKHUQHW2SWLRQVHH)LJXUH Configure the Network settings using the following steps: 8VLQJ3RUW3RUW56FRQQHFWLRQRUWKHRSWLFDOSRUWFRQQHFWD3&WRWKH PHWHU$Q5656FRQYHUWHUPD\EHUHTXLUHGHJ(OHFWUR,QGXVWULHV 8QLFRP 'RXEOHFOLFNRQ&RPPXQLFDWRU(;76RIWZDUHWRRSHQLW &OLFNWKHQuick ConnectRUConnection ManagerLFRQLQWKHLFRQWRROEDU &OLFNWKHSerial PortEXWWRQ0DNHVXUHGDWDPDWFKHVWKHPHWHUWKHQFOLFN Connect Set the Network using the following steps: )URPWKH'HYLFH3URILOHPHQXFOLFNGeneral Settings>Communications!DQG WKHQFOLFNRQRQHRIWKHOLVWHGSRUWV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ <RXZLOOVHHWKH'HYLFH3URILOH&RPPXQLFDWLRQV6HWWLQJVVFUHHQ ,QWKH1HWZRUN6HWWLQJVVHFWLRQPLGGOHRIWKHVFUHHQHQWHUWKHIROORZLQJGDWD SURYLGHGE\\RXU6\VWHPV$GPLQLVWUDWRU ,3$GGUHVV([DPSOH 6XEQHW0DVN([DPSOH 'HIDXOW*DWHZD\([DPSOH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ &OLFNWKHAdvanced SettingsEXWWRQWRIXUWKHUFRQILJXUHWKH1HWZRUNFRQQHFWLRQ 7KH$GYDQFHG1HWZRUN2SWLRQ6HWWLQJVVFUHHQRSHQV 7KHWDEVDWWKHWRSRIWKHVFUHHQOHW\RXQDYLJDWHEHWZHHQVHWWLQJV'HSHQGLQJRQ \RXUPHWHU¶VFRQILJXUDWLRQ\RXPD\QRWQHHGWRSURJUDPDOORIWKHVHWWLQJVVKRZQ KHUH D7KHILUVWWDELV6HUYLFHV6HFXULW\VKRZQDERYH&OLFNWKHRSWLRQVWRHQDEOH WKHPIRUWKH1HWZRUNRSWLRQHJWRHQDEOHWKH:HEVHUYHUFOLFNWKHER[QH[W WRWKDWRSWLRQ E&OLFNDQ\RIWKHRWKHUWDEVWRFRQILJXUHPRUHRSWLRQVVHH&KDSWHULQWKH Communicator EXT User ManualIRUGHWDLOHGLQVWUXFWLRQV )73&OLHQWFRQILJXUHWKH)73VHUYHUVHWWLQJV *(3URWRFRO(*'FRQILJXUH*(¶V(*'SURWRFROLIWKHPHWHU¶VILUPZDUH VXSSRUWVWKLV $ODUP(PDLOFRQILJXUHWKHDODUPHPDLOQRWLILFDWLRQVHWWLQJV &RPSXWHU1DPH'16VHWDQDPH'16VHUYHUV '+&3HQDEOH'+&3IXQFWLRQDOLW\ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ )LUPZDUH8SGDWHXSGDWHWKH1HWZRUNFDUG¶VILUPZDUH '13IRU/$1:$1FRQILJXUHWKHVHWWLQJVIRU'13/$1:$1'13RYHU WKH(WKHUQHW F&OLFNOKWRVDYH\RXUVHWWLQJVDQGFORVHWKH$GYDQFHG1HWZRUN2SWLRQ6HWWLQJV VFUHHQ &OLFNOKWRVDYH\RXUFRPPXQLFDWLRQVHWWLQJVDQGFORVHWKH&RPPXQLFDWLRQV 6HWWLQJVVFUHHQ &OLFNUpdate DeviceWRVHQGWKHQHZSURILOHWRWKHPHWHU $IWHUWKH1HWZRUNSDUDPHWHUVDUHVHW&RPPXQLFDWRU(;7FRQQHFWVWRWKHPHWHUYLD WKH1HWZRUNXVLQJD'HYLFH$GGUHVVRI³´DQGWKHDVVLJQHG,3$GGUHVV)ROORZWKHVH VWHSV 'RXEOHFOLFNRQWKH&RPPXQLFDWRU(;7LFRQWRRSHQWKHVRIWZDUH &OLFNWKHConnect LFRQLQWKHLFRQWRROEDU <RXZLOOVHHWKH&RQQHFWVFUHHQ&OLFNWKHNetworkEXWWRQDWWKHWRSRIWKHVFUHHQ 7KHVFUHHQZLOOFKDQJHWRRQHUHTXHVWLQJWKHIROORZLQJLQIRUPDWLRQ 'HYLFH$GGUHVV +RVW,3$GGUHVVSHU\RXUQHWZRUNDGPLQLVWUDWRU ([DPSOH 1HWZRUN3RUW 3URWRFRO0RGEXV7&3 NOTE: 6HH6HFWLRQIRUWKHIDFWRU\VHWWLQJV &OLFNWKHConnectEXWWRQDWWKHERWWRPRIWKHVFUHHQ&RPPXQLFDWRU(;7FRQQHFWV WRWKHPHWHUYLDWKH1HWZRUN NOTES &RPPXQLFDWRU(;7DOZD\VFRPPXQLFDWHVYLD0RGEXV7&3ZKLFKLVWKHGHIDXOWSUR WRFROIRU1H[XVPHWHUV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ 6HHWKHCommunicator EXT User Manual IRUPRUHGHWDLOVRQWKH1HWZRUNRSWLRQ DQGWKH:HEVHUYHU7RWDO:HE6ROXWLRQV 5.6: INP202 Ethernet/Modem Combination 7KH,132SWLRQLVDQH[WHQVLRQRI,13,WKDVDOOWKHIHDWXUHVRI,13SOXVD EXLOWLQPRGHP7KHFRPPXQLFDWLRQSURWRFROVXSSRUWHGE\WKHPRGHPLV0RGEXV $6&,,7KHFRPPXQLFDWLRQSURWRFROVXSSRUWHGE\WKH56(WKHUQHW0RGHP *DWHZD\LV0RGEXV578 ,13FRQYHUWVDOOLQFRPLQJ0RGHP0RGEXV$6&,,UHTXHVWVWR0RGEXV578IRU LQWHUQDODQGJDWHZD\FRPPXQLFDWLRQ,WWKHQFRQYHUWVDOOUHVSRQVH0RGEXV578 PHVVDJHVLQWR0RGEXV$6&,,DQGVHQGVWKHUHVSRQVHVWRWKHPRGHP 5.6.1: Hardware Overview 7KH1H[XVPHWHUZLWKWKH,132SWLRQKDVDOOWKHFRPSRQHQWVRIDQ ,131H[XVPHWHUSOXVDEXLOWLQPRGHP,WKDVWKHFDSDELOLW\RIFRQQHFWLQJWRD QHWZRUNWKURXJKDQ(WKHUQHW/$1DQGZLWKRWKHUGHYLFHVYLDPRGHP 5.6.2: Hardware Connection 7KHUHDUHWKUHHFDEOHVWRFRQQHFWIRUWKH,132SWLRQ$Q56*DWHZD\FDEOHDQ 5-(WKHUQHWFDEOHDQGDQ5-0RGHPFDEOHDUHLQVHUWHGLQWRWKHFDEOHVFRPLQJ IURPWKHEDFNRIWKH1H[XVPHWHUZLWKWKH,13(WKHUQHW0RGHP2SWLRQ5HIHU WR)LJXUHIRUGHWDLOVRQFDEOHV Make the software connection using the following steps: 8VLQJ3RUWRU3RUW56FRQQHFWLRQFRQQHFWD3&WRWKHPHWHU$Q56 56FRQYHUWHUPD\EHUHTXLUHGHJ(OHFWUR,QGXVWULHV¶8QLFRP 'RXEOHFOLFNRQ&RPPXQLFDWRU(;76RIWZDUHWRRSHQLW &OLFNWKHQuick ConnectRUWKHConnection ManagerLFRQLQWKHLFRQWRROEDU &OLFNWKHSerial PortEXWWRQ0DNHVXUHGDWDPDWFKHVWKHPHWHUWKHQFOLFN Connect Set the Network using the following steps: 5HIHUWR6HFWLRQRIWKHCommunicator EXT User Manual IRUPRUHGHWDLOV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ )URPWKH'HYLFH3URILOHPHQXFOLFNGeneral Settings>Communications!DQG WKHQFOLFNRQRQHRIWKHOLVWHGSRUWV <RXZLOOVHHWKH'HYLFH3URILOH&RPPXQLFDWLRQV6HWWLQJVVFUHHQ,QWKH1HWZRUN 6HWWLQJVVHFWLRQHQWHUGDWDSURYLGHGE\\RXUV\VWHPVPDQDJHU ,3$GGUHVV([DPSOH 6XEQHW0DVN([DPSOH 'HIDXOW*DWHZD\([DPSOH &RPSXWHU1DPH1(7:25.([DPSOH $IWHUWKH1HWZRUNSDUDPHWHUVDUHVHW&RPPXQLFDWRU(;7FRQQHFWVWRWKHPHWHUYLD WKH1HWZRUNXVLQJD'HYLFH$GGUHVVRI³´DQGWKHDVVLJQHG,3$GGUHVV)ROORZWKHVH VWHSV 'RXEOHFOLFNRQWKH&RPPXQLFDWRU(;7LFRQWRRSHQWKHVRIWZDUH &OLFNWKHConnect LFRQLQWKHLFRQWRROEDU <RXZLOOVHHWKH&RQQHFWVFUHHQ&OLFNWKHNetworkEXWWRQDWWKHWRSRIWKHVFUHHQ 7KHVFUHHQZLOOFKDQJHWRRQHUHTXHVWLQJWKHIROORZLQJLQIRUPDWLRQ 'HYLFH$GGUHVV +RVW,3$GGUHVVSHU\RXUQHWZRUNDGPLQLVWUDWRU ([DPSOH 1HWZRUN3RUW 3URWRFRO0RGEXV7&3 NOTE: 6HH6HFWLRQIRUWKHIDFWRU\VHWWLQJV &OLFNWKHConnectEXWWRQDWWKHERWWRPRIWKHVFUHHQ&RPPXQLFDWRU(;7FRQQHFWV WRWKHPHWHUYLDWKH1HWZRUN )RUWKH0RGHPFRQQHFWLRQIROORZWKHLQVWUXFWLRQVLQ6HFWLRQ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ 5.7: Factory Settings <RXFDQXVH&RPPXQLFDWRU(;7WRFRQQHFWWRDPHWHUZLWKWKH,13,13RSWLRQ IRUWKHILUVWWLPHRUDWDQ\WLPHXQWLOWKHVHWWLQJVDUHFKDQJHGXVLQJWKHIROORZLQJ IDFWRU\VHWWLQJV 'HYLFH$GGUHVV ,3$GGUHVV 1HWZRUN3RUW 3URWRFRO0RGEXV7&3 Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6HULDO&RPPXQLFDWLRQ:LULQJ 7KLVSDJHLQWHQWLRQDOO\OHIWEODQN Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 6: Hardware Installation 6: Hardware Installation 6.1: Mounting the Nexus® Socket Meter The Nexus® 1262/1272 Socket meter is designed to mount into a standard meter socket. Follow the Installation Summary below or follow the installation instructions on the meter socket to ensure that the unit is installed securely. See Dimension figures below and on the following pages. NOTE: For Switchboard Meter dimensions and related information, see Chapter 12. 6.96" 17.68cm 4.57" 11.61cm 6.2" 15.75cm 6.96" 17.68cm Front View Side View Figure 6.1: Socket Meter Mounting Dimensions Installation Summary • Examine the labels to verify that the meter you are installing is, in fact, the correct form factor and service type. Make sure that the socket and meter current class ratings are compatible. • Make sure that all communication and auxiliary power wiring is accessible in case disconnection is required for any reason. • Before applying power to the meter, install batteries if not installed at the factory and check the connections if they are installed. The meter has two batteries: an Internal battery which is used to maintain non-volatile readings and the real-time clock, and the Dial-out Modem battery, which is used by the INP2 option to dial out on an outage. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 6-1 6: Hardware Installation WARNING! POWER MUST BE OFF TO INSTALL THE INTERNAL BATTERY! AVERTISSEMENT! POUR INSTALLER LA BATTERIE DE LA BORNE, IL FAUT ÉTENDRE L'ALIMENTATION ÉLECTRIQUE! • To install the Internal Battery, remove the Internal Shroud and place the battery into the battery compartment with the + facing UP. Replace the Internal Shroud. See Section 6.2. • To install the Modem Battery, with the Outer Shroud on the meter, locate the battery cable at the back of the meter and insert the cable connector into the cable. Use the velcro (peel and stick) to attach the battery somewhere outside of the meter. See Section 5.4.4. • Measure the enclosure to make sure it accommodates the meter. (If it is standard size, that won’t be necessary.) • Make sure that any communications wiring from the back of the meter is fed through the appropriate openings in your socket to allow for clean connections with external devices. • Insert the meter into the socket, making sure that the unit blades are firmly within the jaws of the socket. • Connect external devices to the appropriate communications wiring. See following Figure 6.2 and Table 6.1, Cable Color Key, for communications wiring details. RJ11 and RJ45 connectors are supplied. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 6-2 6: Hardware Installation • Make sure the meter is functioning properly by running it through a test circuit. • The Nexus® Socket meter has its own display built into the face of the meter. However, you may want to install additional displays in remote locations. See Section 6.3 for installation procedures for the Nexus® P40N/P40N+/P41N+/P43N+ displays. The displays are connected to the meter via the RS485 cable supplied with the 1262/1272 (see Figure 6.2, below). See Chapter 5 for detailed wiring instructions. Modem/Ethernet Combo: Cable 4=RS485 Cable 5=RJ11 Modem Cable 6=RJ45 Ethernet Modem: Cable 4=RS485 Cable 5=RJ11 Modem Cable 7=Battery Ethernet: Cable 6=RJ45 Ethernet Cable 8: Optional Aux Power Cable 1: Port 1, Port 4, IRIG-B Optional Communication Cables Cable 3: Optional Cable 2: to High-Speed Inputs KYZ Cable Figure 6.2: Socket Meter Rear View Showing Cables Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 6-3 6: Hardware Installation 0.87" 2.21cm 10.4" 26.42cm IA High Va IB Vb IC Vc High High IC Low IB Low Vn IA Low 6.84" 17.37cm Figure 6.3: Socket Meter Mounted in A-Base Front View Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 6-4 6: Hardware Installation 4.57” 11.61cm 2.02” 5.13cm 6.60” 16.76cm Figure 6.4: Socket Meter in A-Base Side View 6.1.1: Cable Color Key Table 1: Cable Color Key Cable Cable 1 Signal Name Color Port 1 Wiring (RS485) SHIELD Black Tx/Rx+ Brown Tx/Rx- Red Port 4 Wiring (RS485) SHIELD Orange Tx/Rx+ Yellow Tx/Rx- Green IRIG-B Electro Industries/GaugeTech Electro Industries/GaugeTech + Blue - Purple The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 6-5 6: Hardware Installation Table 1: Cable Color Key Cable Cable 2 Cable 3 Cable 4 Cable 5 Signal Name High-Speed Inputs Input 8 Black Input 7 Brown Input 6 Red Input 5 Orange Input 4 Yellow Input 3 Green Input 2 Blue Input 1 Gray Common Purple Optional KYZ Output Normally Closed 1 Black Common Brown Normally Open 1 Red Normally Closed 2 Orange Common Yellow Normally Open 2 Green Normally Closed 3 Blue Common Purple Normally Open 3 Gray Normally Closed 4 Light Green Common Pink Normally Open 4 White RS485 SHIELD Blue Tx/Rx+ Green Tx/Rx- Red RJ11 Modem Label Attached Electro Industries/GaugeTech Electro Industries/GaugeTech Color The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# Blue E151701 6-6 6: Hardware Installation Table 1: Cable Color Key Cable Signal Name Cable 6 Color RJ45 Ethernet Label Attached Cable 7 Blue Battery Label Attached Cable 8 Black Aux Power - DE Positive Red Neutral/Negative Black Aux Power - SE Std. Ext. Black Std. Ext. Black Table 6.1: Cable Color Key IMPORTANT NOTE! The Cable colors shown here are subject to change without notice. Refer to the CABLE LABELS for color code verification. 6.2: Internal Battery Installation and Maintenance CAUTION! - BATTERY INSTALLATION OR REPLACEMENT MUST BE DONE WITH POWER OFF! ATTENTION! - L'INSTALLATION OU LE REMPLACEMENT DE LA PILE DOIT ÊTRE FAIT SANS ALIMENTATION! Depending on its age, the Nexus® 1262/1272 meter could be equipped with either of two types of batteries: • Older meters are equipped with 3V Lithium cell BR2032. • Meters shipped after February, 2010 are equipped with 3V Lithium cell Panasonic BR3032. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 6-7 6: Hardware Installation Examine the specific meter and be sure to install the correct battery. Figure 6.5: Meter without Internal Shroud The Internal battery maintains NVRAM and time during outages. It is located on one of the vertical panels inside the Internal Shroud (see Figure 6.5). Under normal conditions, the battery should provide in excess of 10 years of service during storage conditions (disconnected from terminals) or when properly installed in an energized meter. The battery should provide more than one year of service during outage conditions (time on battery backup). A LOW BATTERY indicator on the display screen tells you when replacement is needed. Follow these steps to install the battery: 1. Before replacing the battery, download all memory files to your computer, as data may be lost. 2. Remove power from the meter. 3. Remove the external meter cover and the internal shroud. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 6-8 6: Hardware Installation 4. Remove the old battery with a screwdriver or similar tool. 5. Place the new battery in the battery holder. IMPORTANT! You must insert the replacement battery into the holder correctly. Otherwise proper contact will not be achieved and the meter may lose log memory and time functions. Figure 6.6: Battery Holder Detail a. Make sure the + on the battery is facing UP and toward you. b. Insert the RIGHT SIDE of the battery UNDER the 2 clips on the right side of the holder while gently pushing the battery against the INSIDE RIGHT WALL of the battery holder (Side A in Figure 6.6). c. Gently push the LEFT SIDE of the battery in until it snaps into place (Side B in Figure 6.6). 6. Replace the internal shroud and the external meter cover. 7. Power up the meter. 8. Reset meter time using Communicator software, unless IRIG-B is connected. (If IRIG-B is connected, time is synchronized automatically.) NOTE: Replacement of the Modem Battery is explained in Section 5.4.4. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 6-9 6: Hardware Installation 6.2.1: Battery Safety and Disposal Dispose of batteries in accordance with local, state and federal hazardous waste regulations. For disposal outside the United States, follow your country’s disposal guidelines. 6.3: Mounting the Optional External Displays The Nexus® 1262/1272 meter has its own LCD Display on the meter face. The optional Nexus® LED Displays: P40N+, P41N+ and P43N+ (as well as the legacy P40N) may be used where additional displays are desired. The dimensions of the P40N and P40N+ are different - see the figures on the next page. The display mounts using a standard ANSI C39.1 drill plan. Secure the four mounting studs to the back of the panel with the supplied hardware. See Chapter 9 for details on the external displays. Six feet of RS485 communication/power cable harness is supplied. Allow for at least a 1.25-inch (3.17cm) diameter hole in the mounting panel for the cable harness. See Chapter 5 for wiring details. The display is powered by an external power source, such as the PSIO, which supplies 12 VDC. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 6 - 10 6: Hardware Installation 4.38” Sq. (11.12 cm) NOTE: The P40N is not intended for new applications. .75” 1.438” Sq. (1.91 (3.65 cm) cm) P40N Front Dimensions P40N Side Dimensions Legacy P40N Dimensions P40N+ Front and Side Dimensions Figure 6.6: P40N/P40N+ Mounting Dimensions Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 6 - 11 6: Hardware Installation 3.375”/8.572cm 1.688”/ 4.287cm 4x 0.200”/ 0.508cm 3.375”/ 8.572cm 04.00”/10.16cm Figure 6.7: P40N/P40N+ ANSI Mounting Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 6 - 12 6: Hardware Installation 6.4: Mounting the Nexus® External I/O Modules Connect multiple I/O modules by inserting male RS485 side ports into female side ports, then screw each module into the next, using a flathead screwdriver. Work from left to right. Secure the mounting brackets to both ends of a group of I/O modules or both sides of an individual module, using the screws supplied (#440 pan-head screws). Next, secure the brackets to a flat surface using a #8 screw with a lock washer. 5.629”/14.30cm 3X 1.301”/3.305cm Mounting Bracket 1.125”/2.858cm .090”/.229cm Mounting Bracket 4.188”/10.638cm Figure 6.8: I/O Modules Mounting Diagram, Overhead View Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 6 - 13 6: Hardware Installation Mounting Brackets (MBIO) Female RS485 Side Port I/O Port (Size and Pin Configuration Vary) Male RS485 Side Port Figure 6.9: Single I/O Module with Mounting Brackets IMPORTANT! The Nexus® 1262/1272 meter does not supply power to the I/O modules. You must use an external power supply, such as the EIG PSIO (12V Output). Figure 6.11 shows mounting with the PSIO. Mounting Bracket Mounting Bracket 6.879”/13.088cm /N 0OWER)N . , 3.437”/8.729cm $!.'%2 0OWER3UPPLY 03)/ 2.200”/5.588cm -AX0OWER6! )NPUT6OLTAGE6$# 1.100”/2.54cm 6!#$# /UTPUT6OLTAGE6$# %LECTRO)NDUSTRIES'AUGE4ECH WWWELECTROINDCOM .618”/1.570cm 1.301”/3.305cm Figure 6.10: I/O Modules Mounting Dimensions, Front View Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 6 - 14 6: Hardware Installation 1.73”/4.4cm Figure 6.11: I/O Modules with PSIO Power Supply Refer to Figure 6.12 and Section 5.3.8 for PSIO and I/O Module wiring instructions. Auxiliary Power (PSIO) is supplied through pins 3 and 4 Connection though SHIELD, + and - to meter’s Port 4 072 072 3HIELD Figure 6.12: I/O Module Wiring Detail Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 6 - 15 6: Hardware Installation This page intentionally left blank. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 6 - 16 7LPHRI8VH)XQFWLRQ 7: Time-of-Use Function 7.1: Introduction $7LPHRI8VH728XVDJHVWUXFWXUHWDNHVLQWRDFFRXQWWKHTXDQWLW\RIHQHUJ\XVHG DQGWKHWLPHDWZKLFKLWZDVFRQVXPHG7KH1H[XVPHWHU¶V728 IXQFWLRQDYDLODEOHZLWKWKH&RPPXQLFDWRU(;7VRIWZDUHLVGHVLJQHGWRDFFRPPRGDWH DYDULHW\RISURJUDPPDEOHUDWHVWUXFWXUHV7KH728IXQFWLRQDFFXPXODWHVGDWDEDVHG RQWKHWLPHVFKHPHSURJUDPPHGLQWRWKH1H[XVPHWHU 6HHWKHCommunicator EXT User ManualIRUGHWDLOVRQSURJUDPPLQJWKH1H[XV PHWHU¶V728FDOHQGDUDQGUHWULHYLQJ728GDWD 7.2: The Nexus® Meter’s TOU Calendar $1H[XVPHWHU¶V728FDOHQGDUVHWVWKHSDUDPHWHUVIRU728GDWDDFFXPXODWLRQ<RX PD\VWRUHXSWRWZHQW\FDOHQGDUVLQWKH1H[XV0HWHUDQGDQXQOLPLWHGDPRXQWRI FDOHQGDUILOHVRQ\RXUFRPSXWHU 7KH728FDOHQGDUSURILOHDOORZV\RXWRDVVLJQDSURJUDPPDEOHXVDJHVFKHGXOH²HJ ³:HHNGD\´³:HHNHQG´³+ROLGD\´²WRHDFKGD\RIWKHFDOHQGDU\HDU<RXPD\FUHDWH XSWRGLIIHUHQW728VFKHGXOHV (DFK728VFKHGXOHGLYLGHVWKHKRXUGD\LQWRILIWHHQPLQXWHLQWHUYDOVIURP WR<RXPD\DSSO\RQHRIHLJKWGLIIHUHQWSURJUDPPDEOHUHJLV WHUV²HJ³3HDN´³2II3HDN´³6KRXOGHU3HDN´²WRHDFKILIWHHQPLQXWHLQWHUYDO 7KH1H[XVPHWHUVWRUHV $FFXPXODWLRQVRQDVHDVRQDOEDVLVXSWRIRXUVHDVRQVSHU\HDU $FFXPXODWLRQVRQDPRQWKO\EDVLV 6HDVRQDODQGPRQWKO\DFFXPXODWLRQVPD\VSDQRQH\HDULQWRWKHQH[W(DFKVHDVRQ DQGPRQWKLVGHILQHGE\DSURJUDPPDEOHVWDUWELOOLQJGDWHZKLFKLVDOVRWKHHQGGDWH RIWKHSULRUVHDVRQRUPRQWK $VHDVRQHQGVDWPLGQLJKWRIWKHGD\EHIRUHWKHVWDUWRIWKHQH[WVHDVRQ $PRQWKHQGVDWPLGQLJKWRIWKHPRQWK¶VELOOLQJGD\ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7LPHRI8VH)XQFWLRQ ,IWKH\HDUHQGVDQGWKHUHLVQRQHZFDOHQGDU728DFFXPXODWLRQVZLOOVWRS,ID FDOHQGDULVSUHVHQWIRUWKHIROORZLQJ\HDU728DFFXPXODWLRQVFRQWLQXHXQWLOWKHQH[W PRQWKO\ELOOGDWHRUQH[WVWDUWRIVHDVRQLVUHDFKHG$FFXPXODWLRQFDQVSDQLQWRWKH IROORZLQJ\HDU ,IQRIROORZLQJ\HDULVSUHVHQWWKHODVWDFFXPXODWLRQIRUWKH\HDUZLOOHQGRQ 7.3: TOU Frozen and Active Registers 7KH1H[XVPHWHUVWRUHVDFFXPXODWLRQVIRUWKHSULRUWLPHSHULRGV:KHQWKHHQGRID ELOOLQJSHULRGLVUHDFKHGWKH$FWLYHSHULRGRIWLPHEHFRPHVVWRUHGDV)UR]HQ7KH UHJLVWHUVDUHWKHQFOHDUHGDQGDFFXPXODWLRQVUHVXPHXVLQJWKHQH[WVHWRI728 VFKHGXOHVDQGUHJLVWHUDVVLJQPHQWVIURPWKHVWRUHGFDOHQGDU )UR]HQDQG$FWLYH$FFXPXODWLRQVDUHDOZD\VDYDLODEOH 7.4: Updating, Retrieving and Replacing TOU Calendars &RPPXQLFDWRU(;7VRIWZDUHUHWULHYHV728FDOHQGDUVIURPWKH1H[XVPHWHURUIURP WKHFRPSXWHU¶VKDUGGULYHIRUUHYLHZDQGHGLW 8SWRDPD[LPXPRIWZHQW\\HDUO\FDOHQGDUVFDQEHVWRUHGLQWKH1H[XVPHWHUDW DQ\JLYHQWLPH<RXPD\UHWULHYHWKHPRQHDWDWLPHDQHZFDOHQGDUFDQEHVWRUHG ZKLOHDFXUUHQWFDOHQGDULVLQXVH $FFXPXODWLRQVGRQRWVWRSGXULQJFDOHQGDUXSGDWHV,IDFDOHQGDULVUHSODFHGZKLOHLQ XVHWKHDFFXPXODWLRQVIRUWKHFXUUHQWSHULRGZLOOFRQWLQXHXQWLOWKHVHWHQGGDWH$W WKDWSRLQWWKHFXUUHQWWLPHZLOOEHFRPHWKHQHZVWDUWWLPHDQGWKHVHWWLQJVRIWKH QHZFDOHQGDUZLOOEHXVHG 5HVHWWKHFXUUHQWDFFXPXODWLRQVLI\RXUHSODFHDFDOHQGDULQXVH$UHVHWFOHDUVRQO\ WKHFXUUHQWDFFXPXODWLRQUHJLVWHUV7KLVFDXVHVWKHFXUUHQWDFFXPXODWLRQVWRXVHWKH SUHVHQWGDWHDVWKHVWDUWDQGDFFXPXODWHWRWKHQH[WQHZHQGGDWHZKLFKZLOOEH WDNHQIURPWKHQHZFDOHQGDU2QFHVWRUHGSULRUDFFXPXODWLRQVDUHDOZD\VDYDLODEOH DQGFDQQRWEHUHVHW6HHWKHCommunicator EXT User ManualIRULQVWUXFWLRQVRQ UHVHWWLQJ728DFFXPXODWLRQV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7LPHRI8VH)XQFWLRQ $WWKHHQGRIDGHILQHGSHULRGFXUUHQWDFFXPXODWLRQVDUHVWRUHGWKHUHJLVWHUVDUH FOHDUHGDQGDFFXPXODWLRQVIRUWKHQH[WSHULRGEHJLQ:KHQWKH\HDUERXQGDU\LV FURVVHGWKHVHFRQGFDOHQGDULISUHVHQWLVXVHG7RUHWDLQFRQWLQXLW\\RXKDYHXSWR RQH\HDUWRUHSODFHWKHROGFDOHQGDUZLWKRQHIRUWKHIROORZLQJ\HDU 7.5: Daylight Savings and Demand 7RXVH'D\OLJKW6DYLQJV7LPH\RXPXVWHQDEOHLWLQWKH1H[XVPHWHU¶V'HYLFH 3URILOH7LPH6HWWLQJV&OLFN$XWR'67ZKLFKVHWV'D\OLJKW6DYLQJV7LPHDXWRPDWLFDOO\ IRUWKH8QLWHG6WDWHV21/<<RXFDQDOVRVHOHFW8VHU'HILQHGDQGHQWHUWKHGHVLUHG GDWHVIRU'D\OLJKW6DYLQJV7LPH6HH&KDSWHULQWKHCommunicator EXT User ManualIRUGHWDLOV 7RVHW'HPDQG,QWHUYDOVIURPWKH'HYLFH3URILOHVHOHFWRevenue & Energy Settings > Demand Integration IntervalsDQGVHWWKHGHVLUHGLQWHUYDOV&OLFN OK 7RVHW&XPXODWLYH'HPDQG7\SHIURPWKH'HYLFH3URILOHFOLFNRevenue & Energy Settings > Cumulative Demand TypeDQGVHOHFW%ORFNRU5ROOLQJ:LQGRZ&OLFN OK Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7LPHRI8VH)XQFWLRQ 7KLVSDJHLQWHQWLRQDOO\OHIWEODQN Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7UDQVIRUPHU/RVV&RPSHQVDWLRQ 8: Transformer Line Loss Compensation 8.1: Introduction 7KH(GLVRQ(OHFWULF,QVWLWXWH V+DQGERRNIRU(OHFWULFLW\0HWHULQJ1LQWK(GLWLRQGHILQHV /RVV&RPSHQVDWLRQDV $PHDQVIRUFRUUHFWLQJWKHUHDGLQJRIDPHWHUZKHQWKHPHWHULQJSRLQWDQGSRLQWRI VHUYLFHDUHSK\VLFDOO\VHSDUDWHGUHVXOWLQJLQPHDVXUDEOHORVVHVLQFOXGLQJ,5ORVVHV LQFRQGXFWRUVDQGWUDQVIRUPHUVDQGLURQFRUHORVVHV7KHVHORVVHVPD\EHDGGHGWRRU VXEWUDFWHGIURPWKHPHWHUUHJLVWUDWLRQ /RVVFRPSHQVDWLRQPD\EHXVHGLQDQ\LQVWDQFHZKHUHWKHSK\VLFDOORFDWLRQRIWKH PHWHUGRHVQRWPDWFKWKHHOHFWULFDOORFDWLRQZKHUHFKDQJHRIRZQHUVKLSRFFXUV0RVW RIWHQWKLVDSSHDUVZKHQPHWHUVDUHFRQQHFWHGRQWKHORZ9ROWDJHVLGHRISRZHUWUDQV IRUPHUVZKHQWKHDFWXDORZQHUVKLSFKDQJHRFFXUVRQWKHKLJKVLGHRIWKHWUDQV IRUPHU7KLVFRQGLWLRQLVLOOXVWUDWHGLQ)LJXUH Ownership Change M )LJXUH/RZ9ROWDJH0HWHULQJ,QVWDOODWLRQ5HTXLULQJ/RVV&RPSHQVDWLRQ ,WLVJHQHUDOO\OHVVH[SHQVLYHWRLQVWDOOPHWHULQJHTXLSPHQWRQWKHORZ9ROWDJHVLGHRI DWUDQVIRUPHUDQGLQVRPHFRQGLWLRQVRWKHUOLPLWDWLRQVPD\DOVRLPSRVHWKHUHTXLUH PHQWRIORZVLGHPHWHULQJHYHQWKRXJKWKHDFWXDORZQHUVKLSFKDQJHRFFXUVRQWKH KLJK9ROWDJHVLGH 7KHQHHGIRUORVVFRPSHQVDWHGPHWHULQJPD\DOVRH[LVWZKHQWKHRZQHUVKLSFKDQJHV VHYHUDOPLOHVDORQJDWUDQVPLVVLRQOLQHZKHUHLWLVVLPSO\LPSUDFWLFDOWRLQVWDOOPHWHU LQJHTXLSPHQW2ZQHUVKLSPD\FKDQJHDWWKHPLGZD\SRLQWRIDWUDQVPLVVLRQOLQH ZKHUHWKHUHDUHQRVXEVWDWLRQIDFLOLWLHV,QWKLVFDVHSRZHUPHWHULQJPXVWDJDLQEH FRPSHQVDWHG7KLVFRQGLWLRQLVVKRZQLQ)LJXUH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7UDQVIRUPHU/RVV&RPSHQVDWLRQ M Point of Ownership Change )LJXUH-RLQW2ZQHUVKLS/LQH0HHWLQJ5HTXLULQJ/RVV&RPSHQVDWLRQ $VLQJOHPHWHUFDQQRWPHDVXUHWKHORVVHVLQDWUDQVIRUPHURUWUDQVPLVVLRQOLQH GLUHFWO\,WFDQKRZHYHULQFOXGHFRPSXWDWLRQDOFRUUHFWLRQVWRFDOFXODWHWKHORVVHV DQGDGGRUVXEWUDFWWKRVHORVVHVWRWKHSRZHUIORZPHDVXUHGDWWKHPHWHUORFDWLRQ 7KLVLVWKHPHWKRGXVHGIRUORVVFRPSHQVDWLRQLQWKH1H[XVPHWHU5HIHUWR$SSHQ GL[$LQWKLVPDQXDODQG$SSHQGL[%RIWKHCommunicator EXT User ManualIRU GHWDLOHGH[SODQDWLRQDQGLQVWUXFWLRQVIRUXVLQJWKH7UDQVIRUPHU/LQH/RVV&RPSHQVD WLRQIHDWXUHRIWKH1H[XVPHWHU 7KHFRPSXWDWLRQDOFRUUHFWLRQVXVHGIRUWUDQVIRUPHUDQGWUDQVPLVVLRQOLQHORVVFRP SHQVDWLRQDUHVLPLODU,QERWKFDVHVQRORDGORVVHVDQGIXOOORDGORVVHVDUHHYDOXDWHG DQGDFRUUHFWLRQIDFWRUIRUHDFKORVVOHYHOLVFDOFXODWHG+RZHYHUWKHFDOFXODWLRQRI WKHFRUUHFWLRQIDFWRUVWKDWPXVWEHSURJUDPPHGLQWRWKHPHWHUGLIIHUIRUWKHWZRGLI IHUHQWDSSOLFDWLRQV)RUWKLVUHDVRQWKHWZRPHWKRGRORJLHVZLOOEHWUHDWHGVHSDUDWHO\ LQWKLVFKDSWHU ,QWKH1H[XVPHWHU/RVV&RPSHQVDWLRQLVDWHFKQLTXHWKDWFRPSXWDWLRQDOO\ DFFRXQWVIRUDFWLYHDQGUHDFWLYHSRZHUORVVHV7KHPHWHUFDOFXODWLRQVDUHEDVHGRQ WKHIRUPXODVEHORZ7KHVHHTXDWLRQVGHVFULEHWKHDPRXQWRIDFWLYH:DWWVDQGUHDF WLYH9$5VSRZHUORVWGXHWRERWKLURQDQGFRSSHUHIIHFWVUHIOHFWHGWRWKHVHFRQGDU\ RIWKHLQVWUXPHQWWUDQVIRUPHUV 7RWDO6HFRQGDU\:DWW/RVV 0HDVXUHG9ROWDJH&DOSRLQW9ROWDJH[/:)(0HDVXUHG&XUUHQW&DO 3RLQW&XUUHQW[/:&8[)XOOVFDOH6HFRQGDU\9$ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7UDQVIRUPHU/RVV&RPSHQVDWLRQ 7RWDO6HFRQGDU\9$5/RVV 0HDVXUHG9ROWDJH&DOSRLQW9ROWDJH[/9)(0HDVXUHG&XUUHQW&DO 3RLQW&XUUHQW[/9&8[)XOOVFDOH6HFRQGDU\9$ 7KH9DOXHVIRU/:)(/:&8/9)(DQG/9&8DUHGHULYHGIURPWKHWUDQV IRUPHUDQGPHWHULQIRUPDWLRQDVGHPRQVWUDWHGLQWKHIROORZLQJVHFWLRQV 7KHFDOFXODWHGORVVFRPSHQVDWLRQYDOXHVDUHDGGHGWRRUVXEWUDFWHGIURPWKHPHD VXUHG:DWWVDQG9$5V7KHVHOHFWLRQRIDGGLQJRUVXEWUDFWLQJORVVHVLVPDGHWKURXJK WKHPHWHU VSURILOHZKHQSURJUDPPLQJWKHPHWHUVHHWKHIROORZLQJVHFWLRQIRU LQVWUXFWLRQV7KHPHWHUXVHVWKHFRPELQDWLRQRIWKHDGGVXEWUDFWVHWWLQJDQGWKH GLUHFWLRQDOGHILQLWLRQRISRZHUIORZDOVRLQWKHSURILOHWRGHWHUPLQHKRZWRKDQGOHWKH ORVVHV/RVVHVZLOOEHDGGHGWRRUVXEWUDFWHGIURPGHSHQGLQJRQZKHWKHUDGGRU VXEWUDFWLVVHOHFWHGWKH5HFHLYHG3RZHUIORZ)RUH[DPSOHLIORVVHVDUHVHWWR$GG WRDQGUHFHLYHGSRZHUHTXDOVN:DQGORVVHVDUHHTXDOWRN:WKHQWKHWRWDO PHWHUHGYDOXHZLWKORVVFRPSHQVDWLRQZRXOGEHN:IRUWKHVHVDPHVHWWLQJVLI WKHPHWHUPHDVXUHGN:RIGHOLYHUHGSRZHUWKHWRWDOPHWHUHGYDOXHZLWKORVV FRPSHQVDWLRQZRXOGEHN: 6LQFHWUDQVIRUPHUORVVFRPSHQVDWLRQLVWKHPRUHFRPPRQORVVFRPSHQVDWLRQPHWKRG WKHPHWHUKDVEHHQGHVLJQHGIRUWKLVDSSOLFDWLRQ/LQHORVVFRPSHQVDWLRQLVFDOFXODWHG LQWKHPHWHUXVLQJWKHVDPHWHUPVEXWWKHSHUFHQWYDOXHVDUHFDOFXODWHGE\DGLIIHUHQW PHWKRGRORJ\ 1H[XVPHWHUWUDQVIRUPHUORVVFRPSHQVDWLRQ 3HUIRUPVFDOFXODWLRQVRQHDFKSKDVHRIWKHPHWHUIRUHYHU\PHDVXUHPHQWWDNHQ XQEDODQFHGORDGVDUHKDQGOHGDFFXUDWHO\ &DOFXODWHVQXPHULFDOO\HOLPLQDWLQJWKHHQYLURQPHQWDOHIIHFWVWKDWFDXVHLQDFFXUD FLHVLQHOHFWURPHFKDQLFDOFRPSHQVDWRUV 3HUIRUPVELGLUHFWLRQDOORVVFRPSHQVDWLRQ 5HTXLUHVQRDGGLWLRQDOZLULQJWKHFRPSHQVDWLRQRFFXUVLQWHUQDOO\ ,PSRVHVQRDGGLWLRQDOHOHFWULFDOEXUGHQZKHQSHUIRUPLQJORVVFRPSHQVDWLRQ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7UDQVIRUPHU/RVV&RPSHQVDWLRQ /RVV&RPSHQVDWLRQLVDSSOLHGWRVHFRQGSHUSKDVH:DWW9$5UHDGLQJVDQGEHFDXVH RIWKDWDIIHFWVDOOVXEVHTXHQWUHDGLQJVEDVHGRQVHFRQGSHUSKDVH:DWW9$5UHDG LQJV7KLVPHWKRGUHVXOWVLQORVVFRPSHQVDWLRQEHLQJDSSOLHGWRWKHIROORZLQJTXDQWL WLHV 7RWDO3RZHU 'HPDQGVSHUSKDVHDQGWRWDO7KHUPDO%ORFN)L[HG:LQGRZ5ROOLQJ6OLGLQJ :LQGRZDQG3UHGLFWLYH:LQGRZ 0D[LPXPDQGPLQLPXP'HPDQGV (QHUJ\DFFXPXODWLRQV .<=RXWSXWRI(QHUJ\DFFXPXODWLRQV NOTE/RVV&RPSHQVDWLRQLVGLVDEOHGZKHQWKHPHWHULVSODFHGLQ7HVW0RGH 8.2: Nexus® 1262/1272 Meter's Transformer Loss Compensation 7KH1H[XVPHWHUSURYLGHVFRPSHQVDWLRQIRUDFWLYHDQGUHDFWLYHSRZHUTXDQWLWLHVE\ SHUIRUPLQJQXPHULFDOFDOFXODWLRQV7KHIDFWRUVXVHGLQWKHVHFDOFXODWLRQVDUHGHULYHG HLWKHU %\FOLFNLQJWKH7/&&DOFXODWRUEXWWRQRQWKH7UDQVIRUPHU/RVVVFUHHQRIWKH'HYLFH 3URILOHWRRSHQWKH(,*/RVV&RPSHQVDWLRQ&DOFXODWRULQ0LFURVRIW([FHO %\ILJXULQJWKHYDOXHVIURPWKHZRUNVKHHWVKRZQKHUHDQGLQ$SSHQGL[%RIWKH Communicator EXT User Manual (LWKHUZD\\RXHQWHUWKHGHULYHGYDOXHVLQWRWKH&RPPXQLFDWRU(;7VRIWZDUH WKURXJKWKH'HYLFH3URILOH7UDQVIRUPHUDQG/LQH/RVV&RPSHQVDWLRQVFUHHQ 7KH&RPPXQLFDWRU(;7VRIWZDUHDOORZV\RXWRHQDEOHWUDQVIRUPHUORVVFRPSHQVDWLRQ IRUORVVHVGXHWRFRSSHUDQGLURQLQGLYLGXDOO\RUVLPXOWDQHRXVO\/RVVHVFDQHLWKHUEH DGGHGWRRUVXEWUDFWHGIURPPHDVXUHGUHDGLQJV5HIHUWR$SSHQGL[%LQWKHCommunicator EXT User ManualIRULQVWUXFWLRQV /RVVFRPSHQVDWLRQYDOXHVPXVWEHFDOFXODWHGEDVHGRQWKHPHWHULQVWDOODWLRQ$VD UHVXOWWUDQVIRUPHUORVVYDOXHVPXVWEHQRUPDOL]HGWRWKHPHWHUE\FRQYHUWLQJWKH EDVH9ROWDJHDQGFXUUHQWDQGWDNLQJLQWRDFFRXQWWKHQXPEHURIHOHPHQWVXVHGLQWKH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7UDQVIRUPHU/RVV&RPSHQVDWLRQ PHWHULQJLQVWDOODWLRQ)RUWKUHHHOHPHQWPHWHUVWKHLQVWDOODWLRQPXVWEHQRUPDOL]HG WRWKHSKDVHWRQHXWUDO9ROWDJHDQGWKHSKDVHFXUUHQWLQWZRHOHPHQWPHWHUVWKH LQVWDOODWLRQPXVWEHQRUPDOL]HGWRWKHSKDVHWRSKDVH9ROWDJHDQGWKHSKDVHFXUUHQW 7KLVSURFHVVLVGHVFULEHGLQWKHIROORZLQJVHFWLRQV 8.2.1: Loss Compensation in Three Element Installations /RVVFRPSHQVDWLRQLVEDVHGRQWKHORVVDQGLPSHGDQFHYDOXHVSURYLGHGRQWKHWUDQV IRUPHUPDQXIDFWXUHU VWHVWUHSRUW$W\SLFDOWHVWUHSRUWZLOOLQFOXGHDWOHDVWWKHIROORZ LQJLQIRUPDWLRQ 0DQXIDFWXUHU 8QLWVHULDOQXPEHU 7UDQVIRUPHU09$UDWLQJ6HOI&RROHG 7HVW9ROWDJH 1RORDGORVVZDWWV /RDGORVVZDWWVRUIXOOORDGORVVZDWWV ([FLWLQJFXUUHQW#9ROWDJH ,PSHGDQFH 7KHWUDQVIRUPHU09$UDWLQJLVJHQHUDOO\WKHORZHVW09$UDWLQJWKHVHOIFRROHGRU2$ UDWLQJRIWKHWUDQVIRUPHUZLQGLQJ7KHWHVW9ROWDJHLVJHQHUDOO\WKHQRPLQDO9ROWDJH RIWKHVHFRQGDU\RUORZ9ROWDJHZLQGLQJ)RUWKUHHSKDVHWUDQVIRUPHUVWKHVHYDOXHV ZLOOW\SLFDOO\EHWKHWKUHHSKDVHUDWLQJDQGWKHSKDVHWRSKDVH9ROWDJH$OORIWKHWHVW PHDVXUHPHQWVDUHEDVHGRQWKHVHWZRQXPEHUV3DUWRIWKHSURFHVVRIFDOFXODWLQJWKH ORVVFRPSHQVDWLRQSHUFHQWDJHVLVFRQYHUWLQJWKHWUDQVIRUPHUORVVYDOXHVEDVHGRQWKH WUDQVIRUPHUUDWLQJVWRWKHEDVHXVHGE\WKHPHWHU &RUUHFWFDOFXODWLRQRIORVVFRPSHQVDWLRQDOVRUHTXLUHVNQRZOHGJHRIWKHPHWHU LQVWDOODWLRQ,QRUGHUWRFDOFXODWHWKHORVVFRPSHQVDWLRQVHWWLQJV\RXZLOOQHHGWKH IROORZLQJLQIRUPDWLRQUHJDUGLQJWKHPHWHUDQGWKHLQVWDOODWLRQ 1XPEHURIPHWHUHOHPHQWV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7UDQVIRUPHU/RVV&RPSHQVDWLRQ 3RWHQWLDOWUDQVIRUPHUUDWLR375 &XUUHQWWUDQVIRUPHUUDWLR&75 0HWHUEDVH9ROWDJH 0HWHUEDVHFXUUHQW 7KLVVHFWLRQLVOLPLWHGWRDSSOLFDWLRQRI1H[XVPHWHUVWRWKUHHHOHPHQWPHWHULQJ LQVWDOODWLRQV$VDUHVXOWZHNQRZWKDW 1XPEHURIPHWHULQJHOHPHQWV 0HWHUEDVH9ROWDJH 9ROWV 0HWHUEDVHFXUUHQW $PSV 8.2.1.1: Three-Element Loss Compensation Worksheet Table 1: &RPSDQ\ 6WDWLRQ 1DPH 'DWH 7UI%DQN 1R 7UI0DQI 7UI6HULDO 1R &DOFXODWLRQ E\ 7UDQVIRUPHU'DWDIURP7UDQVIRUPHU0DQXIDFWXUHU V7HVW6KHHW Table 2: Winding Voltage MVA Connection +9+LJK ¨< ;9/RZ ¨< <97HUWLDU\ ¨< Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7UDQVIRUPHU/RVV&RPSHQVDWLRQ Table 3: Value Watts Loss 3KDVH 3KDVH 3KDVHN: 1R/RDG/RVV /RDG/RVV (QWHU3KDVHRU3KDVHYDOXHV,I3KDVHYDOXHVDUHHQWHUHGFDOFXODWH3KDVH YDOXHVE\GLYLGLQJ3KDVHYDOXHVE\WKUHH&RQYHUW3KDVH/RVV:DWWVWR3KDVH N:E\GLYLGLQJ3KDVH/RVV:DWWVE\ Table 4: Value 3-Phase MVA 1-Phase MVA 1-Phase kVA 6HOI&RROHG5DWLQJ (QWHU3KDVHRU3KDVHYDOXHV,I3KDVHYDOXHVDUHHQWHUHGFDOFXODWH3KDVH YDOXHVE\GLYLGLQJ3KDVHYDOXHVE\WKUHH&RQYHUW3KDVH6HOI&RROHG09$WR 3KDVHN9$E\PXOWLSO\LQJE\ Table 5: ([FLWLQJ&XUUHQW ,PSHGDQFH Table 6: 9DOXH 3KDVHWR3KDVH 3KDVHWR1HXWUDO 7HVW9ROWDJH9ROWV )XOO/RDG&XUUHQW$PSV 7HVW9ROWDJHLVJHQHUDOO\3KDVHWR3KDVHIRUWKUHHSKDVHWUDQVIRUPHUV&DOFXODWH 3KDVHWR1HXWUDO9ROWDJHE\GLYLGLQJ3KDVHWR3KDVH9ROWDJHE\WKHVTXDUHURRWRI &DOFXODWH)XOO/RDG&XUUHQWE\GLYLGLQJWKH3KDVHN:6HOI&RROHG5DWLQJE\WKH 3KDVHWR1HXWUDO9ROWDJHDQGPXOWLSO\LQJE\ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7UDQVIRUPHU/RVV&RPSHQVDWLRQ Meter/Installation Data Table 7: ,QVWUXPHQW7UDQVIRUPHUV 1XPHUDWRU 'HQRPLQDWRU 0XOWLSOLHU 3RWHQWLDO7UDQVIRUPHUV &XUUHQW7UDQVIRUPHUV 3RZHU0XOWLSOLHU>370XOWLSOLHU[&70XOWLSOLHU@ (QWHUWKH1XPHUDWRUDQG'HQRPLQDWRUIRUHDFKLQVWUXPHQWWUDQVIRUPHU)RUH[DPSOH D37ZLWKDUDWLRRIKDVDQXPHUDWRURUDGHQRPLQDWRURUDQGD PXOWLSOLHURI Table 8: 0HWHU6HFRQGDU\9ROWDJH9ROWV 0HWHU6HFRQGDU\&XUUHQW$PSV Base Conversion Factors Table 9: 4XDQWLW\ 7UDQV IRUPHU 0XOWLSOLHU 7UI,76HF 0HWHU%DVH 9ROWDJH &XUUHQW 0HWHU7UI )RU7UDQVIRUPHU9ROWDJHHQWHUWKH3KDVHWR1HXWUDOYDOXHRI7HVW9ROWDJHSUHYLRXVO\ FDOFXODWHG)RU7UDQVIRUPHU&XUUHQWHQWHUWKH)XOO/RDG&XUUHQWSUHYLRXVO\FDOFX ODWHG)RU0XOWLSOLHUVHQWHUWKH37DQG&7PXOWLSOLHUVSUHYLRXVO\FDOFXODWHG 7UI,76HFRQGDU\LVWKH%DVH9DOXHRI9ROWDJHDQG&XUUHQWDWWKH,QVWUXPHQW7UDQV IRUPHU6HFRQGDU\RIWKH3RZHU7UDQVIRUPHU7KHVHQXPEHUVDUHREWDLQHGE\GLYLGLQJ WKH7UDQVIRUPHU9ROWDJHDQG&XUUHQWE\WKHLUUHVSHFWLYH0XOWLSOLHUV7KH0HWHU7UI YDOXHVIRU9ROWDJHDQG&XUUHQWDUHREWDLQHGE\GLYLGLQJWKH0HWHU%DVHYDOXHVE\WKH 7UI,76HFRQGDU\YDOXHV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7UDQVIRUPHU/RVV&RPSHQVDWLRQ /RDG/RVVDW7UDQVIRUPHU No-Load Loss Watts (kW) 3KDVHN:1R/RDG/RVV BBBBBBBBBBBBBB No-Load Loss VA (kVA) ([FLWLQJ&XUUHQW3KDVHN9$6HOI&RROHG5DWLQJ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBN9$ No-Load Loss VAR (kVAR) 64571R/RDG/RVVN9$1R/RDG/RVVN: 6457BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 6457BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 6457BBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBB Full-Load Loss Watts (kW) 3KDVH.Z/RDG/RVV BBBBBBBBBBBBBB Full-Load Loss VA (kVA) ,PSHGDQFH3KDVHN9$6HOI&RROHG5DWLQJ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBN9$ Full-Load Loss VAR (kVAR) 6457)XOO/RDG/RVVN9$)XOO/RDG/RVVN: 6457BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 6457BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 6457BBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBB Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7UDQVIRUPHU/RVV&RPSHQVDWLRQ 1RUPDOL]H/RVVHVWR0HWHU%DVH Table 10: 4XDQWLW\ 9DOXH DW7UI %DVH 07)DFWRU 07)DFWRU 9DOXH ([S 1R/RDG /RVVN: 9 ́2 1R/RDG /RVVN9$5 9 ́4 /RDG/RVV N: ́2 /RDG/RVV N9$5 ́2 07)DFWRU Z([S 9DOXH DW 0HWHU %DVH (QWHU9DOXHDW7UDQVIRUPHU%DVHIRUHDFKTXDQWLW\IURPFDOFXODWLRQVDERYH(QWHU 0HWHU7UI)DFWRUYDOXHIURP%DVH&RQYHUVLRQ)DFWRUFDOFXODWLRQVDERYH&DOFXODWH07 )DFWRUZLWK([SRQHQWE\UDLVLQJWKH07)DFWRUWRWKHSRZHULQGLFDWHGLQWKH([SRU ([SRQHQWFROXPQ &DOFXODWHWKH9DOXHDW0HWHU%DVHE\PXOWLSO\LQJWKH07)DFWRUZ([SWLPHVWKH 9DOXHDW7UI%DVH /RVV:DWWV3HUFHQWDJH9DOXHV Meter Base kVA 370XOWLSOLHU&70XOWLSOLHU BBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBB Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7UDQVIRUPHU/RVV&RPSHQVDWLRQ &DOFXODWH/RDG/RVV9DOXHV Table 11: 4XDQWLW\ 9DOXHDW 0HWHU%DVH 0HWHU%DVH N9$ /RVVDW 0HWHU%DVH 4XDQWLW\ 1R/RDG /RVVN: /RVV :DWWV)( 1R/RDG /RVVN9$5 /RVV 9$5V)( /RDG/RVV N: /RVV :DWWV&8 /RDG/RVV N9$5 /RVV 9$5V&8 (QWHU9DOXHDW0HWHU%DVHIURP1RUPDOL]H/RVVHVVHFWLRQ(QWHU0HWHU%DVHN9$ IURPSUHYLRXVFDOFXODWLRQ&DOFXODWH/RVVDW0HWHU%DVHE\GLYLGLQJ9DOXHDW 0HWHU%DVHE\0HWHU%DVHN9$DQGPXOWLSO\LQJE\ (QWHUFDOFXODWHG/RVV:DWWVYDOXHVLQWRWKH1H[XVPHWHUXVLQJ&RPPXQLFDWRU (;7VRIWZDUH5HIHUWR$SSHQGL[%RIWKHCommunicator EXT User ManualIRU LQVWUXFWLRQV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 7UDQVIRUPHU/RVV&RPSHQVDWLRQ 7KLVSDJHLQWHQWLRQDOO\OHIWEODQN Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 8VLQJWKH([WHUQDO'LVSOD\V 9: Using the External Displays 9.1: Overview 7KH1H[XV6RFNHWPHWHUVKDYHDEDFNOLW/&'GLVSOD\EXLOWLQWRWKH PHWHU,QDGGLWLRQ(OHFWUR,QGXVWULHVRIIHUVDQRSWLRQDOH[WHUQDOGLVSOD\SRZHUHGE\ DQDGGLWLRQDOSRZHUVXSSO\VXFKDVWKH36,27KH31DQGWKHOHJDF\31LV DQ/('GLVSOD\WKDWSURYLGHVHDV\WRXVHDFFHVVWRWKHLQIRUPDWLRQVWRUHGLQWKH 1H[XVPHWHU 3OXJWKH1H[XVH[WHUQDOGLVSOD\LQWRWKH3RUWRU3RUWZLULQJFRQQHFWLRQXVLQJWKH 56FDEOHVXSSOLHGVHH&KDSWHUIRUZLULQJGHWDLOV7KHGLVSOD\RSHUDWHVDW EDXG7RXVHWKHGLVSOD\RQDQRWKHUSRUWFRQILJXUHWKDWSRUWWRRSHUDWHDWEDXG XVLQJ&RPPXQLFDWRU(;7VRIWZDUHVHHWKHCommunicator EXT User Manual IRU LQVWUXFWLRQV 9.2: Nexus® P40N/P40N+ LED External Display 7KH1H[XV3131/('H[WHUQDOGLVSOD\KDVWKUHHPRGHV '\QDPLF5HDGLQJV0RGHVHFWLRQVDQG 1H[XV,QIRUPDWLRQ0RGHVHFWLRQVDQG 'LVSOD\)HDWXUHV0RGHVHFWLRQVDQG (DFK0RGHLVGLYLGHGLQWR*URXSV0RVW*URXSVDUHIXUWKHUEURNHQGRZQLQWR 5HDGLQJV 8VHWKH02'(EXWWRQWRVFUROOEHWZHHQ0RGHV 8VHWKH83'2:1DUURZVWRVFUROOIURP*URXSWR*URXSZLWKLQHDFK0RGH 8VHWKH/()75,*+7DUURZVWRVFUROOIURP5HDGLQJWR5HDGLQJZLWKLQHDFK*URXS 8VH&RPPXQLFDWRU(;7VRIWZDUHWR)ODVK8SGDWHWKH3131H[WHUQDOGLVSOD\ 6HHWKHCommunicator EXT User ManualIRULQVWUXFWLRQV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 8VLQJWKH([WHUQDO'LVSOD\V 7KH1H[XV31/('H[WHUQDOGLVSOD\KDVD86%SRUWRQWKHIURQWIRUGLUHFWGDWD GRZQORDGV<RXFDQFRQQHFWWRWKH86%SRUWZLWK&RPPXQLFDWRU(;7WRSROODQGFRQ ILJXUHWKHPHWHUDWWDFKHGWRWKHGLVSOD\7RXVHWKH86%IROORZWKHVHLQVWUXFWLRQV 8VHWKH1H[XV6HULHV3URGXFW&'VKLSSHGZLWK\RXUPHWHUWRLQVWDOOWKH &RPPXQLFDWRU(;7VRIWZDUHDQGWKHGULYHUIRUWKH3186%SRUW D,QVHUWWKH&'LQWR\RXU3& V&'GULYH7KHVFUHHQVKRZQEHORZRSHQVLQ\RXU %URZVHU E&OLFNWKHNexus® Technical DocumentsEXWWRQ7KHIROORZLQJVFUHHQRSHQVLQ \RXU%URZVHU Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 8VLQJWKH([WHUQDO'LVSOD\V F7RLQVWDOO&RPPXQLFDWRU(;7VRIWZDUHDQGWKHGULYHUIRUWKH31 L&OLFNRQWKHCommunicator EXT 3.0EXWWRQDQGFOLFNRun LQWKH ZLQGRZWKDWRSHQV7KHVRIWZDUHLVLQVWDOOHG LL&OLFNRQWKHUSB DriverEXWWRQFOLFNRun LQWKHZLQGRZWKDWRSHQV 7KH31GULYHULVLQVWDOOHG &RQQHFWWKH86%FDEOHIURP \RXU3&WRWKHSRUWXVLQJD 86$$0DOHWR86%%0DOH FDEOHDWWDFKWKH86%$ FRQQHFWRUWRWKH3&DQG DWWDFKWKH86%%FRQQHFWRU WRWKH3186%SRUW6HH )LJXUH )LJXUH86%%0DOH&RQQHFWRUDQG3186%3RUW Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 8VLQJWKH([WHUQDO'LVSOD\V 2QFHWKH86%FDEOHLVFRQQHFWHGWRWKH31WKHGLVSOD\FOHDUVDQGWKHPHVVDJH ³86%LQ8VH´VFUROOVDWWKHERWWRPRIWKHGLVSOD\$GGLWLRQDOO\WKH86%/('LFRQ OLJKWVXSZKHQWKH86%FRQQHFWLRQLVEHLQJXVHG <RXFRQQHFWWRWKH86%SRUWXVLQJ&RPPXQLFDWRU(;7VRIWZDUHWKHVDPHZD\\RX FRQQHFWWRDPHWHUZLWKWKHVRIWZDUH)ROORZWKHVHLQVWUXFWLRQV 'HWHUPLQHZKLFKSRUWWKH3& V86%LVXVLQJ D2Q\RXU3&FOLFNStart>Settings>Control Panel E'RXEOHFOLFNWKHSystemIROGHU F&OLFNWKHHardwareWDE<RXZLOOVHHWKHVFUHHQEHORZ G&OLFNWKHDevice ManagerEXWWRQ<RXZLOOVHHDOLVWRIWKHFRPSXWHU VKDUGZDUH GHYLFHV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 8VLQJWKH([WHUQDO'LVSOD\V H&OLFNWKHSOXVVLJQQH[WWR3RUWV&20/377KH&20SRUWVDUHGLVSOD\HG1RWH WKH&20QXPEHUIRUWKH86%6HULDO3RUW7KLVLVWKHQXPEHU\RXZLOOXVHWR FRQQHFWWRWKH31WKURXJK&RPPXQLFDWRU(;76HHWKHILJXUHEHORZ 2SHQ&RPPXQLFDWRU(;7VRIWZDUHDQGFOLFNWKHConnectLFRQLQWKH,FRQEDU6HH WKHVFUHHQVKRZQEHORZ &OLFNWKHSerial PortEXWWRQLILW¶VQRWDOUHDG\VHOHFWHG 6HWWKH%DXG5DWHWR,WXVHVEHFDXVHLWVKDUHVDQH[LVWLQJ&RPSRUW IRUGLVSOD\HGUHDGLQJV &OLFNWKHAvailable PortsEXWWRQDQGVHOHFWWKH86%&203RUWQXPEHUIURPWKH GURSGRZQOLVW 3URWRFROVKRXOGEH0RGEXV578 )ORZ&RQWUROVKRXOGEH1RQH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 8VLQJWKH([WHUQDO'LVSOD\V (FKR0RGHVKRXOGEH1R(FKR &OLFNConnect7KHVRIWZDUHFRQQHFWVWRWKHPHWHUWKURXJKWKH315HIHUWR WKHCommunicator EXT User's ManualIRUSURJUDPPLQJLQVWUXFWLRQV&OLFN Help>ContentsIURPWKH&RPPXQLFDWRU(;77LWOH%DUWRYLHZWKHPDQXDORQOLQH 9.3: Dynamic Readings Mode 7KH([WHUQDO'LVSOD\SXWVLWVHOILQWKH'\QDPLF5HDGLQJV0RGHXSRQSRZHUXS8VH WKH02'(EXWWRQWRDFFHVVWKH'\QDPLF5HDGLQJVIURPRWKHU0RGHV8VHWKH83 '2:1DUURZVWRQDYLJDWHIURP*URXSWR*URXSZLWKLQWKLV0RGH6HH6HFWLRQIRU D1DYLJDWLRQPDSRIWKH'\QDPLF5HDGLQJV0RGH Group 1: Phase to Neutral Voltages8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKH IROORZLQJUHDGLQJVLQRUGHU 9ROWV$1%1&1 0D[LPXP9ROWV$1%1&1 0LQLPXP9ROWV$1%1&1 9ROWV$1%1&17+' 9ROWV$1%1&10D[LPXP7+' 9ROWV$1%1&10LQLPXP7+' Group 2: Phase to Phase Voltages8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZ LQJUHDGLQJVLQRUGHU 9ROWV$%%&&$ 0LQLPXP9ROWV$%%&&$ 0D[LPXP9ROWV$%%&&$ Group 3: Current8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZLQJUHDGLQJVLQ RUGHU &XUUHQW$%& Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 8VLQJWKH([WHUQDO'LVSOD\V 0D[LPXP&XUUHQW 0LQLPXP&XUUHQW &XUUHQW7+' &XUUHQW0D[LPXP7+' &XUUHQW0LQLPXP7+' &XUUHQW&DOFXODWHG10HDVXUHG1 0D[LPXP&XUUHQW&DOFXODWHG10HDVXUHG1 Group 4: Watt/VAR8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZLQJUHDGLQJVLQ RUGHU N:DWWN9$5 0D[LPXPN:DWWN9$5&R,QN9$5 0D[LPXPN:DWWN9$5&R,QN9$5 %ORFN)L[HG:LQGRZ$YHUDJH0D[LPXPN:DWWN9$5&R,QN9$5 3UHGLFWLYH5ROOLQJ6OLGLQJ:LQGRZ0D[LPXPN:DWWN9$5&R,QN9$5 Group 5:VA/PF/Frequency8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZLQJUHDG LQJVLQRUGHU N9$3)ODJ+] 0D[LPXPN9$+] 0LQLPXPN9$+] 0D[LPXP4XDGUDQW7RWDO3) 0LQLPXP4XDGUDQW7RWDO3) 0D[LPXP4XDGUDQW7RWDO3) 0LQLPXP4XDGUDQW7RWDO3) Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 8VLQJWKH([WHUQDO'LVSOD\V 0D[LPXP4XDGUDQW7RWDO3) 0LQLPXP4XDGUDQW7RWDO3) 0D[LPXP4XDGUDQW7RWDO3) 0LQLPXP4XDGUDQW7RWDO3) Group 6: Delivered Energy8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZLQJUHDG LQJVLQRUGHU N:DWWKU4XDGUDQW4XDGUDQW3ULPDU\ N9$5KU4XDGUDQW3ULPDU\ N9$5KU4XDGUDQW3ULPDU\ Group 7: Received Energy8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZLQJUHDG LQJVLQRUGHU N:DWWKU4XDGUDQW4XDGUDQW3ULPDU\ N9$5KU4XDGUDQW3ULPDU\ N9$5KU4XDGUDQW3ULPDU\ Group 8: Accumulations8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZLQJUHDG LQJVLQRUGHU N,W$ N,W% N,W& N9W$ N9W% N9W& Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 8VLQJWKH([WHUQDO'LVSOD\V Group 9: Phase Angles8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZLQJUHDGLQJV LQRUGHU 3KDVH$QJOH9DQEQFQ 3KDVH$QJOH,DEF 3KDVH$QJOH9DEEFFD 3KDVH6HTXHQFH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 8VLQJWKH([WHUQDO'LVSOD\V 9.4: Navigation Map of Dynamic Readings Mode 8VH/HIW5LJKWDUURZNH\VWRQDYLJDWH5HDGLQJV 8VH8S'RZQDUURZVWRVFUROOEHWZHHQJURXSV 5HDGLQJV * U R X S V 1 Second Volts AN,BN,CN Maximum Volts AN,BN,CN Minimum Volts AN,BN,CN %THD Volts AN,BN,CN 1 Second Volts AB,BC,CA Minimum Volts AB,BC,CA Maximum Volts AB,BC,CA Return to First Reading 1 Second IA,IB,IC Maximum IA,IB,IC 1 Second kWatt, kVAR +Max kWatt, +kVAR,CoIn kVAR 1 Second kVA, PF lag, Frequency Max kVA, Freq Positive kWatthour Q1+Q4 Min kVA, Freq Minimum IA,IB,IC %THD IA,IB,IC -Max kWatt, -kVAR,CoIn kVAR Block WinAvg Max +kWatt, +kVAR,CoIn kVAR Max Q1, Total PF Positive kVARhr Q1 Min Q1, Total PF Max Q2, Total PF Negative kVARhr Q4 Return to First Reading Negative kWatthr Q2+Q3 Positive kVARhr Q2 Negative kVARhr Q3 Return to First Reading 2 kI t A 2 kI t B 2 kI t C 2 kV t A Phase Angles V AN,BN,CN Phase Angles I A,B,C Max %THD IA,IB,IC Phase Angles V AB,BC,CA Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Max %THD Volts AN,BN,CN Min %THD Volts AN,BN,CN Min %THD IA,IB,IC 1 Second INc,INm Pred Roll Win Avg +kWatt, +kVAR,CoIn kVAR Min Q2, Total PF Max Q3, Total PF 2 kV t B Phase Sequence 'RF# Return to First Reading Return to First Reading Return to First Reading Min Q3, Total PF 2 kV t C Min Q4, Total PF Min Q4, Total PF Return to First Reading Return to First Reading Return to First Reading ( 8VLQJWKH([WHUQDO'LVSOD\V 9.5: Nexus® Information Mode 8VHWKH02'(EXWWRQWRDFFHVVWKH1H[XV,QIRUPDWLRQ0RGHIURPRWKHU0RGHV8VH WKH83'2:1DUURZVWRQDYLJDWHIURP*URXSWR*URXSZLWKLQWKLV0RGH6HH6HFWLRQ IRUD1DYLJDWLRQPDSRIWKH1H[XV,QIRUPDWLRQ0RGH Group 1: Device Time 0HWHU7LPH Group 2: Communication Settings8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZ LQJUHDGLQJVLQRUGHU &RPPXQLFDWLRQ6HWWLQJV3RUW%DXG$GGU3URWRFRO &RPPXQLFDWLRQ6HWWLQJV3RUW%DXG$GGU3URWRFRO &RPPXQLFDWLRQ6HWWLQJV3RUW%DXG$GGU3URWRFRO &RPPXQLFDWLRQ6HWWLQJV3RUW%DXG$GGU3URWRFRO Group 3: PT/CT Ratios8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZLQJUHDGLQJV LQRUGHU 375DWLR &75DWLR Group 4: External Display Units 3ULPDU\6HFRQGDU\ 6HOHFWHLWKHU3ULPDU\RU6HFRQGDU\XQLWVIRUWKH([WHUQDO'LVSOD\XVLQJWKH&RPPXQL FDWRU(;7VRIWZDUHVHHWKHCommunicator EXT User Manual :KHQ3ULPDU\LVVHOHFWHGWKH'LVSOD\VKRZVDOOUHDGLQJVLQ3ULPDU\XQLWVEDVHGRQ WKHXVHUSURJUDPPHG37DQG&75DWLRV :KHQ6HFRQGDU\LVVHOHFWHGWKH'LVSOD\VKRZVDOOUHDGLQJVLQ6HFRQGDU\XQLWV Group 5: Firmware Versions and Serial Numbers8VHWKH/HIW5LJKWDUURZVWR DFFHVVWKHIROORZLQJUHDGLQJVLQRUGHU Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 8VLQJWKH([WHUQDO'LVSOD\V 5XQ7LPH([WHUQDO'LVSOD\5XQ7LPH'635XQ7LPH&RPP %RRW([WHUQDO'LVSOD\%RRW'63%RRW&RPP 6HULDO1XPEHU([WHUQDO'LVSOD\6HULDO1XPEHU1H[XV0RQLWRU Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 8VLQJWKH([WHUQDO'LVSOD\V 9.6: Navigation Map of Nexus Information Mode 8VH/HIW5LJKWDUURZNH\VWRQDYLJDWH5HDGLQJV 8VH8S'RZQDUURZVWRVFUROOEHWZHHQJURXSV 5HDGLQJV * U R X S V Meter Time Comm Settings Port 1 Comm Settings Port 2 PT Ratio CT Ratio Return To First Reading Boot Display, DSP, Comm Serial # Display, Serial # Monitor Comm Settings Port 3 Return To First Reading Comm Settings Port 4 Display Primary/Secondary Run-time Display, DSP, Comm Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Return To First Reading 'RF# ( 8VLQJWKH([WHUQDO'LVSOD\V 9.7: Display Features Mode 8VHWKH0RGHEXWWRQWRDFFHVVWKH'LVSOD\)HDWXUHV0RGHIURPRWKHUPRGHV8VHWKH 8S'RZQDUURZVWRQDYLJDWHIURPJURXSWRJURXSZLWKLQWKLVPRGH6HH6HFWLRQ IRUD1DYLJDWLRQPDSRIWKH'LVSOD\)HDWXUHVPRGH Group 1: Reset Max/Min 3UHVVEnterWRUHVHWWKH0D[DQG0LQYDOXHV NOTE,IWKH3DVVZRUG3URWHFWLRQIHDWXUHKDVEHHQHQDEOHGWKURXJK&RPPXQLFDWRU (;7VRIWZDUH\RXZLOOQHHGWRHQWHUDSDVVZRUGWRUHVHWWKH0D[0LQUHDGLQJV)ROORZ WKLVSURFHGXUH 3UHVVEnter (QWHUWKHSDVVZRUGRQHFKDUDFWHUDWDWLPHE\SUHVVLQJWKH8SRU'RZQDUURZV (DFKSDVVZRUGFKDUDFWHUEHJLQVDVDQ$3UHVVWKH8SDUURZWRLQFUHPHQWWKH FKDUDFWHUIURP$=DQGWKHQIURP3UHVVWKH'RZQDUURZWRGHFUHPHQWWKH FKDUDFWHUIURP$WRDQGWKHQIURP=$ 3UHVVSetWRHQWHUHDFKFKDUDFWHULQWKHSDVVZRUG :KHQWKHHQWLUHSDVVZRUGLVVKRZQRQWKH'LVSOD\VFUHHQSUHVVEnter 2QFHWKHSDVVZRUGLVHQWHUHGFRUUHFWO\SUHVVEnterDJDLQWRUHVHWWKH0D[0LQ YDOXHV Group 2: Reset Energy 3UHVVEnterWRUHVHWWKH(QHUJ\UHDGLQJV NOTE,IWKH3DVVZRUG3URWHFWLRQIHDWXUHKDVEHHQHQDEOHGWKURXJK&RPPXQLFDWRU (;7VRIWZDUH\RXZLOOQHHGWRHQWHUDSDVVZRUGWRUHVHWWKH(QHUJ\UHDGLQJV)ROORZ VWHSVDERYH7KHQSUHVVEnterDJDLQWRUHVHWHQHUJ\ Group 3: Display Baud Rate/Address Group 4: Display Communication Protocol Group 5: EIG Use Only Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 8VLQJWKH([WHUQDO'LVSOD\V Group 6: EIG Use Only Group 7: Lamp Test 3UHVVEnterWRFRQGXFWDQ/('WHVW Group 8: Display Scroll ON/OFF 3UHVVEnterWRWXUQWKHVFUROOIHDWXUHRQRURII:KHQWKHVFUROOIHDWXUHLVRQWKH 31H[WHUQDOGLVSOD\VFUROOVWKURXJKWKHILUVWUHDGLQJRIHDFKJURXSLQWKH'\QDPLF 5HDGLQJVPRGH,IDEXWWRQLVSUHVVHGGXULQJWKHVFUROOVFUROOLQJSDXVHVIRURQH PLQXWH Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 8VLQJWKH([WHUQDO'LVSOD\V 9.8: Navigation Map of Display Features Mode 8VH8S'RZQDUURZVWRVFUROOEHWZHHQJURXSV * U R X S V Reset Max/Min Reset Energy Baud Rate/Address Communication Protocol Lamp Test Display Scroll On/Off Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 8VLQJWKH([WHUQDO'LVSOD\V 9.9: Optional P40N+ LED External Remote Display Specifications Specification P40N+/P41N+/P43N+ Displays 0D[LPXP,QSXW9ROWDJH 9'& 0LQLPXP,QSXW9ROWDJH 9'& 0D[LPXP3RZHU&RQVXPSWLRQ : 1RPLQDO3RZHU&RQVXPSWLRQ $SSUR[LPDWHO\: 2SHUDWLQJ7HPSHUDWXUH5DQJH WRR&WRR) 2YHUDOO'LPHQVLRQV+[:[' [[LQFKHV[[ FP 7KHOHJDF\31GLPHQVLRQVDUH[[LQFKHV[[FP Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 8VLQJWKH([WHUQDO'LVSOD\V 7KLVSDJHLQWHQWLRQDOO\OHIWEODQN Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 10: External I/O Modules 10: External I/O Modules 10.1: Hardware Overview All Nexus® External I/O modules have the following components: • Female RS485 Side Port: use to connect to another module’s male RS485 side port. • Male RS485 Side Port: use to connect to the Nexus® 1250/1252 Meter’s Port 3 or 4 or to another module’s female RS485 side port. See Section 5.3.8 for wiring detail. • I/O Port: used for functions specific to the type of module; size and pin configuration vary depending on type of module. • Reset Button: Press and hold for three seconds to reset the module’s baud rate to 57600 and its address to 247 for 30 seconds. • LEDs: when flashing, signal that the module is functioning. • Mounting Brackets (MBIO): used to secure one or more modules to a flat surface. Mounting Brackets (MBIO) Female RS485 Side Port I/O Port LEDs (Size and Pin Configuration Vary) Male RS485 Side Port Reset Button Figure 10.1: I/O Module Components Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 10 - 1 10: External I/O Modules 10.1.1: Port Overview All Electro Industries I/O Modules have ports through which they interface with other devices. The port configurations are variations of the four types shown below. Four Analog Outputs Eight Analog Outputs (0-1mA and 4-20mA) (0-1mA and 4-20mA) 0-1mA Analog Output Module 0-1mA Analog Input Module COM COM OUT 1 OUT 1 OUT 2 OUT 2 OUT 3 OUT 3 OUT 4 OUT 4 OUT 5 OUT 6 OUT 7 OUT 8 RESET RESET Eight Analog Inputs Four Relay Outputs or (0-1mA, 0-20mA, Four KYZ Pulse Outputs 0-5Vdc, 0-10Vdc) or Eight Status Inputs NO 0-1mA Analog Input Module C 1 NO COM INPUT 1 INPUT 2 INPUT 3 INPUT 4 INPUT 5 INPUT 6 NO K Y Z C 2 NO O U T P U T S NO C 3 NO NO INPUT 7 C INPUT 8 RESET Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 4 NO RESET Doc# E151701 10 - 2 10: External I/O Modules 10.2: I/O Module Installation See Section 5.3.8 for wiring instructions for the external I/O Modules, and Section 6.4 for hardware installation instructions. 10.2.1: Power Source for I/O Modules The Nexus® 1262/1272 does not supply power to the I/O Modules. You must use an external power source, such as the EIG PSIO (12V). Refer to Section 5.3.9 to determine power needed. Figure 10.2: PSIO Power Supply Side View, Showing Male RS485 Port TX CT On RX 0-1mA Analog Input Module Power In COM N(-) INPUT 1 INPUT 2 INPUT 3 INPUT 4 ! L(+) DANGER PowerPSIO Supply Max Power: 12 VA Input Voltage: 12-60V DC 90-240V AC/DC Output Voltage: 12V DC RESET ElectroIndustries/GaugeTech www.electroind.com Figure 10.3: Power Flow from PSIO to I/O Module Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 10 - 3 10: External I/O Modules On Power In N(-) ! L(+) DANGER PowerPSIO Supply Max Power: 12 VA Input Voltage: 12-60V DC 90-240V AC/DC Output Voltage: 12V DC ElectroIndustries/GaugeTech www.electroind.com POWER + POWER - Figure 10.4: PSIO Side and Top Labels (Labels are Red and White) 10.3: Using the PSIO with Multiple I/O Modules Mounting bracket Female RS485 side Port 0-1mA Analog Input Module CT RX TX RX TX 0-1mA Analog Output Module CT CT TX Female RS485 Side Port Communication ONLY (A+, B- and Shield) RX LEDs On 0-1mA Analog Input Module COM COM COM OUT 1 INPUT 1 INPUT 1 OUT 2 INPUT 2 INPUT 2 Power In N(-) ! DANGER OUT 3 INPUT 3 INPUT 3 OUT 4 INPUT 4 INPUT 4 INPUT 5 INPUT 5 Max Power: 12 VA INPUT 6 INPUT 6 Input Voltage: 12-60V DC INPUT 7 INPUT 7 INPUT 8 INPUT 8 RESET RESET Control Power L(+) PowerPSIO Supply 90-240V AC/DC Output Voltage: 12V DC RESET ElectroIndustries/GaugeTech www.electroind.com Reset Button Mounting Bracket I/O Port (Size and pin configuration vary) Figure 10.5: PSIO Used with Multiple I/O Modules NOTE: As shown, the PSIO must be to the right of I/O Modules when viewing the side label. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 10 - 4 10: External I/O Modules 10.3.1: Steps for Attaching Multiple I/O Modules 1. Each I/O module in a group must be assigned a unique address. See the Communicator EXT User Manual for details on configuring and programming the I/O Modules. 2. Determine how many power sources (such as the PSIO) are needed for the number of modules in use. See Sections 5.3.9 for details. 3. Starting with the left module and using a slotted screw driver, fasten the first I/O Module to the left Mounting Bracket. The left Mounting Bracket is the one with the PEM. Fasten the internal screw tightly into the left Mounting Bracket. 4. Next, slide the female RS485 port into the male RS485 side port to connect the next I/O module to the left module. Fasten together enough to grab but do not tighten. 5. One by one combine the modules together. 6. Attach the PSIO (power supply) to the right of the group of I/O Modules it is supplying with power. NOTE: The PB1 can also be used as a Low Voltage Power Supply. It must be mounted separately. The PB1 should be ordered with a 12V output for this application. 7. Once you have combined all the I/O modules and power supplies together for the group, fasten tightly. This final tightening will lock the whole group together as a unit. 8. Attach the right Mounting Bracket to the right side of the group using the small Phillips head screws provided. 9. Mount the group of modules on a secure, flat surface. This procedure will insure that all modules stay connected securely. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 10 - 5 10: External I/O Modules 10.4: Factory Settings and Reset Button Factory Settings: All Nexus® I/O Modules are shipped with a preset address and a baud rate of 57600. See following sections for I/O Module addresses. Reset Button: If there is a communication problem or if you are unsure of a module’s address and baud rate, press and hold the RESET button for 3 seconds; the module will reset to a default address of 247 at 57600 baud rate for 30-seconds. This enables you to interrogate the I/O using the Communicator EXT software; see the Modbus Communicating I/O Modules User Manual. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 10 - 6 10: External I/O Modules 10.5: Analog Transducer Signal Output Modules Table 1: Analog Transducer Signal Output Module Specifications Model Numbers 1mAON4: 4-channel analog output 0±1mA 1mAON8: 8-channel analog output 0±1mA 20mAON4: 4-channel analog output 4-20mA 20mAON8: 8-channel analog output 4-20mA Accuracy 0.1% of Full Scale Scaling Programmable Communication RS485, Modbus RTU Programmable Baud Rates: 4800, 9600, 19200, 38400, 57600 Power Requirement 12-20VDC @50-200mA Operating Temperature (-20 to +70)o C/(-4 to +158)o F Maximum Load Impedance 0±1mA: 10k Ohms; 4-20mA: 500 Ohms Factory Settings Modbus Address: 1mAON4: 128; 1mAON8: 128; 20mAON4: 132; 20mAON8: 132 Baud Rate: 57600 Transmit Delay Time: 0 Default Settings (Reset Button) Modbus Address: 247 Baud Rate: 57600 Transmit Delay Time: 20msec 10.5.1: Overview The Analog Transducer Signal Output Modules (0±1mA or 4–20mA) are available in either a 4- or 8-channel configuration. Maximum registers per request, read or write, is 17 registers. All outputs share a single common point. This is also an isolated connection (from ground). The Modbus Map for the Analog Output Module (and operating details) can be found in the Modbus Communicating I/O Modules Manual. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 10 - 7 10: External I/O Modules 10.5.2: Normal Mode Normal Mode is the same for the 0-1mA and the 4-20mA Analog Output Modules except for the number of processes performed by the modules. Both devices: 1. Accept new values through communication. 2. Output current loops scaled from previously accepted values. The 0-1mA module includes one more process in its Normal Mode: 3. Read and average the A/D and adjust values for Process 2 above. The device will operate with the following default parameters: Address: 247 (F7H) Baud Rate: 57600 Baud Transmit Delay Time: 20 msec Normal Operation is prevented by a number of occurrences. See Section 10.4 for details. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 10 - 8 10: External I/O Modules 10.6: Analog Input Modules Table 2: Analog Input Module Specifications Model Numbers 8AI1: 8-channel analog input 0±1mA 8AI2: 8-channel analog input 0±20mA 8AI3: 8-channel analog input 0±5VDC 8AI4: 8-channel analog input 0±10VDC Accuracy 0.25% of Full Scale Scaling Programmable Communication RS485, Modbus RTU Programmable Baud Rates: 4800, 9600, 19200, 38400, 57600 Power Requirement 12-20VDC @50-200mA Operating Temperature (-20 to +70)o C/(-4 to +158)o F Maximum Load Impedance 0±1mA: 10k Ohms; 4-20mA: 500 Ohms Factory Settings Modbus Address: 8AI1: 136; 8AI2: 140; 8AI3: 144; 8AI4: 148 Baud Rate: 57600 Transmit Delay Time: 0 Default Settings (Reset Button) Modbus Address: 247 Baud Rate: 57600 Transmit Delay Time: 20msec 10.6.1: Overview The Analog Input Modules (0±1mA, 0±20mA, 0±5Vdc and 0±10Vdc) are available in 8-channel format. Maximum registers per request, read or write, is 17 registers. All inputs share a single common point. This is also an isolated connection (from ground). The Modbus Map for the Analog Output Module (and operating details) can be found in the Modbus Communicating I/O Modules Manual. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 10 - 9 10: External I/O Modules 10.6.2: Normal Mode In Normal Mode, the Input Module: 1. Reads and averages the A/D and adjusts values for process 2. 2. Calculates the percentage of Input Value. NOTE: The percentage value of the Input is stored in Input Value Registers (Registers 04097-04104). The device will operate with the following default parameters: Address: 247 (F7H) Baud Rate: 57600 Baud Transmit Delay Time: 20 msec Normal Operation is prevented by a number of occurrences. See Section 10.4 for details. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 10 - 10 10: External I/O Modules 10.7: Digital Dry Contact Relay Output (Form C) Module Digital Dry Contact Relay Output Module Specifications Model Number 4RO1: 4 latching relay outputs Contact Type Changeover (SPDT) Relay Type Mechanically latching Communication RS485, Modbus RTU Programmable Baud Rates: 4800, 9600, 19200, 38400, 57600 Power Requirement 2.0W max @ 12-20VDC Operating Temperature (-20 to +70)o C/(-4 to +158)o F Switching Voltage AC 250V / DC 30V Switching Power 1250VA / 150W Switching Current 5A Mechanical Life 5 x 107 switching operations Electrical Life 105 switching operations at rated current Factory Settings Modbus Address: 156 Baud Rate: 57600 Transmit Delay Time: 0 Default Settings (Reset Button) Modbus Address: 247 Baud Rate: 57600 Transmit Delay Time: 20msec 10.7.1: Overview The Relay Output Module consists of four Latching Relay Outputs. In Normal Mode, the device accepts commands to control the relays. Relay output modules are triggered by limits programmed with the Communicator EXT software. See the Communicator EXT User Manual for details on programming limits. The Modbus Map for the Analog Output Module (and operating details) can be found in the Modbus Communicating I/O Modules Manual. Each latching relay will hold its state in the event of a power loss. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 10 - 11 10: External I/O Modules 10.7.2: Communication Maximum registers per request, read or write, is 4 registers. The device will operate with the following default parameters: Address: 247 (F7H) Baud Rate: 57600 Baud Transmit Delay Time: 20 msec Some situations will cause the device to operate with the above Default Parameters. See Section 10.4 for details of Default Mode. 10.7.3: Normal Mode Normal Mode consists of one process: the device accepts new commands to control the relays. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 10 - 12 10: External I/O Modules 10.8: Digital Solid State Pulse Output (KYZ) Module Digital Solid State Pulse Output Module Specifications Model Number 4PO1 Communication RS485, Modbus RTU Programmable Baud Rates: 4800, 9600, 19200, 38400, 57600 Power Requirement 12-20VDC @50-200mA Operating Temperature (-20 to +70)o C/(-4 to +158)o F Voltage Rating Up to 300VDC Commands Accepted Read and Write with at least 4 registers of data per command Memory 256 Byte IC EEPROM for storage of programmable settings and non-volatile memory Factory Settings Modbus Address: 160 Baud Rate: 57600 Transmit Delay Time: 0 Default Settings (Reset Button) Modbus Address: 247 Baud Rate: 57600 Transmit Delay Time: 20msec 10.8.1: Overview The KYZ Pulse Output Modules have 4 KYZ Pulse Outputs and accept Read and Write Commands with at least 4 registers of data per command. Digital Solid State Pulse Output (KYZ) Modules are user programmed to reflect VAR-hours, WATT-hours, or VAhours. See the Modbus Communicating I/O Modules User Manual for details on programming the module. The Modbus Map for the KYZ Pulse Output Module (and operating details) can be found in the Modbus Communicating I/O Modules Manual. NC = Normally Closed; NO = Normally Open; C = Common. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 10 - 13 10: External I/O Modules 10.8.2: Communication Maximum registers per request, read or write, is 4 registers. The device will operate with the following Default Mode Parameters. See Section 10.4 for details. Address: 247 (F7H) Baud Rate: 57600 Baud Transmit Delay Time: 20 msec 10.8.3: Normal Mode Energy readings are given to the device frequently. The device generates a pulse at each channel after a certain energy increase. Normal Operation consists of three processes: 1. The first process accepts writes to registers 04097 - 04112. Writes can be up to four registers long and should end on the fourth register of a group (register 04100, or registers 04103-04112 or registers 04109-04112). These writes can be interpreted as two-byte, four-byte, six-byte or eight-byte energy readings. The reception of the first value for a given channel provides the initial value for that channel. Subsequent writes will increment the Residual for that channel by the difference of the old value and the new value. The previous value is then replaced with the new value. Attempting to write a value greater than the programmed Rollover Value for a given channel is completely ignored and no registers are modified. If the difference is greater than half of the programmed Rollover Value for a given channel, the write does not increment the Residual but does update the Last Value. Overflow of the Residual is not prevented. 2. The second process occurs in the main loop and attempts to decrement the Residual by the Programmed Energy/Pulse Value. If the Residual is greater than the Programmed Energy/Pulse Value and the Pending Pulses Value for that channel has not reached the maximum limit, then Residual is decremented appropriately and the Pending Pulses is increased by two, signifying two more transitions and one more pulse. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 10 - 14 10: External I/O Modules 3. The third process runs from a timer which counts off pulse widths from the Programmable Minimum Pulse Width Values. If there are Pulses Pending for a channel and the delay has passed, then the Pulses Pending is decremented for that channel and the Output Relay is toggled. Operation Indicator (0000H = OK, 1000H = Problem): Bit 1:1 = EEPROM Failure Bit 2:1 = Checksum for Communications Settings bad Bit 3:1 = Checksum for Programmable Settings bad Bit 4:1 = 1 or mor Communications Settings are invalid Bit 5:1 = 1 or more Programmable Settings are invalid Bit 6:1 = 1 or more Programmable Settings have been modified Bit 7:1 = Forced Default by Reset Value Bit 15:1 = Normal Operation of the device is disabled Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 10 - 15 10: External I/O Modules 10.9: Digital Status Input Module Digital Status Input Module Specifications Model Number 8DI1 Communication RS485, Modbus RTU Programmable Baud Rates: 4800, 9600, 19200, 38400, 57600 Power Requirement 12-20VDC @50-200mA Operating Temperature (-20 to +70)o C/(-4 to +158)o F Voltage Rating Up to 300VDC Detection Wet/Dry, Auto-detect Memory 256 Byte I2C EEPROM for storage of programmable settings and non-volatile memory Factory Settings Modbus Address: 164 Baud Rate: 57600 Transmit Delay Time: 0 Default Settings (Reset Button) Modbus Address: 247 Baud Rate: 57600 Transmit Delay Time: 20msec 10.9.1: Overview The Digital Status Input Module is used either for additional status detect or for accumulating pulses from external equipment, such as power meters, water meters, etc. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 10 - 16 10: External I/O Modules 10.9.2: Communication Maximum registers per request, read or write, is 4 registers. The device will operate with the following Default Mode Parameters. See Section 10.4 for details. Address: 247 (F7H) Baud Rate: 57600 Baud Transmit Delay Time: 20 msec 10.9.3: Normal Mode The device polls the inputs at 100Hz (once every 10 msec), debouncing the inputs and incrementing the Transition Accumulators for each channel as appropriate. The inputs are represented by Channel 1 in the LSB through Channel 8 in the MSB of the low order byte of the register. The Modbus Map for the Digital Status Input Modules (and operating details) can be found in the Modbus Communicating I/O Modules Manual. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 10 - 17 10: External I/O Modules This page intentionally left blank. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 10 - 18 11: Electrical Installation 11: Electrical Installation The Nexus® 1262/1272 Socket meter supported forms and their wiring configurations are shown in this chapter. The forms are based on the rated Voltage and hookup required for your application. (Custom forms and configurations are also available from EIG.) 11.1: Considerations When Installing Meters Installation of the Nexus® 1262/1272 meter must be performed only by qualified personnel who follow standard safety precautions during all procedures. Those personnel should have appropriate training and experience with high voltage devices. Appropriate safety gloves, safety glasses and protective clothing are recommended. During normal operation of the Nexus® meter, dangerous voltages flow through many parts of the unit, including: Terminals and any connected CTs (Current Transformers) and PTs (Potential Transformers), all I/O Modules and their circuits. All Primary and Secondary circuits can, at times, produce lethal voltages and currents. Avoid contact with any current-carrying surfaces. Do not use the meter or any I/O device for primary protection or in an energy-limiting capacity. The meter can only be used as secondary protection. Do not use the meter for applications where failure of the meter may cause harm or death. Do not use the meter for any application where there may be a risk of fire. All meter terminals should be inaccessible after installation. Do not apply more than the maximum voltage the meter or any attached device can withstand. Refer to meter and/or device labels and to the Specifications for all devices before applying voltages. Do not HIPOT/Dielectric test any Outputs, Inputs or Communications terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 1 11: Electrical Installation EIG recommends the use of Fuses for voltage leads and power supply, and shorting blocks to prevent hazardous voltage conditions or damage to CTs, if the meter needs to be removed from service. One side of the CT must be grounded. NOTE: The current inputs are only to be connected to external current transformers provided by the installer. The CTs shall be Approved or Certified and rated for the current of the meter used. NOTE: IF THE EQUIPMENT IS USED IN A MANNER NOT SPECIFIED BY THE MANUFACTURER, THE PROTECTION PROVIDED BY THE EQUIPMENT MAY BE IMPAIRED. NOTE: THERE IS NO REQUIRED PREVENTIVE MAINTENANCE OR INSPECTION NECESSARY FOR SAFETY. HOWEVER, ANY REPAIR OR MAINTENANCE SHOULD BE PERFORMED BY THE FACTORY. DISCONNECT DEVICE: The following part is considered the equipment disconnect device. A SWITCH OR CIRCUIT-BREAKER SHALL BE INCLUDED IN THE END-USE EQUIPMENT OR BUILDING INSTALLATION. THE SWITCH SHALL BE IN CLOSE PROXIMITY TO THE EQUIPMENT AND WITHIN EASY REACH OF THE OPERATOR. THE SWITCH SHALL BE MARKED AS THE DISCONNECTING DEVICE FOR THE EQUIPMENT. L’installation des compteurs de Nexus 1262/1272 doit être effectuée seulement par un personnel qualifié qui suit les normes relatives aux précautions de sécurité pendant toute la procédure. Le personnel doit avoir la formation appropriée et l'expérience avec les appareils de haute tension. Des gants de sécurité, des verres et des vêtements de protection appropriés sont recommandés. AVERTISSEMENT! Pendant le fonctionnement normal du compteur Nexus 1262/ 1272 des tensions dangereuses suivant de nombreuses pièces, notamment, les bornes et tous les transformateurs de courant branchés, les transformateurs de tension, toutes les sorties, les entrées et leurs circuits. Tous les circuits secondaires Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 2 11: Electrical Installation et primaires peuvent parfois produire des tensions de létal et des courants. Évitez le contact avec les surfaces sous tensions. Avant de faire un travail dans le compteur, assurez-vous d'éteindre l'alimentation et de mettre tous les circuits branchés hors tension. Ne pas utiliser les compteurs ou sorties d'appareil pour une protection primaire ou capacité de limite d'énergie. Le compteur peut seulement être utilisé comme une protection secondaire. Ne pas utiliser le compteur pour application dans laquelle une panne de compteur peut causer la mort ou des blessures graves. Ne pas utiliser le compteur ou pour toute application dans laquelle un risque d'incendie est susceptible. Toutes les bornes de compteur doivent être inaccessibles après l'installation. Ne pas appliquer plus que la tension maximale que le compteur ou appareil relatif peut résister. Référez-vous au compteur ou aux étiquettes de l'appareil et les spécifications de tous les appareils avant d'appliquer les tensions. Ne pas faire de test HIPOT/diélectrique, une sortie, une entrée ou un terminal de réseau. EIG recommande d'utiliser les fusibles pour les fils de tension et alimentations électriques, ainsi que des coupe-circuits pour prévenir les tensions dangereuses ou endommagements de transformateur de courant si l'unité Nexus 1262/1272 doit être enlevée du service. Un côté du transformateur de courant doit être mis à terre. NOTE: Les entrées actuelles doivent seulement être branchées dans le transformateur externe actuel par l'installateur. Le transformateur de courant doit être approuvé ou certifié et déterminé pour le compteur actuel utilisé. IMPORTANT! SI L'ÉQUIPEMENT EST UTILISÉ D'UNE FAÇON NON SPÉCIFIÉE PAR LE FABRICANT, LA PROTECTION FOURNIE PAR L'ÉQUIPEMENT PEUT ÊTRE ENDOMMAGÉE. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 3 11: Electrical Installation NOTE: Il N'Y A AUCUNE MAINTENANCE REQUISE POUR LA PRÉVENTION OU INSPECTION NÉCESSAIRE POUR LA SÉCURITÉ. CEPENDANT, TOUTE RÉPARATION OU MAINTENANCE DEVRAIT ÊTRE RÉALISÉE PAR LE FABRICANT. DÉBRANCHEMENT DE L'APPAREIL : la partie suivante est considérée l'appareil de débranchement de l'équipement. UN INTERRUPTEUR OU UN DISJONCTEUR DEVRAIT ÊTRE INCLUS DANS L'UTILISATION FINALE DE L'ÉQUIPEMENT OU L'INSTALLATION. L'INTERRUPTEUR DOIT ÊTRE DANS UNE PROXIMITÉ PROCHE DE L'ÉQUIPEMENT ET A LA PORTÉE DE L'OPÉRATEUR. L'INTERRUPTEUR DOIT AVOIR LA MENTION DÉBRANCHEMENT DE L'APPAREIL POUR L'ÉQUIPEMENT. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 4 11: Electrical Installation 11.2: Blade Configuration for Forms 9S, 36S, and 45S Detailed drawings of the Blade configurations are shown below and on the next page. There are two configurations because the 9S and the 36S are the same. NOTE: The forms referred to in this chapter comply with ANSI forms 9S, 36S and 45S. Figure 11.1: Form 9S & 36S Base with Knock Out Holes Figure 11.2: Form 45S Base with Knock Out Holes Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 5 11: Electrical Installation 11.3: Wiring Diagrams Choose from the supported meter forms based on the rated Voltage and hookup required for your application. Corresponding wiring diagrams appear on the following pages. If the connection diagram you need is not listed, contact EIG for a custom connection diagram. Form 9S mounted in an A/S Adapter is shown in Figure 11.19. NOTE: Form 45S replaces Form 5S and may also be used in 4-wire circuits. Form 9S 36S 45S 9S in S/A Description Figure# Wye, no PTs, 3 CTs 11.3 Wye, 3 PTs, 3 CTs 11.4 4-Wire Delta, no PTs, 3 CTs 11.5 4-Wire Delta, 3 PTs, 3 CTs 11.6 4-Wire Delta, no PTs, 2 CTs 11.7 4-Wire Delta, 2 PTs, 2 CTs 11.8 3-Wire Delta, no PTs, 2 CTs 11.9 3-Wire Delta, 2 PTs, 2 CTs 11.10 2.5 EL Wye, no PTs, 3 CTs 11.11 2.5 EL Wye, 2 PTs, 3 CTs 11.12 Wye, no PTs, 3 CTs 11.13 Wye, 2 PTs, 3 CTs 11.14 3-wire Delta, no PTs, 2 CTs 11.15 3-wire Delta, 2 PTs, 2 CTs 11.16 4-wire Delta, no PTs, 2 CTs 11.17 4-wire Delta, 2 PTs, 2 CTs 11.18 Form 9S Mounted in S/A Adapter (showing connectors) 11.19 Table 11.1: Nexus® 1262/1272 Meter Forms REMARQUE pour Tous les schémas de câblage: • Les connexions de garde pour les transformateurs sont omises dans les schémas et ne sont pas nécessaires afin que le compteur fonctionne correctement. Toutefois, nous vous recommandons fortement ces connexions pour réduire les risques de choc. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 6 11: Electrical Installation • Les commutateurs de court-circuit (blocs) pour le côté secondaire des transformateurs de courant ne sont également pas représentés. Pour éviter les chocs électriques, nous vous recommandons d'utiliser ces commutateurs de court-circuit (blocs). Assurez-vous que les côtés secondaires des transformateurs de courant sont court-circuités avant de les déconnecter des bornes d'entrée de courant du compteur. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 7 11: Electrical Installation FORM: 9S (TRANSFORMER RATED) SERVICE: WYE, 4WIRE NO PTs, 3 CTs 3 N LINE 1 2 LOAD Figure 11.3: Form 9S Wye, no PTs, 3 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 8 11: Electrical Installation FORM: 9S (TRANSFORMER RATED) SERVICE: WYE, 4WIRE 3 PTs, 3 CTs 3 N LINE 1 2 LOAD Figure 11.4: Form 9S Wye, 3 PTs, 3 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 9 11: Electrical Installation 3 FORM: 9S (TRANSFORMER RATED) SERVICE: DELTA, 4WIRE NO PTs, 3 CTs LINE 2 N 1 LOAD Figure 11.5: Form 9S 4-Wire Delta, no PTs, 3 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 10 11: Electrical Installation 3 FORM: 9S (TRANSFORMER RATED) SERVICE: DELTA, 4WIRE 3 PTs, 3 CTs LINE 2 N 1 LOAD Figure 11.6: Form 9S 4-Wire Delta, 3 PTs, 3 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 11 11: Electrical Installation FORM: 9S (TRANSFORMER RATED) SERVICE: DELTA, 4WIRE NO PTs, 2 CTs 3 LINE 2 N 1 LOAD Figure 11.7: Form 9S 4-Wire Delta no PTs, 2 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 12 11: Electrical Installation 3 FORM: 9S (TRANSFORMER RATED) SERVICE: DELTA, 4WIRE 2 PTs, 2 CTs LINE 2 N 1 LOAD Figure 11.8: Form 9S 4-Wire Delta, 2 PTs, 2 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 13 11: Electrical Installation FORM: 9S (TRANSFORMER RATED) SERVICE: DELTA, 3WIRE NO PTs, 2 CTs 3 LINE 2 1 LOAD Figure 11.9: Form 9S 3-Wire Delta, no PTs, 2 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 14 11: Electrical Installation 3 FORM: 9S (TRANSFORMER RATED) SERVICE: DELTA, 3WIRE 2 PTs, 2 CTs LINE 1 2 LOAD Figure 11.10: Form 9S 3-Wire Delta, 2 PTs, 2 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 15 11: Electrical Installation FORM: 36S (TRANSFORMER RATED) SERVICE: WYE, 4WIRE NO PTs, 3 CTs 3 N LINE 1 2 LOAD Figure 11.11: Form 36S 2.5 Element Wye, no PTs, 3 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 16 11: Electrical Installation FORM: 36S (TRANSFORMER RATED) SERVICE: WYE, 4WIRE 2 PTs, 3 CTs 3 N LINE 1 2 LOAD Figure 11.12: Form 36S 2.5 Element Wye, 2 PTs, 3 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 17 11: Electrical Installation FORM: 45S (TRANSFORMER RATED) SERVICE: WYE, 4WIRE NO PTs, 3 CTs 3 N LINE 1 2 LOAD Figure 11.13: Form 45S Wye, no PTs, 3 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 18 11: Electrical Installation FORM: 45S (TRANSFORMER RATED) SERVICE: WYE, 4WIRE 2 PTs, 3 CTs 3 N LINE 1 2 LOAD Figure 11.14: Form 45S Wye, 2 PTs, 3 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 19 11: Electrical Installation FORM: 45S (TRANSFORMER RATED) SERVICE: DELTA, 3WIRE NO PTs, 2 CTs 3 LINE 1 2 LOAD Figure 11.15: Form 45S 3-Wire Delta, no PTs, 2 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 20 11: Electrical Installation FORM: 45S (TRANSFORMER RATED) SERVICE: DELTA, 3WIRE 2 PTs, 2 CTs 3 LINE 1 2 LOAD Figure 11.16: Form 45S 3-Wire Delta, 2 PTs, 2 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 21 11: Electrical Installation FORM: 45S (TRANSFORMER RATED) SERVICE: DELTA, 4WIRE NO PTs, 2 CTs 3 LINE 2 N 1 LOAD Figure 11.17: Form 45S 4-Wire Delta, no PTs, 2 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 22 11: Electrical Installation FORM: 45S (TRANSFORMER RATED) SERVICE: DELTA, 4WIRE 2 PTs, 2 CTs 3 LINE 2 N 1 LOAD Figure 11.18: Form 45S 4-Wire Delta, 2 PTs, 2 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 23 11: Electrical Installation 11.3: 9S Meter Mounted in S/A Adapter Any of the 9S Forms can be mounted in an S/A Adapter, such as the one shown below. The socket meter is “pushed” into the S/A Adapter until the meter “snaps” into place. The blades on the back of the socket meter make the proper connection. See Figures 11.1 to 11.8 for the 9S wiring diagrams. Figure 11.19: Form 9S mounted in an S/A Adapter (front removed) Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 11 - 24 12: Switchboard Meter 12: Switchboard Meter 12.1: Introduction 9.25" (235 mm) 6.85" (174 mm) Figure 12.1: Switchboard Meter Dimensions, Front This chapter gives you a brief overview of the Nexus® 1262/1272 Switchboard option. The Switchboard meter gives you all the features of the Socket meter in a compact case. Easy installation or disconnection is the primary benefit of choosing this option. The Switchboard system lets you install or “rack out” the meter in two easy steps. Minimal manual wiring is required to connect or disconnect the meter. The Switchboard meter operates in the same way as the Socket meter. There are a few differences between the two meter options: • The labels on the face and the shroud of the meter will be slightly different, depending on options selected (see Section 12.2 for label detail) Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 1 12: Switchboard Meter • The wiring Forms are 9Z and 36Z and the wiring is different (see Section 12.5) • Dimensions are different (see Section 12.3) • Installation is different (and even easier!) (see Section 12.4) CAUTION! The Power Supply Input on the Switchboard unit is configured differently. Please check wiring carefully. ATTENTION! L'entrée d'alimentation de l'unité du tableau est configurée différemment. Veuillez vérifier le câblage avec soin. 12.2: Labels The labels on the Switchboard meter are similar to those on the Socket meter. Forms are 9Z and 36Z and there may be some additional items, depending upon the options selected. See Chapter 3 for a description of the components on the front and shroud labels. Figure 12.2: Switchboard Meter, Front View Mfg. Date: 2/2/2011 Serial#: 40/83003 Model: NEXUS 1262S-SWB-20-60HZ-4IPO-INP2 Memory: 4 Meg: Options: Freq.: 50Hz KYZ Out: NO Opt. Comm: Power Supply: NONE No Optional Com 56-82.8V AC Notes: Figure 12.3: Sample of Switchboard Options Label Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 2 12: Switchboard Meter 12.3: Specifications and Dimensions The Switchboard meter specifications are the same as those of the Socket meter, except for meter dimensions. The Switchboard meter is essentially the Socket meter in an oblong case. The dimensions are given in figures 12.1 (Front View), 12.4 (Back View) and 12.5 (Side View). See Chapter 2 for meter specifications. 6.13" (15.57cm) 2.31" (5.86 cm) Y K Z CH1 S (-) (+) COM4 | S (1) (+) Gateway 8 7 6 5 4 3 2 1 C HIGH SPEED | L N PE Power In Network Phone Line Vc Ia - Hi Ib - Hi + + + 9.0" (22.86cm) (-) (+) | SCOM1 | K Z K Z | Y CH3 | Y CH4 8.5" (21.59cm) 4.38" (11.12cm) (-) (+) IRIG-B K Z | Y CH2 Va Ic - Hi + + Vn Lo Lo Lo Vb + + + + + 0.19" (.48cm) 0.50" (1.27cm) 5.60" (14.22cm) 6.58" (16.71cm) Figure 12.4: Switchboard Meter Dimensions, Back Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 3 12: Switchboard Meter 6.25" (15.88cm) 8.5" (21.6 cm) 2.0" 5.08cm 7.0" (17.78cm) 9.0" (22.86cm) Figure 12.5: Switchboard Meter Dimensions, Side Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 4 12: Switchboard Meter 0.188” (0.477cm) 6.125” (15.557cm) 5.750” (14.605cm) +.010”/.025cm/ - .001”/.0025cm R0.10 TYP 2.296” (5.831cm) 4X 0.250” (0.635cm) 8.625” (21.907cm) 4.375” (11.112cm) Figure 12.6: Switchboard Meter Cutout IMPORTANT! Check drill holes for the mounting screw you are using, to insure that the mounting screw fits the box tightly enough to hold the box in place. You can use a washer for a slightly smaller mounting screw. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 5 12: Switchboard Meter 12.4: Installation The Switchboard meter provides easy installation and removal from installation. IMPORTANT! Before installing the meter, check the battery connections (see Sections 6.2 and 5.4.4). 1.Insert the case into a prepared mounting hole. Secure with mounting screws. 2. Slide the meter into the case and secure it by sliding the chassis levers until they snap into place. Connectors for the following are located on the back of the meter. The connectors automatically plug into the available connectors on the mounting board (see Figure 12.8). • Pulse Outputs - Four Channels • Status Inputs • Phone • Line/Network • Power In • COM4, COM1 • IRIG-B • Modem Gateway RS485 3. Position the Switchboard case front against the four screw holes and secure it by turning the four built-in screws in each of the corners. See Figure 12.7. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 6 12: Switchboard Meter Built-in Screws Figure 12.7: Switchboard Case Front Showing 4 Screw Holes Figure 12.8: Switchboard Meter Back Showing Connectors Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 7 12: Switchboard Meter 12.5: Wiring Diagrams The wiring of the Switchboard meter is similar to that of the Socket meter. Table 1: Form 9Z 36Z Description Figure# Wye, no PTs, 3 CTs 12.9 Wye, 3 PTs, 3 CTs 12.10 4-Wire Delta, no PTs, 3 CTs 12.11 4-Wire Delta, 3 PTs, 3 CTs 12.12 3-Wire Delta, no PTs, 2 CTs 12.13 3-Wire Delta, 2 PTs, 2 CTs 12.14 3-Wire Delta, no PTs, 2 CTs 12.15 3-Wire Delta, 2 PTs, 2 CTs 12.16 3-Wire Delta, 2 PTs, 3 CTs 12.19 3-Wire Delta, no PTs, 3 CTs 12.20 2.5 EL Wye, no PTs, 3 CTs 12.17 2.5 EL Wye, 2 PTs, 3 CTs 12.18 Table 12.1: Switchboard Meter Configurations The meter snaps into place and is secured with levers and screws. All input and output connections are made automatically as the meter is installed. (Refer to Section 12.4 and Figure 12.8.) Wiring options are shown in Figures 12.9 through 12.20. NOTE: For special requirements, contact our service department. CAUTION! All wiring should be done by a licensed professional. Actual installation procedures, materials, equipment and connections must conform to applicable codes and standards. See Section 11.1 for important safety considerations. ATTENTION! Tout travail de câblage doit être effectué par un professionnel agréé. Les procédures, matériaux, équipements et connexions d'installation actuels doivent être conformes aux codes et aux normes applicables. Pour voir d'importantes exigences de sécurité, vous référer à Section 11.1. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 8 12: Switchboard Meter REMARQUE pour Tous les schémas de câblage: • Les connexions de garde pour les transformateurs sont omises dans les schémas et ne sont pas nécessaires afin que le compteur fonctionne correctement. Toutefois, nous vous recommandons fortement ces connexions pour réduire les risques de choc. • Les commutateurs de court-circuit (blocs) pour le côté secondaire des transformateurs de courant ne sont également pas représentés. Pour éviter les chocs électriques, nous vous recommandons d'utiliser ces commutateurs de court-circuit (blocs). Assurez-vous que les côtés secondaires des transformateurs de courant sont court-circuités avant de les déconnecter des bornes d'entrée de courant du compteur. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 9 12: Switchboard Meter SERVICE: WYE, 4WIRE NO PTs, 3 CTs 3 Y K Z CH1 K Z Y K Z Y K Z | Y CH2 | CH3 | CH4 | (-) (+) S (-) (+) | IRIG-B COM1 | S (-) (+) COM4 | S (1) (+) Gateway N 8 7 6 5 4 3 2 1 C HIGH SPEED L N PE Power In 1 Network Phone Line 2 Vc Ia - Hi + Ib - Hi + + Caution: Power Supply Input on new units is configured differently. Please check wiring carefully. Va Ic - Hi + + Vn Lo Lo Lo Vb + + + + + LINE LOAD Figure 12.9: 9Z Transformer Rated Wye, no PTs, 3 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 10 12: Switchboard Meter SERVICE: WYE, 4WIRE 3 PTs, 3 CTs 3 Y K Z CH1 K Z Y K Z Y K Z | Y CH2 | CH3 | CH4 | (-) (+) S (-) (+) | IRIG-B COM1 | S (-) (+) COM4 | S (1) (+) Gateway N 8 7 6 5 4 3 2 1 C HIGH SPEED L N PE Power In 1 Network Phone Line 2 Vc Ia - Hi + Ib - Hi + + Caution: Power Supply Input on new units is configured differently. Please check wiring carefully. Va Ic - Hi + + Vn Lo Lo Lo Vb + + + + + LINE LOAD Figure 12.10: 9Z Transformer Rated Wye, 3 PTs, 3 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 11 12: Switchboard Meter SERVICE: DELTA, 4WIRE NO PTs, 3 CTs 3 Y K Z CH1 K Z Y K Z Y K Z | Y CH2 | CH3 | CH4 | (-) (+) S (-) (+) | IRIG-B COM1 | S (-) (+) COM4 | S (1) (+) Gateway 8 7 6 5 4 3 2 1 C HIGH SPEED L N PE Power In N Network Phone Line 2 Vc Ia - Hi + Ib - Hi + + Caution: Power Supply Input on new units is configured differently. Please check wiring carefully. Va Ic - Hi + + Vn Lo Lo Lo Vb + + + + + 1 LINE LOAD Figure 12.11: 9Z Transformer Rated 4-Wire Delta, no PTs, 3 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 12 12: Switchboard Meter SERVICE: DELTA, 4WIRE 3 PTs, 3 CTs 3 Y K Z CH1 K Z Y K Z Y K Z | Y CH2 | CH3 | CH4 | (-) (+) S (-) (+) | IRIG-B COM1 | S (-) (+) COM4 | S (1) (+) Gateway 8 7 6 5 4 3 2 1 C HIGH SPEED L N PE Power In N Network Phone Line 2 Vc Ia - Hi + Ib - Hi + + Caution: Power Supply Input on new units is configured differently. Please check wiring carefully. Va Ic - Hi + + Vn Lo Lo Lo Vb + + + + + 1 LINE LOAD Figure 12.12: 9Z Transformer Rated 4-Wire Delta, 3 PTs, 3 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 13 12: Switchboard Meter SERVICE: DELTA, 4WIRE NO PTs, 2 CTs 3 Y K Z CH1 K Z Y K Z Y K Z | Y CH2 | CH3 | CH4 | (-) (+) S (-) (+) | IRIG-B COM1 | S (-) (+) COM4 | S (1) (+) Gateway 8 7 6 5 4 3 2 1 C HIGH SPEED L N PE Power In N Network Phone Line 2 Vc Ia - Hi + Ib - Hi + + Caution: Power Supply Input on new units is configured differently. Please check wiring carefully. Va Ic - Hi + + Vn Lo Lo Lo Vb + + + + + 1 LINE LOAD Figure 12.13: 9Z Transformer Rated 3-Wire Delta, no PTs, 2 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 14 12: Switchboard Meter SERVICE: DELTA, 4WIRE 2 PTs, 2 CTs 3 Y K Z CH1 K Z Y K Z Y K Z | Y CH2 | CH3 | CH4 | (-) (+) S (-) (+) | IRIG-B COM1 | S (-) (+) COM4 | S (1) (+) Gateway 8 7 6 5 4 3 2 1 C HIGH SPEED L N PE Power In N Network Phone Line 2 Vc Ia - Hi + Ib - Hi + + Caution: Power Supply Input on new units is configured differently. Please check wiring carefully. Va Ic - Hi + + Vn Lo Lo Lo Vb + + + + + 1 LINE LOAD Figure 12.14: 9Z Transformer Rated 3-Wire Delta, 2 PTs, 2 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 15 12: Switchboard Meter SERVICE: DELTA, 3WIRE NO PTs, 2 CTs 3 Y K Z CH1 K Z Y K Z Y K Z | Y CH2 | CH3 | CH4 | (-) (+) S (-) (+) | IRIG-B COM1 | S (-) (+) COM4 | S (1) (+) Gateway 8 7 6 5 4 3 2 1 C HIGH SPEED L N PE Power In Network Phone Line 1 2 Vc Ia - Hi + Ib - Hi + + Caution: Power Supply Input on new units is configured differently. Please check wiring carefully. Va Ic - Hi + + Vn Lo Lo Lo Vb + + + + + LINE LOAD Figure 12.15: 9Z Transformer Rated 3-Wire Delta, no PTs, 2 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 16 12: Switchboard Meter SERVICE: DELTA, 3WIRE 2 PTs, 2 CTs 3 Y K Z CH1 K Z Y K Z Y K Z | Y CH2 | CH3 | CH4 | (-) (+) S (-) (+) | IRIG-B COM1 | S (-) (+) COM4 | S (1) (+) Gateway 8 7 6 5 4 3 2 1 C HIGH SPEED L N PE Power In Network Phone Line 1 2 Vc Ia - Hi + Ib - Hi + + Caution: Power Supply Input on new units is configured differently. Please check wiring carefully. Va Ic - Hi + + Vn Lo Lo Lo Vb + + + + + LINE LOAD Figure 12.16: 9Z Transformer Rated 3-Wire Delta, 2 PTs, 2 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 17 12: Switchboard Meter SERVICE: 2.5 EL WYE, NO PTs, 3 CTs 3 Y K Z CH1 K Z Y K Z Y K Z | Y CH2 | CH3 | CH4 | (-) (+) S (-) (+) | IRIG-B COM1 | S (-) (+) COM4 | S (1) (+) Gateway N 8 7 6 5 4 3 2 1 C HIGH SPEED L N PE Power In 1 Network Phone Line 2 Vc Ia - Hi + Ib - Hi + + Caution: Power Supply Input on new units is configured differently. Please check wiring carefully. Va Ic - Hi + + Vn Lo Lo Lo Vb + + + + + LINE LOAD Figure 12.17: 36Z 2.5 Element Wye, no PTs, 3 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 18 12: Switchboard Meter SERVICE: 2.5 EL WYE 2 PTs, 3 CTs 3 Y K Z CH1 (-) (+) IRIG-B K Z | Y CH2 (-) (+) | SCOM1 | K Z K Z | Y CH3 | Y CH4 S (-) (+) COM4 | | S (1) (+) Gateway N 8 7 6 5 4 3 2 1 C HIGH SPEED L N PE Power In 1 Network Phone Line 2 Vc Ia - Hi + Ib - Hi + + Caution: Power Supply Input on new units is configured differently. Please check wiring carefully. Va Ic - Hi + + Vn Lo Lo Lo Vb + + + + + LINE N 3 2 1 I3 I2 I1 V1 V3 N LOAD Figure 12.18: 36Z 2.5 Element Wye, 2 PTs, 3 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 19 12: Switchboard Meter SERVICE: DELTA, 3WIRE 2 PTs, 3 CTs 3 Y K Z CH1 K Z Y K Z Y K Z | Y CH2 | CH3 | CH4 | (-) (+) S (-) (+) | IRIG-B COM1 | S (-) (+) COM4 | S (1) (+) Gateway 8 7 6 5 4 3 2 1 C HIGH SPEED L N PE Power In Network Phone Line 1 2 Vc Ia - Hi + Ib - Hi + + Caution: Power Supply Input on new units is configured differently. Please check wiring carefully. Va Ic - Hi + + Vn Lo Lo Lo Vb + + + + + LINE ! 1! 1 1 8 8! 8 LOAD Figure 12.19: Delta, 3-Wire, 2 PTs, 3 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 20 12: Switchboard Meter SERVICE: DELTA, 3WIRE NO PTs, 3 CTs 3 Y K Z CH1 K Z Y K Z Y K Z | Y CH2 | CH3 | CH4 | (-) (+) S (-) (+) | IRIG-B COM1 | S (-) (+) COM4 | S (1) (+) Gateway 8 7 6 5 4 3 2 1 C HIGH SPEED L N PE Power In Network Phone Line 1 2 Vc Ia - Hi + Ib - Hi + + Caution: Power Supply Input on new units is configured differently. Please check wiring carefully. Va Ic - Hi + + Vn Lo Lo Lo Vb + + + + + LINE ! 1! 1 1 8 8 8! LOAD Figure 12.20: Delta, 3-wire, No PTs, 3 CTs • The protective ground connections for the transformers are omitted in the diagrams and are not required for the meter to work properly. However, we strongly recommend those connections to reduce shock hazard. • Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 21 12: Switchboard Meter This page intentionally left blank. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions Doc# E151701 12 - 22 0HWHU&DOFXODWLRQV 13: Meter Calculations 13.1: Measurements and Calculations 7KH1H[XV0HWHUPHDVXUHVPDQ\GLIIHUHQWSRZHUSDUDPHWHUV)ROORZLQJ LVDOLVWRIWKHIRUPXODVXVHGWRSHUIRUPFDOFXODWLRQVZLWKVDPSOHVIRU:\HDQG'HOWD VHUYLFHV 6DPSOHVIRU:\HYDYEYFLDLELFLQ 6DPSOHVIRU'HOWDYDEYEFYFDLDLELF 5RRW0HDQ6TXDUH506RI3KDVH9ROWDJHV1 QXPEHURIVDPSOHV )RU:\H[ DEF N ¦v VRMS x 2 x (t ) t 1 N 5RRW0HDQ6TXDUH506RI/LQH&XUUHQWV1 QXPEHURIVDPSOHV )RU:\H[ DEFQ )RU'HOWD[ DEF N ¦i I RMS x Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 2 x (t ) t 1 N 'RF# ( 0HWHU&DOFXODWLRQV 5RRW0HDQ6TXDUH506RI/LQH9ROWDJHV1 QXPEHURIVDPSOHV )RU:\H[\ DERUEFRUFD N ¦ (v x( t ) v y( t ) ) 2 t 1 VRMS xy N )RU'HOWD[\ DEEFFD N ¦v 2 xy ( t ) t 1 VRMS xy N 3RZHU:DWWVSHUSKDVH1 QXPEHURIVDPSOHV )RU:\H[ DEF N ¦v WX x (t ) x ix ( t ) t 1 N $SSDUHQW3RZHU9$SHUSKDVH )RU:\H[ DEF VAx Electro Industries/GaugeTech Electro Industries/GaugeTech VRMS X x I RMS X The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 0HWHU&DOFXODWLRQV 5HDFWLYH3RZHU9$5SHUSKDVH )RU:\H[ DEF VAx2 W x2 VAR x 4SHU3KDVH )RU:\H[ DEF Q 3VAR X W X 2 X $FWLYH3RZHU:DWWV7RWDO1 QXPEHURIVDPSOHV )RU:\H Wa Wb Wc WT )RU'HOWD N ¦ v ab ( t ) WT x ia (t ) vbc (t ) x ic ( t ) t 1 N 5HDFWLYH3RZHU9$57RWDO1 QXPEHURIVDPSOHV )RU:\H VART Electro Industries/GaugeTech Electro Industries/GaugeTech VARa VARb VARc The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 0HWHU&DOFXODWLRQV )RU'HOWD VART = (VRMSab ⎤ ⎡ N vab (t ) • ia (t ) ⎥ ∑ ⎢ 2 ⎥ • I RMSa ) − ⎢ t =1 N ⎥ ⎢ ⎥⎦ ⎢⎣ 2 + (VRMSbc ⎤ ⎡ N vbc (t ) • ic (t ) ⎥ ∑ ⎢ 2 ⎥ • I RMSc ) − ⎢ t =1 N ⎥ ⎢ ⎥⎦ ⎢⎣ 2 $SSDUHQW3RZHU9$7RWDO )RU:\H VAT VAa VAb VAc )RU'HOWD VAT WT2 VART2 QT Qa Qb Qc 7RWDO4 )RU:\H )RU'HOWD QT Electro Industries/GaugeTech Electro Industries/GaugeTech 3VART WT 2 The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 0HWHU&DOFXODWLRQV 7RWDO(QHUJLHV [\ :7:K7RU9$579$5K7RU9$79$K7RU474K7 ¦x y 3600sec. 3RZHU)DFWRU3) )RU:\H[ DEF7 )RU'HOWD[ 7 P Fx Wx V Ax 7RWDO$YHUDJH3RZHU)DFWRU [ 4XDGUDQWVSRVLWLYH:K4XDGUDQWVQHJDWLYH:K PFT _ Avg x Whx VAhx 3KDVH$QJOHV [ DEF x cos1 PFx Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 0HWHU&DOFXODWLRQV 7RWDO+DUPRQLF'LVWRUWLRQ7+' )RU:\H[ YDYEYFLDLELF )RU'HOWD[ LDLELFYDEYEFYFD ¦ RMS 127 2 xh h 2 THD RMS x1 .)DFWRU [ LDLELF 127 ¦ h x RMS xh ¦ RMS h 1 127 KFactor 2 2 xh h 1 9ROWDJH,PEDODQFH1 QXPEHURIVDPSOHV ¦ v a vb vc N N RMSva RMSvb RMSvc Imb v &XUUHQW,PEDODQFH Imb Electro Industries/GaugeTech Electro Industries/GaugeTech RMS I RMS The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions IA I CalcN RMS I RMS I B 'RF# C ( 0HWHU&DOFXODWLRQV 13.2: Demand Integrators 3RZHUXWLOLWLHVWDNHLQWRDFFRXQWERWKHQHUJ\FRQVXPSWLRQDQGSHDNGHPDQGZKHQ ELOOLQJFXVWRPHUV3HDNGHPDQGH[SUHVVHGLQNLORZDWWVN:LVWKHKLJKHVWOHYHORI GHPDQGUHFRUGHGGXULQJDVHWSHULRGRIWLPHFDOOHGWKHLQWHUYDO7KH1H[XV VXSSRUWVWKHIROORZLQJPRVWSRSXODUFRQYHQWLRQVIRUDYHUDJLQJGHPDQGDQG SHDNGHPDQG%ORFN:LQGRZ'HPDQG5ROOLQJ:LQGRZ'HPDQG7KHUPDO'HPDQG DQG3UHGLFWLYH:LQGRZ'HPDQG<RXFDQSURJUDPDQGDFFHVVDOOFRQYHQWLRQV FRQFXUUHQWO\ZLWKWKH&RPPXQLFDWRU(;7VRIWZDUHVHHWKHCommunicator EXT User Manual Block (Fixed) Window Demand: 7KLVFRQYHQWLRQUHFRUGVWKHDYHUDJHDULWKPHWLFPHDQGHPDQGIRUFRQVHFXWLYHWLPH LQWHUYDOVXVXDOO\PLQXWHV ([DPSOH$W\SLFDOVHWWLQJRIPLQXWHVSURGXFHVDQDYHUDJHYDOXHHYHU\PLQXWHV DWHWFIRUSRZHUUHDGLQJRYHUWKHSUHYLRXVILIWHHQPLQXWH LQWHUYDOHWF Rolling (Sliding) Window Demand: 5ROOLQJ:LQGRZ'HPDQGIXQFWLRQVOLNHPXOWLSOHRYHUODSSLQJ%ORFN:LQGRZ'HPDQGV 7KHSURJUDPPDEOHVHWWLQJVSURYLGHGDUHWKHQXPEHUDQGOHQJWKRIGHPDQGVXELQWHU YDOV$WHYHU\VXELQWHUYDODQDYHUDJHDULWKPHWLFPHDQRISRZHUUHDGLQJVRYHUWKH VXELQWHUYDOLVLQWHUQDOO\FDOFXODWHG7KLVQHZVXELQWHUYDODYHUDJHLVWKHQDYHUDJHG DULWKPHWLFPHDQZLWKDVPDQ\SUHYLRXVVXELQWHUYDODYHUDJHVDVSURJUDPPHGWR SURGXFHWKH5ROOLQJ:LQGRZ'HPDQG ([DPSOH:LWKVHWWLQJVRIILYHPLQXWHVXELQWHUYDOVVXELQWHUYDODYHUDJHVDUHFRP SXWHGHYHU\PLQXWHVHWFIRUSRZHUUHDGLQJVRYHUWKHSUHYL RXVILYHPLQXWHLQWHUYDO HWF)XUWKHUHYHU\PLQXWHVWKHVXELQWHUYDODYHUDJHVDUHDYHUDJHGLQJURXSVRI HWFWRSURGXFHDILIWHHQ[PLQXWHDYHUDJHHYHU\ PLQXWHVUROOLQJVOLGLQJHYHU\PLQXWHVHWF Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 0HWHU&DOFXODWLRQV Thermal Demand: 7UDGLWLRQDODQDORJ:DWWKRXU:KPHWHUVXVHKHDWVHQVLWLYHHOHPHQWVWRPHDVXUH WHPSHUDWXUHULVHVSURGXFHGE\DQLQFUHDVHLQFXUUHQWIORZLQJWKURXJKWKHPHWHU$ SRLQWHUPRYHVLQSURSRUWLRQWRWKHWHPSHUDWXUHFKDQJHSURYLGLQJDUHFRUGRI GHPDQG7KHSRLQWHUUHPDLQVDWSHDNOHYHOXQWLODVXEVHTXHQWLQFUHDVHLQGHPDQG PRYHVLWDJDLQRUXQWLOLWLVPDQXDOO\UHVHW7KH1H[XVPLPLFVWUDGL WLRQDOPHWHUVWRSURYLGH7KHUPDO'HPDQGUHDGLQJV (DFKVHFRQGDVDQHZSRZHUOHYHOLVFRPSXWHGDUHFXUUHQFHUHODWLRQIRUPXODLV DSSOLHG7KLVIRUPXODUHFRPSXWHVWKHWKHUPDOGHPDQGE\DYHUDJLQJDVPDOOSRUWLRQRI WKHQHZSRZHUYDOXHZLWKDODUJHSRUWLRQRIWKHSUHYLRXVWKHUPDOGHPDQGYDOXH7KH SURSRUWLRQLQJRIQHZWRSUHYLRXVLVSURJUDPPDEOHVHWE\DQDYHUDJLQJLQWHUYDO7KH DYHUDJLQJLQWHUYDOUHSUHVHQWVDFKDQJHLQWKHUPDOGHPDQGWRDVWHSFKDQJHLQ SRZHU Predictive Window Demand: 3UHGLFWLYH:LQGRZ'HPDQGHQDEOHVWKHXVHUWRIRUHFDVWDYHUDJHGHPDQGIRUIXWXUH WLPHLQWHUYDOV7KH1H[XVXVHVWKHGHOWDUDWHRIFKDQJHRID5ROOLQJ:LQGRZ 'HPDQGLQWHUYDOWRSUHGLFWDYHUDJHGHPDQGIRUDQDSSURDFKLQJWLPHSHULRG7KHXVHU FDQVHWDUHOD\RUDODUPWRVLJQDOZKHQWKH3UHGLFWLYH:LQGRZUHDFKHVDVSHFLILFOHYHO WKHUHE\DYRLGLQJXQDFFHSWDEOHGHPDQGOHYHOV7KH1H[XVFDOFXODWHV 3UHGLFWLYH:LQGRZ'HPDQGXVLQJWKHIROORZLQJIRUPXOD ([DPSOH8VLQJWKHSUHYLRXVVHWWLQJVRIILYHPLQXWHLQWHUYDOVDQGDQHZVHWWLQJRI SUHGLFWLRQIDFWRUWKHZRUNLQJRIWKH3UHGLFWLYH:LQGRZ'HPDQGFRXOGEH GHVFULEHGDVIROORZV $WZHKDYHWKHDYHUDJHRIWKHVXELQWHUYDOVIURP DQG,QILYHPLQXWHVZHZLOOKDYHDQDYHUDJHRIWKHVXELQWHU YDOVDQGZKLFKZHNQRZDQGZKLFKZHGR QRW\HWNQRZ$VDJXHVVZHZLOOXVHWKHODVWVXELQWHUYDODVDQ DSSUR[LPDWLRQIRUWKHQH[WVXELQWHUYDO$VDIXUWKHUUHILQHPHQWZH ZLOODVVXPHWKDWWKHQH[WVXELQWHUYDOPLJKWKDYHDKLJKHUDYHUDJHWKDQWKH ODVWVXELQWHUYDO$VZHSURJUHVVLQWRWKHVXELQWHUYDOIRUH[DPSOHXSWRWKH 3UHGLFWLYH:LQGRZ'HPDQGZLOOEHWKHDYHUDJHRIWKHILUVWWZRVXELQWHUYDOV WKHDFWXDOYDOXHVRIWKHFXUUHQWVXELQWHUYDODQG Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 0HWHU&DOFXODWLRQV WKHSUHGLFWLRQIRUWKHUHPDLQGHURIWKHVXELQWHUYDORIWKHRIWKH VXELQWHUYDO RI6XELQWHUYDOV Q 6XELQWHUYDO/HQJWK /HQ 3DUWLDO6XELQWHUYDO/HQJWK &QW 3UHGLFWLRQ)DFWRU 3FW Table 1: 6XEQ 6XE 6XE 3DUWLDO 3UHGLFW /HQ /HQ /HQ &QW /HQ Len 1 ¦Value i Sub i 0 Len Cnt 1 ¦Value i Partial i 0 Cnt n2 º ª Valuei » ¦ « ª ª ª Len Cnt º ºº » u «1 « « « Partial i 0 u Pct » » » n » ¬ ¬ ¬ Len ¼ « ¼¼ »¼ «¬ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( 0HWHU&DOFXODWLRQV º ª n2 « ¦ Subi Sub Sub » ª ª Len Cnt º º 0 n 1 » u «« u Pct » «i 0 » 2 x(n 1) » ¬ ¬ Len ¼ « n 1 ¼ »¼ «¬ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( (1,(&)OLFNHU 14: EN50160/IEC61000-4-15 Flicker 14.1: Overview )OLFNHULVWKHVHQVDWLRQH[SHULHQFHGE\WKHKXPDQYLVXDOV\VWHPZKHQVXEMHFWHGWR FKDQJHVLQWKHLOOXPLQDWLRQLQWHQVLW\RIOLJKWVRXUFHV7KHSULPDU\HIIHFWVRI)OLFNHUDUH KHDGDFKHVDQGLUULWDELOLW\VRPHWLPHV)OLFNHUFDQWULJJHUHSLOHSWLFILWV ,(&DQGIRUPHU,(&GHVFULEHWKHPHWKRGVXVHGWRGHWHUPLQH)OLFNHU VHYHULW\6LQFHWKLVSKHQRPHQRQLVVWULFWO\UHODWHGWRWKHVHQVLWLYLW\DQGUHDFWLRQRI LQGLYLGXDOVLWFDQRQO\EHVWXGLHGRQDVWDWLVWLFDOEDVLVE\VHWWLQJXSVXLWDEOHH[SHUL PHQWVDPRQJSHRSOH 14.2: Theory of Operation )OLFNHUFDQEHFDXVHGE\YROWDJHYDULDWLRQVZKLFKLQWXUQDUHFDXVHGE\YDULDEOH ORDGVVXFKDVDUFIXUQDFHVODVHUSULQWHUVDQGPLFURZDYHRYHQV,QRUGHUWRPRGHO WKHH\HEUDLQFKDQJHZKLFKLVDFRPSOH[SK\VLRORJLFDOSURFHVVWKHVLJQDOIURPWKH SRZHUQHWZRUNKDVWREHSURFHVVHGZKLOHFRQIRUPLQJZLWK)LJXUHVKRZQRQ SDJH %ORFNFRQVLVWVRIVFDOLQJFLUFXLWU\DQGDQDXWRPDWLFJDLQFRQWUROIXQFWLRQWKDWQRU PDOL]HVLQSXW9ROWDJHVWR%ORFNVDQG)RUWKHVSHFLILHG+]RSHUDWLRQWKH 9ROWDJHVWDQGDUGLV9506 %ORFNUHFRYHUVWKH9ROWDJHIOXFWXDWLRQE\VTXDULQJWKHLQSXW9ROWDJHVFDOHGWRWKH UHIHUHQFHOHYHO7KLVVLPXODWHVWKHEHKDYLRURIDODPS %ORFNLVFRPSRVHGRIDFDVFDGHRIWZRILOWHUVDQGDPHDVXULQJUDQJHVHOHFWRU,Q WKLVLPSOHPHQWDWLRQDORJFODVVLILHUFRYHUVWKHIXOOVFDOHLQXVHVRWKHJDLQVHOHFWLRQ LVDXWRPDWLFDQGQRWVKRZQKHUH7KHILUVWILOWHUHOLPLQDWHVWKH'&FRPSRQHQWDQG WKHGRXEOHPDLQVIUHTXHQF\FRPSRQHQWVRIWKHGHPRGXODWHGRXWSXW7KHFRQILJXUD WLRQFRQVLVWVRID+]/RZ+LJK3DVVILOWHUDQGD3ROH%XWWHUZRUWK/RZ3DVV ILOWHUORFDWHGDW+]7KHVHFRQGILOWHULVDZHLJKWLQJILOWHUWKDWVLPXODWHVWKH UHVSRQVHRIWKHKXPDQYLVXDOV\VWHPWRVLQXVRLGDO9ROWDJHIOXFWXDWLRQVRIDFRLOHG ILODPHQWJDVILOOHGODPS:97KHILOWHULPSOHPHQWDWLRQRIWKLVIXQFWLRQ LVDVVSHFLILHGLQ,(& Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( (1,(&)OLFNHU %ORFNLVFRPSRVHGRIDVTXDULQJPXOWLSOLHUDQGD/RZ3DVVILOWHU7KH+XPDQ )OLFNHU6HQVDWLRQYLDODPSH\HDQGEUDLQLVVLPXODWHGE\WKHFRPELQHGQRQOLQHDU UHVSRQVHRI%ORFNVDQG %ORFNSHUIRUPVDQRQOLQHVWDWLVWLFDOFXPXODWLYHSUREDELOLW\DQDO\VLVRIWKHIOLFNHU OHYHO%ORFNDOORZVGLUHFWFDOFXODWLRQRIWKHHYDOXDWLRQSDUDPHWHUV3VWDQG3OW )OLFNHULVFRPSXWHGXVLQJWKHWKUHHSKDVHWRQHXWUDO9ROWDJHVLQ:\HFRQILJXUDWLRQV DQGWKHWKUHHSKDVHWRSKDVH9ROWDJHVZKHQLQ'HOWD(YDOXDWLRQRFFXUVLQWKHIROORZ LQJIRUPV,QVWDQWDQHRXV6KRUW7HUPRU/RQJ7HUP ,QVWDQWDQHRXV)OLFNHU(YDOXDWLRQ$QRXWSXWRIIURP%ORFNFRUUHVSRQGVWR WKH5HIHUHQFH+XPDQ)OLFNHU3HUFHSWLELOLW\7KUHVKROGIRURIWKHSRSXODWLRQ 7KLVYDOXHLVPHDVXUHGLQ3HUFHSWLELOLW\8QLWV38DQGLVODEHOHG3LQVW7KLVLVDUHDO WLPHYDOXHDQGLWLVFRQWLQXRXVO\XSGDWHG 6KRUW7HUP)OLFNHU(YDOXDWLRQ$QRXWSXWRIIURP%ORFNFRUUHVSRQGLQJWRWKH 3VWYDOXHFRUUHVSRQGVWRWKHFRQYHQWLRQDOWKUHVKROGRILUULWDELOLW\SHU,(& ,QRUGHUWRHYDOXDWHIOLFNHUVHYHULW\WZRSDUDPHWHUVKDYHEHHQGHILQHGRQHIRU WKHVKRUWWHUPFDOOHG3VWGHILQHGLQWKLVVHFWLRQDQGRQHIRUWKHORQJWHUPFDOOHG 3OWGHILQHGLQWKHQH[WVHFWLRQ 7KHVWDQGDUGPHDVXUHPHQWWLPHIRU3VWLVPLQXWHV3VWLVGHULYHGIURPWKHWLPH DWOHYHOVWDWLVWLFVREWDLQHGIURPWKHOHYHOFODVVLILHULQ%ORFNRIWKHIOLFNHUPHWHU 7KHIROORZLQJIRUPXODLVXVHG Pst 0.0314 P0.1 0.0525 P1s 0.0657 P3 s 0.28 P10 s 0.08 P50 s ZKHUHWKHSHUFHQWLOHV33333DUHWKHIOLFNHUOHYHOV H[FHHGHGIRUDQGRIWKHWLPHGXULQJWKHREVHUYDWLRQSHULRG7KH VXIIL[6LQWKHIRUPXODLQGLFDWHVWKDWWKHVPRRWKHGYDOXHVKRXOGEHXVHG7KH VPRRWKHGYDOXHVDUHREWDLQHGXVLQJWKHIROORZLQJIRUPXODV 3V 333 3V 333 3V 33333 3V 333 Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( (1,(&)OLFNHU 7KHVHFRQGPHPRU\WLPHFRQVWDQWLQWKHIOLFNHUPHWHUHQVXUHVWKDW3FDQQRW FKDQJHDEUXSWO\DQGQRVPRRWKLQJLVQHHGHGIRUWKLVSHUFHQWLOH /RQJ7HUP)OLFNHU(YDOXDWLRQ7KHPLQXWHSHULRGRQZKLFKWKHVKRUWWHUPIOLFNHU VHYHULW\LVEDVHGLVVXLWDEOHIRUVKRUWGXW\F\FOHGLVWXUEDQFHV)RUIOLFNHUVRXUFHV ZLWKORQJDQGYDULDEOHGXW\F\FOHVHJDUFIXUQDFHVLWLVQHFHVVDU\WRSURYLGHFUL WHULDIRUORQJWHUPDVVHVVPHQW)RUWKLVSXUSRVHWKHORQJWHUP3OWLVGHULYHGIURP WKHVKRUWWHUPYDOXHVRYHUDQDSSURSULDWHSHULRG%\GHILQLWLRQWKLVLVVKRUW WHUPYDOXHVRIPLQXWHVHDFKRYHUDSHULRGRIKRXUV7KHIROORZLQJIRUPXODLV XVHG N Plt 3 ¦P 3 sti i 1 N ZKHUH3VWLL DUHFRQVHFXWLYHUHDGLQJVRIWKHVKRUWWHUPVHYHULW\3VW 14.2.1: Summary: Flicker &KDQJHVLQWKHLOOXPLQDWLRQRIOLJKWVRXUFHVGXHWRF\FOLFDO9ROWDJH YDULDWLRQV Pinst ,QVWDQWDQHRXVIOLFNHUYDOXHVLQ3HUFHSWLELOLW\8QLWV38 Pst 9DOXHEDVHGRQPLQXWHDQDO\VLV Plt 9DOXHEDVHGRQ3VWYDOXHV Measurement Procedure: 2ULJLQDO6LJQDOZLWKDPSOLWXGHYDULDWLRQV 6TXDUHGHPRGXODWRU :HLJKWHGILOWHU /RZSDVVILOWHUVWRUGHU 6WDWLVWLFDOFRPSXWLQJ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( (1,(&)OLFNHU Data available: 3VW3VW0D[3VW0LQYDOXHVIRUORQJWHUPUHFRUGLQJ 3OW3OW0D[3OW0LQYDOXHVIRUORQJWHUPUHFRUGLQJ Simulation Of Eye Brain Response Block 1 Block 2 Block 3 Voltage Detector and Gain Control Square Law Demodulator Input Voltage Adaptor High Pass Filter (DC Removal) Low Pass Filter (Carrier Removal Weighting Filter Block 4 Squaring Multiplier 1st Order Sliding Mean Filter Block 5 A/D Converter Sampling Rate >50Hz Minimum 64 level Classifier Output Interface Programming of short and long observation periods Output Recording Instantaneous Flicker in Perceptibility Units (Pinst) Output and Data Display Pst Max/Min Pst Plt Max/Min Plt )LJXUH6LPXODWLRQRI(\H%UDLQ5HVSRQVH 14.3: Flicker Setup <RXPXVWVHWXSVHYHUDOSDUDPHWHUVWRSURSHUO\FRQILJXUH)OLFNHU 6HOHFWWKHProfileLFRQIURP&RPPXQLFDWRU(;7 V,FRQEDU )URPWKH'HYLFH3URILOHVFUHHQGRXEOHFOLFNPower Quality and Alarm Settings>EN50160/IEC61000-4-30 Flicker<RXZLOOVHHWKHVFUHHQVKRZQ EHORZ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( (1,(&)OLFNHU 6HOHFWWKH)UHTXHQF\RIRSHUDWLRQ+]LVWKHDSSURYHGIUHTXHQF\DFFRUGLQJ WR)OLFNHUVWDQGDUGV$+]LPSOHPHQWDWLRQLVDYDLODEOHDQGFDQEHVHOHFWHG 5HPHPEHUWKH9ROWDJHLVQRUPDOL]HG)RU+]WKHQRUPDOL]HG9ROWDJHLV 9DQGIRU+]WKHQRUPDOL]HG9ROWDJHLV9 6HOHFWD6KRUW7HUP7HVW7LPH367WLPHUDQJHIURPWRPLQXWHV7KH VWDQGDUGPHDVXUHPHQWSHULRGLVQRPLQDOO\PLQXWHV 6HOHFWD/RQJ7HUP7HVW7LPH3/7WLPHUDQJHIURPWRPLQXWHV7KH VWDQGDUGPHDVXUHPHQWLVQRPLQDOO\3VWSHULRGVPLQXWHV3OWWLPH PXVWDOZD\VEHHTXDOWRRUJUHDWWKDQDQGDPXOWLSOHRI3VWWLPH7KLVLV UHIOHFWHGLQWKHDYDLODEOHVHOHFWLRQV &OLFNOKZKHQ\RXDUHILQLVKHG 14.4: Flicker Polling Screen )URPWKH&RPPXQLFDWRU(;77LWOHEDUVHOHFWReal-Time Poll>Power Quality and Alarms>Flicker<RXZLOOVHHWKHVFUHHQVKRZQEHORZ Main screen 7KLVVHFWLRQGHVFULEHVWKH0DLQ6FUHHQIXQFWLRQV7KHVHIXQFWLRQVDUHIRXQGRQWKH OHIWVLGHRIWKHVFUHHQ Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( (1,(&)OLFNHU 7LPH 6WDUW5HVHWLVWKHWLPHZKHQ)OLFNHUZDVVWDUWHGRUUHVHW$5HVHWRI)OLFNHUFDXVHV WKH0D[0LQYDOXHVWREHFOHDUHGDQGUHVWDUWVWKH)OLFNHU3VWDQG3OWWLPHUV$6WDUW RI)OLFNHULVDOVRHTXLYDOHQWWRD5HVHWLQWKDWWKH367DQG3/7DUHUHVWDUWHGDQGWKH 0D[0LQ9DOXHVDUHFOHDUHG 6WRSFRUUHVSRQGVWRWKHWLPHZKHQ)OLFNHULVWXUQHGRII &XUUHQWLVWKHFXUUHQWFORFNWLPH 1H[W3VWLVWKHFRXQWGRZQWLPHWRZKHQWKHQH[W3VWYDOXHLVDYDLODEOH 1H[W3OWLVWKHFRXQWGRZQWLPHWRZKHQWKHQH[W3OWYDOXHLVDYDLODEOH 6WDWXV ,QGLFDWHVWKHFXUUHQWVWDWXV$FWLYH 2Q6WRSSHG 2II )UHTXHQF\ %DVHLVWKHRSHUDWLQJIUHTXHQF\RU+]VHOHFWHGLQWKH(1)OLFNHU VFUHHQVHH6HFWLRQ &XUUHQWLVWKHUHDOWLPHIUHTXHQF\PHDVXUHPHQWRIWKHDSSOLHG9ROWDJH %DVH9ROWDJH 7KHQRUPDOL]HG9ROWDJHIRUWKHVHOHFWHGIUHTXHQF\9IRU+]RU9IRU +] )OLFNHU0RQLWRULQJ &OLFNLQJRQStopFDXVHV)OLFNHUWRVWRSEHLQJSURFHVVHGDQGIUHH]HVDOOWKHFXUUHQW YDOXHV6WRS7LPHLVUHFRUGHGDQGWKHFXUUHQW0D[0LQYDOXHVDUHFOHDUHG &OLFNLQJRQStart VWDUWV)OLFNHUSURFHVVLQJ6WDUW7LPHLVUHFRUGHG &OLFNLQJRQReset FDXVHVWKH0D[0LQYDOXHVWREHFOHDUHGDQGUHVWDUWVWKH)OLFNHU 3VWDQG3OWWLPHUV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( (1,(&)OLFNHU 8VHWKHWDEVDWWKHWRSRIWKHVFUHHQWRQDYLJDWHWRWKH,QVWDQWDQHRXV6KRUW7HUP DQG/RQJ7HUP5HDGLQJVYLHZVVKRZQRQWKHULJKWVLGHRIWKHVFUHHQ Instantaneous Readings: NOTE:7KH,QVWDQWDQHRXVYLHZLVWKHGHIDXOWRIWKLVVFUHHQ6HHWKHVFUHHQSLFWXUHG RQWKHSUHYLRXVSDJH,I\RXDUHLQWKH6KRUWRU/RQJ7HUPYLHZVFOLFNRQWKH,QVWDQ WDQHRXVWDEWRGLVSOD\WKLVYLHZ 7KH38YDOXHV3LQVWIRU9ROWDJH,QSXWV9D9EDQG9FDUHGLVSOD\HGKHUHDQGDUH FRQWLQXRXVO\XSGDWHG7KHFRUUHVSRQGLQJ&XUUHQW9ROWDJHYDOXHVIRUHDFKFKDQQHO DUHGLVSOD\HGIRUUHIHUHQFH Short Term Readings: &OLFNRQWKH6KRUW7HUPWDEWRDFFHVVDVFUHHQFRQWDLQLQJWKUHHJURXSVRI3VWUHDGLQJV VKRZQEHORZ 3VW5HDGLQJV'LVSOD\HG &XUUHQW3VWYDOXHVIRU9D9EDQG9FDQGWKHWLPHRIFRPSXWDWLRQ &XUUHQW3VW0D[YDOXHVIRU9D9EDQG9FVLQFHWKHODVWUHVHWDQGWKHWLPHRIWKH ODVWUHVHW Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( (1,(&)OLFNHU &XUUHQW3VW0LQYDOXHVIRU9D9EDQG9FVLQFHWKHODVWUHVHWDQGWKHWLPHRIWKHODVW UHVHW Long Term Readings: &OLFNRQWKH/RQJ7HUPWDEWRDFFHVVDVFUHHQFRQWDLQLQJWKUHHJURXSVRI3OW UHDGLQJVVKRZQEHORZ 3OW5HDGLQJV'LVSOD\HG &XUUHQW3OWYDOXHVIRU9D9EDQG9FDQGWKHWLPHRIFRPSXWDWLRQ &XUUHQW3OW0D[YDOXHVIRU9D9EDQG9FVLQFHWKHODVWUHVHWDQGWKHWLPHRIWKHODVW UHVHW &XUUHQW3OW0LQYDOXHVIRU9D9EDQG9FVLQFHWKHODVWUHVHWDQGWKHWLPHRIWKHODVW UHVHW &OLFNOKWRH[LWWKH(1,(&)OLFNHU3ROOLQJVFUHHQFOLFNPrintWR SULQWDOORIWKH5HDGLQJVYLHZV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( (1,(&)OLFNHU 14.5: Logging 7KH1H[XVPHWHULVFDSDEOHRIORJJLQJ)OLFNHUYDOXHVLQDQLQGHSHQGHQW ORJ:KHQ)OLFNHULVRQHQWULHVDUHPDGHLQWRWKHORJLQDFFRUGDQFHZLWKWKHWLPHV WKDWDVVRFLDWHGYDOXHVRFFXU3VW3VW0D[3VW0LQ3OW3OW0D[3OW0LQ6WDUW5HVHW DQG6WRSWLPHVDUHDOOUHFRUGHG$OOYDOXHVFDQEHGRZQORDGHGWRWKH/RJ9LHZHU ZKHUHWKH\DUHDYDLODEOHIRUJUDSKLQJRUH[SRUWWRDQRWKHUSURJUDPVXFKDV([FHO$OO )OLFNHUYDOXHVDUHSUHGHILQHGDQGFDQQRWEHFKDQJHG5HIHUWR&KDSWHURIWKH Communicator EXT User ManualIRUDGGLWLRQDOLQVWUXFWLRQVFRQFHUQLQJWKH)OLFNHUORJ 14.6: Polling through a Communication Port 7KH3LQVW3VW3VW0D[3VW0LQ3OW3OW0D[3OW0LQYDOXHVFDQEHSROOHGWKURXJKWKH &RPPXQLFDWLRQV3RUW5HIHUWRWKH1H[XVPHWHUV 0RGEXVDQG'13 0DSSLQJPDQXDOVIRUUHJLVWHUDVVLJQPHQWVDQGGDWDGHILQLWLRQV 14.7: Log Viewer 2SHQ/RJ9LHZHUE\VHOHFWLQJWKHOpen LogsLFRQIURP&RPPXQLFDWRU(;7 V,FRQ EDU 8VLQJWKHPHQXVDWWKHWRSRIWKHVFUHHQVHOHFWDPHWHUWLPHUDQJHVDQGYDOXHVWR DFFHVV &OLFNWKHFlickerLFRQ 7KHYDOXHVDQGWKHDVVRFLDWHGWLPHVWDPSVZKHQWKHYDOXHVRFFXUUHGDUHGLVSOD\HG LQDJULGER[8VHWKHEXWWRQVDWWKHERWWRPRIWKHVFUHHQWRFUHDWHDJUDSKRUH[SRUW WKHGDWDWRDQRWKHUSURJUDP *UDSKHGYDOXHVLQFOXGH3VWDQG3OW9D9EDQG9F 'LVSOD\HGYDOXHVLQFOXGH3VWDQG3OW0D[DQG0LQIRU9D9EDQG9F NOTE0D[DQG0LQYDOXHVDUHRQO\GLVSOD\HGWKH\FDQQRWEHJUDSKHG+RZHYHU 0D[DQG0LQYDOXHVDUHDYDLODEOHIRUH[SRUW Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( (1,(&)OLFNHU 14.8: Performance Notes 3VWDQG3OWDYHUDJHWLPHDUHV\QFKURQL]HGWRWKHFORFNHJIRUDPLQXWHDYHUDJH WKHWLPHVZLOORFFXUDWHWF7KHDFWXDOWLPHRIWKHILUVWDYHUDJHFDQEHOHVV WKDQWKHVHOHFWHGSHULRGWRDOORZIRULQLWLDOFORFNV\QFKURQL]DWLRQ ,IWKHZURQJIUHTXHQF\LVFKRVHQHJ+]VHOHFWLRQIRUDV\VWHPRSHUDWLQJDW +])OLFNHUZLOOVWLOORSHUDWHEXWWKHFRPSXWHGYDOXHVZLOOQRWEHYDOLG7KHUHIRUH \RXVKRXOGVHOHFWWKHIUHTXHQF\VHWWLQJZLWKFDUH 8VHUVHWWLQJVDUHVWRUHG,I)OLFNHULVRQDQGSRZHULVUHPRYHGIURPWKHPHWHU)OLFNHU ZLOOVWLOOEHRQZKHQSRZHUUHWXUQV7KLVFDQFDXVHJDSVLQWKHORJJHGGDWD 7KH0D[DQG0LQYDOXHVDUHVWRUHGDQGDUHQRWORVWLIWKHXQLWLVSRZHUHGGRZQ )OLFNHUPHHWVWKHUHTXLUHPHQWVRI,(&DQGIRUPHU,(&5HIHUWRWKRVH VSHFLILFDWLRQVIRUPRUHGHWDLOVLIQHHGHG0HWHUVZLWKWKH)OLFNHURSWLRQDOVRPHHWWKH ,(&FRQIRUPDQFHVWDQGDUGVIRU)OLFNHU5HIHUWRFKDSWHUVDQGLQWKH Communicator EXT User ManualIRUDGGLWLRQDOLQIRUPDWLRQ 2SHUDWLRQLVDW9IRU+]DQG9IRU+]DVSHUVSHFLILFDWLRQ,IWKHLQSXW 9ROWDJHLVGLIIHUHQWWKHV\VWHPZLOOQRUPDOL]HLWWR9RU9IRUFRPSXWDWLRQDO SXUSRVHV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( $7/&6SUHDGVKHHWDQG([DPSOHV A: Transformer Line Loss Compensation Spreadsheet and Examples A.1: Calculating Values 7UDQVIRUPHU/RVV&RPSHQVDWLRQLVGLVFXVVHGLQ&KDSWHU9DOXHVIRUWKUHHHOHPHQW LQVWDOODWLRQVFDQEHFDOFXODWHGLQWZRZD\V Through an Excel Spreadsheet: &OLFNWKHTLC CalculatorEXWWRQRQWKH7UDQVIRUPHU/RVVVFUHHQRIWKHPHWHU¶V 'HYLFH3URILOH7KH7/&&DOFXODWRUEXWWRQDFWLYDWHVDQ([FHO6SUHDGVKHHWEXW21/< LI\RXKDYH06([FHOLQVWDOOHGRQ\RXUFRPSXWHU$FRS\RIWKH([FHO6SUHDGVKHHWLV VKRZQRQWKHIROORZLQJSDJHVZLWKH[DPSOHQXPEHUV (QWHUWKHUHTXLUHGGDWDLQWRWKH([FHO6SUHDGVKHHW7KH([FHOSURJUDPZLOOFDOFX ODWHWKHYDOXHVQHHGHGIRUWKH7UDQVIRUPHU/RVVVFUHHQRIWKH'HYLFH3URILOH (QWHUWKHYDOXHVLQWRWKH'HYLFH3URILOH Manually: 8VHWKHZRUNVKHHWIRXQGLQ&KDSWHU³7KUHH(OHPHQW/RVV&RPSHQVDWLRQ:RUN VKHHW´WRFDOFXODWHWKHYDOXHVE\KDQG5HIHUWRWKH1RWHVXQGHUHDFKVHFWLRQ (QWHUYDOXHVEDVHGRQWKHWUDQVIRUPHUPDQXIDFWXUHU¶VWHVWUHSRUW7KHZRUNVKHHWLV SURJUHVVLYHDQGQRWHVXQGHUHDFKVHFWLRQZLOOJXLGH\RXWRWKHQH[WVHFWLRQ (QWHUWKHYDOXHVLQWRWKH'HYLFH3URILOH A.2: Excel Spreadsheet with Example Numbers ,I\RXKDYH06([FHOLQVWDOOHGLQ\RXUFRPSXWHUXVHWKHTLC CalculatorEXWWRQRQ WKH7UDQVIRUPHU/RVVVFUHHQRIWKH'HYLFH3URILOH5HIHUWRWKHVSUHDGVKHHWFRSLHV ZLWKH[DPSOHQXPEHUVIRXQGRQWKHIROORZLQJSDJHV IMPORTANT! Refer to Appendix B of the Communicator EXT User Manual for additional instructions and information on the Transformer Line Loss application. Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( $ $7/&6SUHDGVKHHWDQG([DPSOHV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( $ $7/&6SUHDGVKHHWDQG([DPSOHV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( $ $7/&6SUHDGVKHHWDQG([DPSOHV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( $ $7/&6SUHDGVKHHWDQG([DPSOHV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( $ $7/&6SUHDGVKHHWDQG([DPSOHV 7KLVSDJHLQWHQWLRQDOO\OHIWEODQN Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( $ %%ODGH&RQILJXUDWLRQIRU)RUPV666 B: Blade Configuration for Forms 9S, 36S and 45S B.1: 1262/1272 Forms )RXUVXSSRUWHGIRUPVIRUWKH1H[XV6RFNHWPHWHUVZLWKWKHLUZLULQJ FRQILJXUDWLRQVDUHVKRZQLQ&KDSWHU7KRVHIRUPVDUHEDVHGRQWKHUDWHG9ROWDJH DQGKRRNXSUHTXLUHGIRU\RXUDSSOLFDWLRQ&XVWRPIRUPVDQGFRQILJXUDWLRQVDUHDOVR DYDLODEOHIURP(,* 7KHWKUHHVXSSRUWHGIRUPVZLWKZLULQJFRQILJXUDWLRQVIRUWKH1H[XV 6RFNHWPHWHUVDUHOLVWHGEHORZ 9S :\HQR37VRU37V&7V :LUH'HOWDQR37VRU37V&7V (/:\HQR37VRU37V&7V :LUH'HOWDQR37VRU37V&7V :LUH'HOWDQR37VRU37V&7V 36S (/:\HQR37VRU37V&7V 45S :\HQR37VRU37V&7V :LUH'HOWDQR37VRU37V&7V :LUH'HOWDQR37VRU37V&7V Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( % %%ODGH&RQILJXUDWLRQIRU)RUPV666 B.2: Blade Configuration Drawings 'HWDLOHGGUDZLQJVRIWKH%ODGHFRQILJXUDWLRQVDUHRIIHUHGEHORZ7KHUHDUHWZR FRQILJXUDWLRQVEHFDXVHWKH6DQGWKH6DUHWKHVDPH7KHUHLVDGUDZLQJVKRZLQJ WKHNQRFNRXWKROHVIRUHDFKFRQILJXUDWLRQ NOTE:7KHIRUPVUHIHUUHGWRLQWKLVDSSHQGL[FRPSO\ZLWK$16,IRUPV66DQG 6 )LJXUH%)RUP66%DVHZLWK.QRFN2XW+ROHV )LJXUH%)RUP6%DVHZLWK.QRFN2XW+ROHV Electro Industries/GaugeTech Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions The Leader In Power Monitoring and Smart Grid Solutions 'RF# ( % *ORVVDU\ Glossary 6HFRQG9DOXHV 7KHVHYDOXHVDUHWKH506YDOXHVRIWKHLQGLFDWHG TXDQWLW\DVFDOFXODWHGDIWHUDSSUR[LPDWHO\ PLOOLVHFRQGVF\FOHVRIVDPSOLQJ 6HFRQG9DOXHV 7KHVHYDOXHVDUHWKH506YDOXHVRIWKHLQGLFDWHG TXDQWLW\DVFDOFXODWHGDIWHURQHVHFRQG F\FOHVRIVDPSOLQJ $ODUP $QHYHQWRUFRQGLWLRQLQDPHWHUWKDWFDQFDXVHD WULJJHURUFDOOEDFNWRRFFXU $QQXQFLDWRU $VKRUWODEHOWKDWLGHQWLILHVSDUWLFXODUTXDQWLWLHVRU YDOXHVGLVSOD\HGIRUH[DPSOHN:K $YHUDJH&XUUHQW :KHQDSSOLHGWRFXUUHQWYDOXHV$PSVWKH DYHUDJHLVDFDOFXODWHGYDOXHWKDWFRUUHVSRQGVWR WKHWKHUPDODYHUDJHRYHUDVSHFLILHGWLPH LQWHUYDO 7KHLQWHUYDOLVVSHFLILHGE\WKHXVHULQWKHPHWHU SURILOH7KHLQWHUYDOLVW\SLFDOO\PLQXWHV 6R$YHUDJH$PSVLVWKHWKHUPDODYHUDJHRI$PSV RYHUWKHSUHYLRXVPLQXWHLQWHUYDO7KHWKHUPDO DYHUDJHULVHVWRRIWKHDFWXDOYDOXHLQHDFK WLPHLQWHUYDO)RUH[DPSOHLIDFRQVWDQW$PS ORDGLVDSSOLHGWKHWKHUPDODYHUDJHZLOOLQGLFDWH DPSVDIWHURQHWLPHLQWHUYDODPSVDIWHU WZRWLPHLQWHUYDOVDQGDPSVDIWHUWKUHHWLPH LQWHUYDOV $YHUDJH,QSXW3XOVH :KHQDSSOLHGWR,QSXW3XOVH$FFXPXODWLRQVWKH $FFXPXODWLRQV ³$YHUDJH´UHIHUVWRWKHEORFNIL[HGZLQGRZ DYHUDJHYDOXHRIWKHLQSXWSXOVHV Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions'RF# ( */ *ORVVDU\ $YHUDJH3RZHU :KHQDSSOLHGWRSRZHUYDOXHV:DWWV9$5V9$ WKHDYHUDJHLVDFDOFXODWHGYDOXHWKDWFRUUHVSRQGV WRWKHWKHUPDODYHUDJHRYHUDVSHFLILHGWLPH LQWHUYDO 7KHLQWHUYDOLVVSHFLILHGE\WKHXVHULQWKHPHWHU SURILOH7KHLQWHUYDOLVW\SLFDOO\PLQXWHV 6RWKH$YHUDJH:DWWVLVWKHWKHUPDODYHUDJHRI :DWWVRYHUWKHSUHYLRXVPLQXWHLQWHUYDO7KH WKHUPDODYHUDJHULVHVWRRIWKHDFWXDOYDOXH LQHDFKWLPHLQWHUYDO)RUH[DPSOHLIDFRQVWDQW N:ORDGLVDSSOLHGWKHWKHUPDODYHUDJHZLOO LQGLFDWHN:DIWHURQHWLPHLQWHUYDON:DIWHU WZRWLPHLQWHUYDOVDQGN:DIWHUWKUHHWLPH LQWHUYDOV %LW $XQLWRIFRPSXWHULQIRUPDWLRQHTXLYDOHQWWRWKH UHVXOWRIDFKRLFHEHWZHHQWZRDOWHUQDWLYHV<HV 1R2Q2IIIRUH[DPSOH 2UWKHSK\VLFDOUHSUHVHQWDWLRQRIDELWE\DQ HOHFWULFDOSXOVHZKRVHSUHVHQFHRUDEVHQFH LQGLFDWHVGDWD %LQDU\ 5HODWLQJWRDV\VWHPRIQXPEHUVKDYLQJDVLWV EDVHGLJLWVDQG %ORFN:LQGRZ$YJ 3RZHU 7KH%ORFN)L[HG:LQGRZ$YHUDJHLVWKHDYHUDJH SRZHUFDOFXODWHGRYHUDXVHUVHWWLPHLQWHUYDO W\SLFDOO\PLQXWHV7KLVFDOFXODWHGDYHUDJH FRUUHVSRQGVWRWKHGHPDQGFDOFXODWLRQV SHUIRUPHGE\PRVWHOHFWULFXWLOLWLHVLQPRQLWRULQJ XVHUSRZHUGHPDQG6HH5ROOLQJ:LQGRZ $YHUDJH Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions'RF# ( */ *ORVVDU\ %\WH $JURXSRIELQDU\GLJLWVSURFHVVHGDVDXQLWE\D FRPSXWHURUGHYLFHDQGXVHGHVSHFLDOO\WR UHSUHVHQWDQDOSKDQXPHULFFKDUDFWHU &%(0$&XUYH $9ROWDJHTXDOLW\FXUYHHVWDEOLVKHGRULJLQDOO\E\ WKH&RPSXWHU%XVLQHVV(TXLSPHQW0DQXIDFWXUHUV $VVRFLDWLRQ7KH&%(0$&XUYHGHILQHV9ROWDJH GLVWXUEDQFHVWKDWFRXOGFDXVHPDOIXQFWLRQRU GDPDJHLQPLFURSURFHVVRUGHYLFHV 7KHFXUYHLVFKDUDFWHUL]HGE\9ROWDJHPDJQLWXGH DQGWKHGXUDWLRQZKLFKWKH9ROWDJHLVRXWVLGHRI WROHUDQFH6HH,7,&&XUYH &KDQQHO 7KHVWRUDJHRIDVLQJOHYDOXHLQHDFKLQWHUYDOLQD ORDGSURILOH &ROG/RDG3LFNXS 7KLVYDOXHLVWKHGHOD\IURPWKHWLPHFRQWURO SRZHULVUHVWRUHGWRWKHWLPHZKHQWKHXVHUZDQWV WRUHVXPHGHPDQGDFFXPXODWLRQ &5&)LHOG &\FOLF5HGXQGDQF\&KHFN)LHOG0RGEXV FRPPXQLFDWLRQLVDQHUURUFKHFNVXP FDOFXODWLRQWKDWHQDEOHVD6ODYHGHYLFHWR GHWHUPLQHLIDUHTXHVWSDFNHWIURPD0DVWHU GHYLFHKDVEHHQFRUUXSWHGGXULQJWUDQVPLVVLRQ,I WKHFDOFXODWHGYDOXHGRHVQRWPDWFKWKHYDOXHLQ WKHUHTXHVWSDFNHWWKH6ODYHLJQRUHVWKHUHTXHVW &7&XUUHQW5DWLR $&XUUHQW7UDQVIRUPHU5DWLRLVXVHGWRVFDOHWKH YDOXHRIWKHFXUUHQWIURPDVHFRQGDU\YDOXHXSWR WKHSULPDU\VLGHRIDQLQVWUXPHQWWUDQVIRUPHU &XPXODWLYH'HPDQG 7KHVXPRIWKHSUHYLRXVELOOLQJSHULRGPD[LPXP GHPDQGUHDGLQJVDWWKHWLPHRIELOOLQJSHULRG UHVHW7KHPD[LPXPGHPDQGIRUWKHPRVWUHFHQW ELOOLQJSHULRGLVDGGHGWRWKHSUHYLRXVO\ Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions'RF# ( */ *ORVVDU\ DFFXPXODWHGWRWDORIWKHPD[LPXPGHPDQGV 'HPDQG 7KHDYHUDJHYDOXHRISRZHURUDVLPLODUTXDQWLW\ RYHUDVSHFLILHGSHULRGRIWLPH 'HPDQG,QWHUYDO $VSHFLILHGWLPHRYHUZKLFKGHPDQGLVFDOFXODWHG 'LVSOD\ 8VHUFRQILJXUDEOHYLVXDOLQGLFDWLRQRIGDWDLQD PHWHU '13 $UREXVWQRQSURSULHWDU\SURWRFROEDVHGRQ H[LVWLQJRSHQVWDQGDUGV'13LVXVHGWR RSHUDWHEHWZHHQYDULRXVV\VWHPVLQHOHFWULFDQG RWKHUXWLOLW\LQGXVWULHVDQG6&$'$QHWZRUNV ((3520 1RQYRODWLOHPHPRU\(OHFWULFDOO\(UDVDEOH 3URJUDPPDEOH5HDG2QO\0HPRU\WKDWUHWDLQVLWV GDWDGXULQJDSRZHURXWDJHZLWKRXWQHHGIRUD EDWWHU\$OVRUHIHUVWRPHWHU¶V)/$6+PHPRU\ (QHUJ\5HJLVWHU 3URJUDPPDEOHUHFRUGWKDWPRQLWRUVDQ\HQHUJ\ TXDQWLW\([DPSOH:DWWKRXUV9$5KRXUV 9$KRXUV (WKHUQHW $W\SHRI/$1QHWZRUNFRQQHFWLRQWKDWFRQQHFWV WZRRUPRUHGHYLFHVRQDFRPPRQFRPPXQL FDWLRQVEDFNERQH$Q(WKHUQHW/$1FRQVLVWVRIDW OHDVWRQHKXEGHYLFHWKHQHWZRUNEDFNERQHZLWK PXOWLSOHGHYLFHVFRQQHFWHGWRLWLQDVWDUFRQILJX UDWLRQ7KHPRVWFRPPRQYHUVLRQVRI(WKHUQHWLQ XVHDUH%DVH7DQG%DVH7DVGHILQHGLQ ,(((VWDQGDUGV+RZHYHUVHYHUDORWKHU YHUVLRQVRI(WKHUQHWDUHDOVRDYDLODEOH )OLFNHU )OLFNHULVWKHVHQVDWLRQWKDWLVH[SHULHQFHGE\WKH KXPDQYLVXDOV\VWHPZKHQLWLVVXEMHFWHGWR Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions'RF# ( */ *ORVVDU\ FKDQJHVRFFXUULQJLQWKHLOOXPLQDWLRQLQWHQVLW\RI OLJKWVRXUFHV,(&DQGIRUPHU,(& GHVFULEHWKHPHWKRGVXVHGWRGHWHUPLQH )OLFNHUVHYHULW\ +DUPRQLFV 0HDVXULQJYDOXHVRIWKHIXQGDPHQWDOFXUUHQWDQG 9ROWDJHDQGSHUFHQWRIWKHIXQGDPHQWDO +HDUWEHDW3XOVH (QHUJ\LQGLFDWRURQWKHIDFHRIWKH1H[XV PHWHUSXOVHVDUHJHQHUDWHGSHUWKH SURJUDPPHG.HYDOXH ,77KUHVKROG 'DWDZLOOQRWDFFXPXODWHXQWLOFXUUHQWUHDFKHV SURJUDPPHGOHYHO ,QWHJHU $Q\RIWKHQDWXUDOQXPEHUVWKHQHJDWLYHVRI WKRVHQXPEHUVRU]HUR ,QWHUQDO0RGHP $QRSWLRQDOPRGHPZLWKLQWKHPHWHU¶VHQFORVXUH WKDWFRQQHFWVWRWKH5-WHOHSKRQHFRQQHFWRU ,QYDOLG5HJLVWHU ,QWKH1H[XVPHWHU¶V0RGEXV0DSWKHUHDUH JDSVEHWZHHQ5HJLVWHUV)RUH[DPSOHWKHQH[W 5HJLVWHUDIWHULV$Q\XQPDSSHG 5HJLVWHUVWRUHVQRLQIRUPDWLRQDQGLVVDLGWREH LQYDOLG ,7,&&XUYH $QXSGDWHGYHUVLRQRIWKH&%(0$&XUYHWKDW UHIOHFWVIXUWKHUVWXG\LQWRWKHSHUIRUPDQFHRI PLFURSURFHVVRUGHYLFHV7KHFXUYHFRQVLVWVRID VHULHVRIVWHSVEXWVWLOOGHILQHVFRPELQDWLRQVRI 9ROWDJHPDJQLWXGHDQGGXUDWLRQWKDWZLOOFDXVH PDOIXQFWLRQRUGDPDJH .H Electro Industries/GaugeTech N:KSHUSXOVHLHWKHHQHUJ\ The Leader In Power Monitoring and Smart Grid Solutions'RF# ( */ *ORVVDU\ N:K .LORZDWWKRXUVN:[GHPDQGLQWHUYDOLQKRXUV .<=2XWSXW 2XWSXWZKHUHWKHUDWHRIFKDQJHVEHWZHHQDQG UHIOHFWVWKHPDJQLWXGHRIDPHWHUHGTXDQWLW\ /&' /LTXLG&U\VWDO'LVSOD\ /(' /LJKW(PLWWLQJ'LRGH 0D[LPXP'HPDQG 7KHODUJHVWGHPDQGFDOFXODWHGGXULQJDQ\LQWHUYDO RYHUDELOOLQJSHULRG 0RGEXV$6&,, $OWHUQDWHYHUVLRQRIWKH0RGEXVSURWRFROWKDW XWLOL]HVDGLIIHUHQWGDWDWUDQVIHUIRUPDW7KLV YHUVLRQLVQRWGHSHQGHQWXSRQVWULFWWLPLQJDVLV WKH578YHUVLRQ7KLVLVWKHEHVWFKRLFHIRU WHOHFRPPXQLFDWLRQVDSSOLFDWLRQVYLDPRGHPV 0RGEXV578 7KHPRVWFRPPRQIRUPRI0RGEXVSURWRFRO 0RGEXV578LVDQRSHQSURWRFROVSRNHQE\PDQ\ ILHOGGHYLFHVWRHQDEOHGHYLFHVIURPPXOWLSOH YHQGRUVWRFRPPXQLFDWHLQDFRPPRQODQJXDJH 'DWDLVWUDQVPLWWHGLQDWLPHGELQDU\IRUPDW SURYLGLQJLQFUHDVHGWKURXJKSXWDQGWKHUHIRUH LQFUHDVHGSHUIRUPDQFH 1HWZRUN $FRPPXQLFDWLRQVFRQQHFWLRQEHWZHHQWZRRU PRUHGHYLFHVWRHQDEOHWKRVHGHYLFHVWRVHQGWR DQGUHFHLYHGDWDIURPRQHDQRWKHU,QPRVW DSSOLFDWLRQVWKHQHWZRUNLVHLWKHUDVHULDOW\SHRU D/$1W\SH 195$0 1RQYRODWLOH5DQGRP$FFHVV0HPRU\DEOHWR NHHSWKHVWRUHGYDOXHVLQPHPRU\HYHQGXULQJ WKHORVVRIFLUFXLWRUFRQWUROSRZHU+LJKVSHHG 195$0LVXVHGLQWKH1H[XVPHWHUWRJDWKHU Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions'RF# ( */ *ORVVDU\ PHDVXUHGLQIRUPDWLRQDQGWRLQVXUHWKDWQR LQIRUPDWLRQLVORVW 2SWLFDO3RUW $SRUWWKDWIDFLOLWDWHVLQIUDUHGFRPPXQLFDWLRQZLWK DPHWHU8VLQJDQ$16,&7\SH,,PDJQHWLF RSWLFDOFRPPXQLFDWLRQVFRXSOHUDQGDQ56 FDEOHIURPWKHFRXSOHUWRD3&WKHPHWHUFDQEH SURJUDPPHGZLWK&RPPXQLFDWRU(;7VRIWZDUH 3DFNHW $VKRUWIL[HGOHQJWKVHFWLRQRIGDWDWKDWLV WUDQVPLWWHGDVDXQLW([DPSOHDVHULDOVWULQJRI ELWE\WHV 3HUFHQW7+' 3HUFHQW7RWDO+DUPRQLF'LVWRUWLRQ6HH7+' 3URWRFRO $ODQJXDJHWKDWLVVSRNHQEHWZHHQWZRRUPRUH GHYLFHVFRQQHFWHGRQDQHWZRUN 375DWLR 3RWHQWLDO7UDQVIRUPHU5DWLRXVHGWRVFDOHWKH YDOXHRIWKH9ROWDJHWRWKHSULPDU\VLGHRIDQ LQVWUXPHQWWUDQVIRUPHU$OVRUHIHUUHGWRDV97 5DWLR 3XOVH 7KHFORVLQJDQGRSHQLQJRIWKHFLUFXLWRIDWZR ZLUHSXOVHV\VWHPRUWKHDOWHUQDWHFORVLQJDQG RSHQLQJRIRQHVLGHDQGWKHQWKHRWKHURIDWKUHH ZLUHV\VWHPZKLFKLVHTXDOWRWZRSXOVHV 45HDGLQJV 4LVWKHTXDQWLW\REWDLQHGE\ODJJLQJWKHDSSOLHG 9ROWDJHWRDZDWWPHWHUE\GHJUHHV9DOXHVDUH GLVSOD\HGRQWKH8QFRPSHQVDWHG3RZHUDQG4 5HDGLQJVVFUHHQ Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions'RF# ( */ *ORVVDU\ 4XDGUDQW 3URJUDPPDEOH9DOXHVDQG )DFWRUVRQWKH1H[XV PHWHU :DWWDQG9$5IORZLVW\SLFDOO\UHSUHVHQWHGXVLQJ DQ;<FRRUGLQDWHV\VWHP7KHIRXUFRUQHUVRIWKH ;<SODQHDUHUHIHUUHGWRDVTXDGUDQWV0RVW SRZHUDSSOLFDWLRQVODEHOWKHULJKWKDQGFRUQHUDV WKHILUVWTXDGUDQWDQGQXPEHUWKHUHPDLQLQJ TXDGUDQWVLQDFRXQWHUFORFNZLVHURWDWLRQ)ROORZ LQJDUHWKHSRVLWLRQVRIWKHTXDGUDQWV VWXSSHUULJKWQGXSSHUOHIWUGORZHUOHIW DQGWKORZHUULJKW 3RZHUIORZLVJHQHUDOO\SRVLWLYHLQTXDGUDQWV DQG 9$5IORZLVSRVLWLYHLQTXDGUDQWVDQG 7KHPRVWFRPPRQORDGFRQGLWLRQVDUH 4XDGUDQWSRZHUIORZSRVLWLYH9$5IORZ SRVLWLYHLQGXFWLYHORDGODJJLQJRUSRVLWLYH SRZHUIDFWRU 4XDGUDQWSRZHUIORZQHJDWLYH9$5IORZ SRVLWLYHFDSDFLWLYHORDGOHDGLQJRUQHJDWLYH SRZHUIDFWRU 5HJLVWHU $QHQWU\RUUHFRUGWKDWVWRUHVDVPDOODPRXQWRI GDWD 5HJLVWHU5ROORYHU $SRLQWDWZKLFKD5HJLVWHUUHDFKHVLWVPD[LPXP YDOXHDQGUROOVRYHUWR]HUR 5HVHW /RJVDUHFOHDUHGRUQHZRUGHIDXOWYDOXHVDUH VHQWWRFRXQWHUVRUWLPHUV 5ROOLQJ:LQGRZ 7KH5ROOLQJ6OLGLQJ:LQGRZ$YHUDJHLVWKH $YHUDJH3RZHU DYHUDJHSRZHUFDOFXODWHGRYHUDXVHUVHWWLPH LQWHUYDOWKDWLVGHULYHGIURPDVSHFLILHGQXPEHURI VXELQWHUYDOVHDFKRIDVSHFLILHGWLPH)RU Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions'RF# ( */ *ORVVDU\ H[DPSOHWKHDYHUDJHLVFDOFXODWHGRYHUD PLQXWHLQWHUYDOE\FDOFXODWLQJWKHVXPRIWKH DYHUDJHRIWKUHHFRQVHFXWLYHPLQXWHLQWHUYDOV 7KLVGHPDQGFDOFXODWLRQPHWKRGRORJ\KDVEHHQ DGRSWHGE\VHYHUDOXWLOLWLHVWRSUHYHQWFXVWRPHU PDQLSXODWLRQRIN:GHPDQGE\VLPSO\VSUHDGLQJ SHDNGHPDQGDFURVVWZRLQWHUYDOV 56 $W\SHRIVHULDOQHWZRUNFRQQHFWLRQWKDWFRQQHFWV WZRGHYLFHVWRHQDEOHFRPPXQLFDWLRQEHWZHHQ WKHGHYLFHV$Q56FRQQHFWLRQFRQQHFWVRQO\ WZRSRLQWV'LVWDQFHEHWZHHQGHYLFHVLVW\SLFDOO\ OLPLWHGWRIDLUO\VKRUWUXQV &XUUHQWVWDQGDUGVUHFRPPHQGDPD[LPXPRI IHHWEXWVRPHXVHUVKDYHKDGVXFFHVVZLWKUXQV XSWRIHHW &RPPXQLFDWLRQVVSHHGLVW\SLFDOO\LQWKHUDQJHRI ELWVSHUVHFRQGWRELWVSHUVHFRQG 56FRQQHFWLRQFDQEHDFFRPSOLVKHGXVLQJ3RUW RIWKH1H[XVPHWHU 56 $W\SHRIVHULDOQHWZRUNFRQQHFWLRQWKDWFRQQHFWV WZRRUPRUHGHYLFHVWRHQDEOHFRPPXQLFDWLRQ EHWZHHQWKHGHYLFHV$Q56FRQQHFWLRQDOORZV PXOWLGURSFRPPXQLFDWLRQIURPRQHWRPDQ\ SRLQWV 'LVWDQFHEHWZHHQGHYLFHVLVW\SLFDOO\OLPLWHGWR DURXQGWRZLUHIHHW &RPPXQLFDWLRQVVSHHGLVW\SLFDOO\LQWKHUDQJHRI ELWVSHUVHFRQGWRELWVSHUVHFRQG 6DJ $9ROWDJHTXDOLW\HYHQWGXULQJZKLFKWKH506 9ROWDJHLVORZHUWKDQQRUPDOIRUDSHULRGRIWLPH W\SLFDOO\IURPF\FOHWRPLQXWH Electro Industries/GaugeTech The Leader In Power Monitoring and Smart Grid Solutions'RF# ( */ *ORVVDU\ 6HFRQGDU\5DWHG $Q\5HJLVWHURUSXOVHRXWSXWWKDWGRHVQRWXVH DQ\&7RU37975DWLR 6HULDO3RUW 7KHW\SHRISRUWXVHGWRGLUHFWO\LQWHUIDFHZLWKD GHYLFHXVLQJWKH56VWDQGDUG 6ZHOO $9ROWDJHTXDOLW\HYHQWGXULQJZKLFKWKH506 9ROWDJHLVKLJKHUWKDQQRUPDOIRUDSHULRGRIWLPH W\SLFDOO\IURPF\FOHWRPLQXWH 7'' 7KH7RWDO'HPDQG'LVWRUWLRQRIWKHFXUUHQW ZDYHIRUP7KHUDWLRRIWKHURRWVXPVTXDUHYDOXH RIWKHKDUPRQLFFXUUHQWWRWKHPD[LPXPGHPDQG ORDGFXUUHQW6HHHTXDWLRQEHORZ NOTE7KH7''GLVSOD\HGLQWKH+DUPRQLFV VFUHHQLVFDOFXODWHGE\&RPPXQLFDWRU(;7 VRIWZDUHXVLQJWKH0D[$YHUDJH'HPDQG 1TDD 7+' I 22 I 32 I 42 I 52 ...x100% IL 7RWDO+DUPRQLF'LVWRUWLRQLVWKHFRPELQHGHIIHFW RIDOOKDUPRQLFVPHDVXUHGLQD9ROWDJHRUFXUUHQW 7KH7+'QXPEHULVH[SUHVVHGDVDSHUFHQWRIWKH IXQGDPHQWDO)RUH[DPSOHD7+'LQGLFDWHV WKDWWKHPDJQLWXGHRIDOOKDUPRQLFGLVWRUWLRQ PHDVXUHGHTXDOVRIWKHPDJQLWXGHRIWKH IXQGDPHQWDO+]TXDQWLW\7KH7+'GLVSOD\HG LVFDOFXODWHGE\\RXU1H[XVPHWHU 7LPH6WDPS $VWRUHGUHSUHVHQWDWLRQRIWKHWLPHRIDQHYHQW 7LPH6WDPSFDQLQFOXGH\HDUPRQWKGD\KRXU PLQXWHVHFRQGDQG'D\OLJKW6DYLQJV7LPH LQGLFDWLRQ Electro Industries/GaugeTech 'RF# The Leader In Power Monitoring and Smart Grid Solutions ( */ *ORVVDU\ 728 7LPHRI8VH 8QFRPSHQVDWHG 3RZHU 9$:DWWDQG9$5UHDGLQJVQRWDGMXVWHGE\ 7UDQVIRUPHU/RVV&RPSHQVDWLRQ 977KUHVKROG 'DWDZLOOVWRSDFFXPXODWLQJZKHQ9ROWDJHIDOOV EHORZSURJUDPPHGOHYHO 9ROWDJH,PEDODQFH 7KHUDWLRRIWKH9ROWDJHRQDSKDVHWRWKHDYHUDJH 9ROWDJHRQDOOSKDVHV 9ROWDJH4XDOLW\(YHQW $QLQVWDQFHRIDEQRUPDO9ROWDJHRQDSKDVH7KH HYHQWVWKHPHWHUWUDFNVLQFOXGHVDJVVZHOOV LQWHUUXSWLRQVDQGLPEDODQFHV 975DWLR 7KH9ROWDJH7UDQVIRUPHU5DWLRLVXVHGWRVFDOHWKH YDOXHRIWKH9ROWDJHWRWKHSULPDU\VLGHRIDQ LQVWUXPHQWWUDQVIRUPHU$OVRUHIHUUHGWRDV37 5DWLR 9ROWDJH9DE 9DE9EF9FDDUHDOO3KDVHWR3KDVH9ROWDJH PHDVXUHPHQWV7KHVH9ROWDJHVDUHPHDVXUHG EHWZHHQWKHWKUHHSKDVH9ROWDJHLQSXWVWRWKH PHWHU 9ROWDJH9DQ 9DQ9EQ9FQDUHDOO3KDVHWR1HXWUDO9ROWDJHV DSSOLHGWRWKHPRQLWRU7KHVH9ROWDJHVDUH PHDVXUHGEHWZHHQWKHSKDVH9ROWDJHLQSXWVDQG 9QLQSXWWRWKHPHWHU7HFKQRORJLFDOO\WKHVH 9ROWDJHVFDQEH³PHDVXUHG´HYHQZKHQWKHPHWHU LVLQD'HOWDFRQILJXUDWLRQDQGWKHUHLVQRFRQQHF WLRQWRWKH9QLQSXW+RZHYHULQWKLVFRQILJX UDWLRQWKHVH9ROWDJHVKDYHOLPLWHGPHDQLQJDQG DUHW\SLFDOO\QRWUHSRUWHG Electro Industries/GaugeTech 'RF# The Leader In Power Monitoring and Smart Grid Solutions ( */ *ORVVDU\ 9ROWDJH9DX[ 7KLVLVWKHIRXUWK9ROWDJHLQSXWPHDVXUHGIURP EHWZHHQWKH9DX[DQG9UHILQSXWV7KLVLQSXWFDQ EHVFDOHGWRDQ\YDOXH+RZHYHUWKHDFWXDOLQSXW 9ROWDJHWRWKHPHWHUVKRXOGEHRIWKHVDPH PDJQLWXGHDVWKH9ROWDJHVDSSOLHGWRWKH9D9E DQG9FWHUPLQDOV Electro Industries/GaugeTech 'RF# The Leader In Power Monitoring and Smart Grid Solutions ( */